Basic Information | |
---|---|
Family ID | F084140 |
Family Type | Metagenome |
Number of Sequences | 112 |
Average Sequence Length | 44 residues |
Representative Sequence | MYTIGKHITIWQRQQSEADLDEVLMGAEAFHAIAKELKRRSKSVL |
Number of Associated Samples | 87 |
Number of Associated Scaffolds | 112 |
Quality Assessment | |
---|---|
Transcriptomic Evidence | No |
Most common taxonomic group | Viruses |
% of genes with valid RBS motifs | 63.96 % |
% of genes near scaffold ends (potentially truncated) | 28.57 % |
% of genes from short scaffolds (< 2000 bps) | 48.21 % |
Associated GOLD sequencing projects | 81 |
AlphaFold2 3D model prediction | Yes |
3D model pTM-score | 0.65 |
Hidden Markov Model |
---|
Powered by Skylign |
Most Common Taxonomy | |
---|---|
Group | Duplodnaviria (64.286 % of family members) |
NCBI Taxonomy ID | 2731341 |
Taxonomy | All Organisms → Viruses → Duplodnaviria |
Most Common Ecosystem | |
---|---|
GOLD Ecosystem | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake (15.179 % of family members) |
Environment Ontology (ENVO) | Unclassified (77.679 % of family members) |
Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Water (non-saline) (75.000 % of family members) |
⦗Top⦘ |
⦗Top⦘ |
Predicted Topology & Secondary Structure | |||||
---|---|---|---|---|---|
Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 53.42% β-sheet: 0.00% Coil/Unstructured: 46.58% | Feature Viewer |
|
|||||
Powered by Feature Viewer |
Structure Viewer | |
---|---|
| |
Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.65 |
Powered by PDBe Molstar |
⦗Top⦘ |
Pfam ID | Name | % Frequency in 112 Family Scaffolds |
---|---|---|
PF13619 | KTSC | 25.00 |
PF03237 | Terminase_6N | 17.86 |
PF05133 | Phage_prot_Gp6 | 8.04 |
PF07691 | PA14 | 1.79 |
PF09723 | Zn-ribbon_8 | 1.79 |
PF11662 | DUF3263 | 0.89 |
PF05257 | CHAP | 0.89 |
PF02467 | Whib | 0.89 |
PF13673 | Acetyltransf_10 | 0.89 |
PF01391 | Collagen | 0.89 |
PF13392 | HNH_3 | 0.89 |
PF13155 | Toprim_2 | 0.89 |
PF02195 | ParBc | 0.89 |
PF02945 | Endonuclease_7 | 0.89 |
PF01844 | HNH | 0.89 |
PF03767 | Acid_phosphat_B | 0.89 |
COG ID | Name | Functional Category | % Frequency in 112 Family Scaffolds |
---|---|---|---|
COG2503 | Predicted secreted acid phosphatase | General function prediction only [R] | 0.89 |
COG3700 | Acid phosphatase, class B | Inorganic ion transport and metabolism [P] | 0.89 |
⦗Top⦘ |
Name | Rank | Taxonomy | Distribution |
All Organisms | root | All Organisms | 95.54 % |
Unclassified | root | N/A | 4.46 % |
Visualization |
---|
Powered by ApexCharts |
Scaffold | Taxonomy | Length | IMG/M Link |
---|---|---|---|
2035265000|ErSWdraf_F5BXKTZ02IF1J0 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 537 | Open in IMG/M |
3300000176|TB03JUN2009E_c000115 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 24055 | Open in IMG/M |
3300000553|TBL_comb47_HYPODRAFT_10078361 | All Organisms → Viruses → Predicted Viral | 1775 | Open in IMG/M |
3300000756|JGI12421J11937_10000109 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 27541 | Open in IMG/M |
3300001836|RCM27_1029647 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Thermomonosporaceae → Actinomadura → Actinomadura atramentaria | 901 | Open in IMG/M |
3300001837|RCM39_1039969 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 587 | Open in IMG/M |
3300002091|JGI24028J26656_1000788 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 8538 | Open in IMG/M |
3300002091|JGI24028J26656_1001641 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Thermomonosporaceae → Actinomadura → Actinomadura atramentaria | 4729 | Open in IMG/M |
3300002092|JGI24218J26658_1007104 | All Organisms → Viruses → Predicted Viral | 2094 | Open in IMG/M |
3300002307|JGI24890J29729_1006271 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 3629 | Open in IMG/M |
3300002307|JGI24890J29729_1026468 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1296 | Open in IMG/M |
3300003375|JGI26470J50227_1000226 | All Organisms → cellular organisms → Bacteria | 25649 | Open in IMG/M |
3300003653|SLW02_104093 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1070 | Open in IMG/M |
3300003813|Ga0007879_1020753 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 671 | Open in IMG/M |
3300003815|Ga0007856_1000064 | All Organisms → Viruses | 11596 | Open in IMG/M |
3300004461|Ga0066223_1399179 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 933 | Open in IMG/M |
3300004692|Ga0065171_1021682 | All Organisms → Viruses → Predicted Viral | 1033 | Open in IMG/M |
3300004805|Ga0007792_10270197 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 522 | Open in IMG/M |
3300004805|Ga0007792_10281579 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 510 | Open in IMG/M |
3300005528|Ga0068872_10074606 | Not Available | 2067 | Open in IMG/M |
3300005581|Ga0049081_10000069 | All Organisms → cellular organisms → Bacteria | 36163 | Open in IMG/M |
3300005582|Ga0049080_10017820 | All Organisms → Viruses → Predicted Viral | 2476 | Open in IMG/M |
3300005584|Ga0049082_10003326 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 5224 | Open in IMG/M |
3300005584|Ga0049082_10045384 | All Organisms → Viruses → Predicted Viral | 1539 | Open in IMG/M |
3300005805|Ga0079957_1014437 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 5773 | Open in IMG/M |
3300005805|Ga0079957_1016564 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micrococcales → Intrasporangiaceae → Terracoccus → unclassified Terracoccus → Terracoccus sp. 273MFTsu3.1 | 5294 | Open in IMG/M |
3300005805|Ga0079957_1021419 | All Organisms → cellular organisms → Bacteria | 4496 | Open in IMG/M |
3300005805|Ga0079957_1229481 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 875 | Open in IMG/M |
3300006072|Ga0007881_1001201 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 10364 | Open in IMG/M |
3300006112|Ga0007857_1020786 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1395 | Open in IMG/M |
3300006641|Ga0075471_10180235 | All Organisms → Viruses → Predicted Viral | 1107 | Open in IMG/M |
3300007165|Ga0079302_1002281 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 5312 | Open in IMG/M |
3300007177|Ga0102978_1096175 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 4843 | Open in IMG/M |
3300007212|Ga0103958_1169325 | All Organisms → Viruses → Predicted Viral | 1772 | Open in IMG/M |
3300009159|Ga0114978_10427971 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 788 | Open in IMG/M |
3300009183|Ga0114974_10229682 | All Organisms → Viruses → Predicted Viral | 1119 | Open in IMG/M |
3300009183|Ga0114974_10233235 | All Organisms → Viruses → Predicted Viral | 1108 | Open in IMG/M |
3300009185|Ga0114971_10282818 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 963 | Open in IMG/M |
3300010354|Ga0129333_11659713 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 521 | Open in IMG/M |
3300010370|Ga0129336_10663376 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 554 | Open in IMG/M |
3300012006|Ga0119955_1163619 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 577 | Open in IMG/M |
3300017774|Ga0181358_1207967 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 637 | Open in IMG/M |
3300020159|Ga0211734_10411920 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 14135 | Open in IMG/M |
3300020159|Ga0211734_10446284 | All Organisms → Viruses → Predicted Viral | 1251 | Open in IMG/M |
3300020161|Ga0211726_10265857 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 4356 | Open in IMG/M |
3300020172|Ga0211729_10473144 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 700 | Open in IMG/M |
3300020205|Ga0211731_11040262 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1747 | Open in IMG/M |
3300020533|Ga0208364_1002585 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 3386 | Open in IMG/M |
3300020548|Ga0208856_1022695 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 904 | Open in IMG/M |
3300020555|Ga0208358_1000207 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 21610 | Open in IMG/M |
3300020718|Ga0214178_1002334 | All Organisms → Viruses → Predicted Viral | 3961 | Open in IMG/M |
3300021136|Ga0214167_1029815 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1252 | Open in IMG/M |
3300021136|Ga0214167_1094231 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 556 | Open in IMG/M |
3300021139|Ga0214166_1000769 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 15371 | Open in IMG/M |
3300021139|Ga0214166_1021927 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1603 | Open in IMG/M |
3300021142|Ga0214192_1000051 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 66833 | Open in IMG/M |
3300021519|Ga0194048_10039615 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1942 | Open in IMG/M |
3300021519|Ga0194048_10059926 | All Organisms → Viruses → Predicted Viral | 1515 | Open in IMG/M |
3300021519|Ga0194048_10086272 | All Organisms → Viruses → Predicted Viral | 1219 | Open in IMG/M |
3300021961|Ga0222714_10019785 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 5307 | Open in IMG/M |
3300021961|Ga0222714_10214865 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1101 | Open in IMG/M |
3300022407|Ga0181351_1198264 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 674 | Open in IMG/M |
3300022591|Ga0236341_1001456 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 13234 | Open in IMG/M |
3300022591|Ga0236341_1018248 | All Organisms → Viruses → Predicted Viral | 2212 | Open in IMG/M |
3300023174|Ga0214921_10001022 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 48871 | Open in IMG/M |
3300023174|Ga0214921_10007495 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 14531 | Open in IMG/M |
3300023174|Ga0214921_10069184 | All Organisms → Viruses → Predicted Viral | 2895 | Open in IMG/M |
3300023184|Ga0214919_10079549 | Not Available | 2904 | Open in IMG/M |
3300023311|Ga0256681_11208500 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 732 | Open in IMG/M |
3300024343|Ga0244777_10001546 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 16423 | Open in IMG/M |
3300025372|Ga0207957_1002452 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 3482 | Open in IMG/M |
3300025387|Ga0207959_1054528 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 596 | Open in IMG/M |
3300025598|Ga0208379_1008998 | All Organisms → Viruses → Predicted Viral | 3080 | Open in IMG/M |
3300027114|Ga0208009_1006355 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 3072 | Open in IMG/M |
3300027586|Ga0208966_1028283 | All Organisms → Viruses → Predicted Viral | 1639 | Open in IMG/M |
3300027608|Ga0208974_1000981 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 11363 | Open in IMG/M |
3300027608|Ga0208974_1063642 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1034 | Open in IMG/M |
3300027708|Ga0209188_1000106 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 96036 | Open in IMG/M |
3300027708|Ga0209188_1000706 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 30734 | Open in IMG/M |
(restricted) 3300027730|Ga0247833_1006020 | All Organisms → cellular organisms → Bacteria | 13764 | Open in IMG/M |
3300027736|Ga0209190_1005496 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 8091 | Open in IMG/M |
3300027736|Ga0209190_1034128 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 2701 | Open in IMG/M |
3300027741|Ga0209085_1391402 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 503 | Open in IMG/M |
3300027749|Ga0209084_1026021 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 3075 | Open in IMG/M |
3300027754|Ga0209596_1003013 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 13515 | Open in IMG/M |
3300027754|Ga0209596_1009219 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 6719 | Open in IMG/M |
3300027760|Ga0209598_10393658 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 509 | Open in IMG/M |
3300027770|Ga0209086_10000052 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales | 101191 | Open in IMG/M |
3300027782|Ga0209500_10004133 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 9676 | Open in IMG/M |
3300027793|Ga0209972_10382181 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 602 | Open in IMG/M |
3300027808|Ga0209354_10119983 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1073 | Open in IMG/M |
3300027963|Ga0209400_1353180 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 543 | Open in IMG/M |
3300027969|Ga0209191_1241986 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 691 | Open in IMG/M |
(restricted) 3300028569|Ga0247843_1005327 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 18021 | Open in IMG/M |
3300031758|Ga0315907_10000165 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 97292 | Open in IMG/M |
3300031758|Ga0315907_10254783 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1455 | Open in IMG/M |
3300031813|Ga0316217_10034512 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 3005 | Open in IMG/M |
3300031857|Ga0315909_10046270 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 4067 | Open in IMG/M |
3300031951|Ga0315904_10044266 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 5028 | Open in IMG/M |
3300031951|Ga0315904_10341179 | All Organisms → Viruses → Predicted Viral | 1384 | Open in IMG/M |
3300031951|Ga0315904_10398579 | Not Available | 1248 | Open in IMG/M |
3300033980|Ga0334981_0171301 | All Organisms → Viruses → Predicted Viral | 1027 | Open in IMG/M |
3300033981|Ga0334982_0090041 | All Organisms → Viruses → Predicted Viral | 1631 | Open in IMG/M |
3300033993|Ga0334994_0253722 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 919 | Open in IMG/M |
3300033994|Ga0334996_0013070 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 5494 | Open in IMG/M |
3300034021|Ga0335004_0046513 | All Organisms → Viruses → Predicted Viral | 3056 | Open in IMG/M |
3300034062|Ga0334995_0001090 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 29324 | Open in IMG/M |
3300034112|Ga0335066_0035540 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 3408 | Open in IMG/M |
3300034112|Ga0335066_0666148 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 530 | Open in IMG/M |
3300034120|Ga0335056_0369180 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 779 | Open in IMG/M |
3300034356|Ga0335048_0057471 | Not Available | 2481 | Open in IMG/M |
Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
⦗Top⦘ |
Habitat | Taxonomy | Distribution |
Freshwater Lake | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake | 15.18% |
Freshwater | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater | 14.29% |
Freshwater | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater | 11.61% |
Freshwater | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater | 8.93% |
Freshwater | Environmental → Aquatic → Freshwater → Lentic → Epilimnion → Freshwater | 6.25% |
Freshwater Lentic | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lentic | 6.25% |
Freshwater | Environmental → Aquatic → Freshwater → Unclassified → Unclassified → Freshwater | 5.36% |
Freshwater Lake | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lake | 4.46% |
Lentic | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Lentic | 4.46% |
Freshwater | Environmental → Aquatic → Freshwater → Lentic → Hypolimnion → Freshwater | 3.57% |
Lake | Environmental → Aquatic → Freshwater → Lake → Unclassified → Lake | 3.57% |
Anoxic Zone Freshwater | Environmental → Aquatic → Freshwater → Lake → Unclassified → Anoxic Zone Freshwater | 2.68% |
Freshwater Lake | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake | 1.79% |
Marine Plankton | Environmental → Aquatic → Freshwater → Lotic → Unclassified → Marine Plankton | 1.79% |
Freshwater To Marine Saline Gradient | Environmental → Aquatic → Marine → Coastal → Unclassified → Freshwater To Marine Saline Gradient | 1.79% |
Estuarine Water | Environmental → Aquatic → Marine → Unclassified → Unclassified → Estuarine Water | 1.79% |
Deep Subsurface | Environmental → Terrestrial → Deep Subsurface → Unclassified → Unclassified → Deep Subsurface | 1.79% |
Freshwater And Sediment | Environmental → Aquatic → Freshwater → Lentic → Hypolimnion → Freshwater And Sediment | 0.89% |
Subglacial Freshwater | Environmental → Aquatic → Freshwater → Ice → Glacial Lake → Subglacial Freshwater | 0.89% |
Aqueous | Environmental → Aquatic → Marine → Coastal → Unclassified → Aqueous | 0.89% |
Marine | Environmental → Aquatic → Marine → Coastal → Unclassified → Marine | 0.89% |
Estuarine | Environmental → Aquatic → Marine → Intertidal Zone → Estuary → Estuarine | 0.89% |
Visualization |
---|
Powered by ApexCharts |
Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
Taxon OID | Sample Name | Habitat Type | IMG/M Link |
---|---|---|---|
2035265000 | Freshwater microbial communities from Swedish Lakes - surface of Lake Erken | Environmental | Open in IMG/M |
3300000176 | Freshwater microbial communities from Trout Bog Lake, WI - Practice 03JUN2009 epilimnion | Environmental | Open in IMG/M |
3300000553 | Trout Bog Lake May 28 2007 Hypolimnion (Trout Bog Lake Combined Assembly 47 Hypolimnion Samples, Aug 2012 Assem) | Environmental | Open in IMG/M |
3300000756 | Freshwater microbial communities from dead zone in Lake Erie, Canada - CCB hypolimnion July 2011 | Environmental | Open in IMG/M |
3300001836 | Marine plankton microbial communities from the Amazon River plume, Atlantic Ocean - RCM27, ROCA_DNA191_0.2um_MCP-N_C_3a | Environmental | Open in IMG/M |
3300001837 | Marine plankton microbial communities from the Amazon River plume, Atlantic Ocean - RCM39, ROCA_DNA237_0.2um_Ob_C_3a | Environmental | Open in IMG/M |
3300002091 | Lentic bog actinobacteria communities from Grosse Fuchskuhle, Germany - Sample acI-B2 co-culture F-F8 metagenome | Environmental | Open in IMG/M |
3300002092 | Lentic bog actinobacteria communities from Grosse Fuchskuhle, Germany - Sample acI-B2 co-culture F-B6 metagenome | Environmental | Open in IMG/M |
3300002307 | Lentic bog actinobacteria communities from Grosse Fuchskuhle, Germany - Sample acI-C2 co-culture F-D7 | Environmental | Open in IMG/M |
3300003375 | Freshwater actinobacteria microbial communities from Trout Bog Lake, Wisconsin, USA - enrichment TB-E6 | Environmental | Open in IMG/M |
3300003653 | Subglacial freshwater microbial communities from Lake Whillans, Antarctica - 0.2 micron filter | Environmental | Open in IMG/M |
3300003813 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBH15Jun09 | Environmental | Open in IMG/M |
3300003815 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBH27Jun07 | Environmental | Open in IMG/M |
3300004461 | Marine viral communities from Newfoundland, Canada BC-2 | Environmental | Open in IMG/M |
3300004692 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBE27Jun07 (version 2) | Environmental | Open in IMG/M |
3300004805 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - MA6M | Environmental | Open in IMG/M |
3300005528 | Freshwater lake microbial communities from Lake Erie, under a cyanobacterial bloom - NOAA_Erie_Diel1S_2200h metaG | Environmental | Open in IMG/M |
3300005581 | Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG ER78MSRF | Environmental | Open in IMG/M |
3300005582 | Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG ER15MSRF | Environmental | Open in IMG/M |
3300005584 | Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG HU45MSRF | Environmental | Open in IMG/M |
3300005805 | Microbial and algae communities from Cheney Reservoir in Wichita, Kansas, USA | Environmental | Open in IMG/M |
3300006072 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBH12Aug09 | Environmental | Open in IMG/M |
3300006112 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBH10Oct08 | Environmental | Open in IMG/M |
3300006641 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_0.19_D_>0.8_DNA | Environmental | Open in IMG/M |
3300007165 | Deep subsurface shale carbon reservoir microbial communities from Ohio, USA - Utica-2 Time Series FC 2014_7_16 | Environmental | Open in IMG/M |
3300007177 | Combined Assembly of cyanobacterial bloom in Marina Bay water reservoir, Singapore (Diel cycle-Surface and Bottom layers) 16 sequencing projects | Environmental | Open in IMG/M |
3300007212 | Combined Assembly of cyanobacterial bloom in Punggol water reservoir, Singapore (Diel cycle-Bottom layer) 7 sequencing projects | Environmental | Open in IMG/M |
3300009159 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_140212_EF_MetaG | Environmental | Open in IMG/M |
3300009183 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130206_EF_MetaG | Environmental | Open in IMG/M |
3300009185 | Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_140625_MF_MetaG | Environmental | Open in IMG/M |
3300010354 | Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Sum_0.6_0.8_DNA | Environmental | Open in IMG/M |
3300010370 | Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Sum_0.6_0.2_DNA | Environmental | Open in IMG/M |
3300012006 | Freshwater microbial communities from Lake Lanier in Georgia, USA - LL_1101B | Environmental | Open in IMG/M |
3300017774 | Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM110.S.D | Environmental | Open in IMG/M |
3300020159 | Freshwater lake microbial communities from Lake Erken, Sweden - P4710_108 megahit1 | Environmental | Open in IMG/M |
3300020160 | Freshwater lake microbial communities from Lake Erken, Sweden - P4710_105 megahit1 | Environmental | Open in IMG/M |
3300020161 | Freshwater lake microbial communities from Lake Erken, Sweden - P4710_101 megahit1 | Environmental | Open in IMG/M |
3300020172 | Freshwater lake microbial communities from Lake Erken, Sweden - P4710_102 megahit1 | Environmental | Open in IMG/M |
3300020205 | Freshwater lake microbial communities from Lake Erken, Sweden - P4710_103 megahit1 | Environmental | Open in IMG/M |
3300020533 | Freshwater microbial communities from Lake Mendota, WI - 08JUN2012 deep hole epilimnion (SPAdes) | Environmental | Open in IMG/M |
3300020548 | Freshwater microbial communities from Lake Mendota, WI - 13JUL2012 deep hole epilimnion (SPAdes) | Environmental | Open in IMG/M |
3300020555 | Freshwater microbial communities from Lake Mendota, WI - 10AUG2009 deep hole epilimnion (SPAdes) | Environmental | Open in IMG/M |
3300020718 | Freshwater microbial communities from Trout Bog Lake, WI - 17SEP2007 epilimnion | Environmental | Open in IMG/M |
3300021136 | Freshwater microbial communities from Trout Bog Lake, WI - Practice 18AUG2009 hypolimnion | Environmental | Open in IMG/M |
3300021139 | Freshwater microbial communities from Trout Bog Lake, WI - Practice 18AUG2009 epilimnion | Environmental | Open in IMG/M |
3300021142 | Freshwater microbial communities from Trout Bog Lake, WI - 29JUL2008 epilimnion | Environmental | Open in IMG/M |
3300021519 | Anoxic zone freshwater microbial communities from boreal shield lake in IISD Experimental Lakes Area, Ontario, Canada - Jun2016-L222-5m | Environmental | Open in IMG/M |
3300021961 | Estuarine water microbial communities from San Francisco Bay, California, United States - C33_3D | Environmental | Open in IMG/M |
3300022407 | Freshwater viral communities from Lake Michigan, USA - Su13.VD.MM15.S.D | Environmental | Open in IMG/M |
3300022591 | Freshwater microbial communities from thermokarst lake SAS2a, Kuujjuarapick, Canada - Sample Summer S2 | Environmental | Open in IMG/M |
3300023174 | Freshwater microbial communities from Lake Lanier, Atlanta, Georgia, United States - LL-1505 | Environmental | Open in IMG/M |
3300023184 | Freshwater microbial communities from Lake Lanier, Atlanta, Georgia, United States - LL-1503 | Environmental | Open in IMG/M |
3300023311 | Combined Assembly of Gp0281739, Gp0281740, Gp0281741 | Environmental | Open in IMG/M |
3300024343 | Combined assembly of estuarine microbial communities from Columbia River, Washington, USA >3um size fraction | Environmental | Open in IMG/M |
3300025372 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBH27Jun07 (SPAdes) | Environmental | Open in IMG/M |
3300025387 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBH20Aug07 (SPAdes) | Environmental | Open in IMG/M |
3300025598 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBE02Aug07 (SPAdes) | Environmental | Open in IMG/M |
3300027114 | Deep subsurface shale carbon reservoir microbial communities from Ohio, USA - Utica-2 Time Series FC 2014_7_16 (SPAdes) | Environmental | Open in IMG/M |
3300027586 | Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG HU45MSRF (SPAdes) | Environmental | Open in IMG/M |
3300027608 | Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG ER15MSRF (SPAdes) | Environmental | Open in IMG/M |
3300027708 | Freshwater microbial communities from Lake Croche, Canada to study carbon cycling - C_130625_EF_MetaG (SPAdes) | Environmental | Open in IMG/M |
3300027730 (restricted) | Freshwater microbial communities from meromictic Lake La Cruz, Castile-La Mancha, Spain - LaCruzMarch2015_8m | Environmental | Open in IMG/M |
3300027736 | Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_140205_XF_MetaG (SPAdes) | Environmental | Open in IMG/M |
3300027741 | Freshwater microbial communities from Lake Croche, Canada to study carbon cycling - C_131016_EF_MetaG (SPAdes) | Environmental | Open in IMG/M |
3300027749 | Freshwater microbial communities from Lake Croche, Canada to study carbon cycling - C_130820_MF_MetaG (SPAdes) | Environmental | Open in IMG/M |
3300027754 | Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_130807_MF_MetaG (SPAdes) | Environmental | Open in IMG/M |
3300027760 | Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_140807_EF_MetaG (SPAdes) | Environmental | Open in IMG/M |
3300027770 | Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_130207_XF_MetaG (SPAdes) | Environmental | Open in IMG/M |
3300027782 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_140212_EF_MetaG (SPAdes) | Environmental | Open in IMG/M |
3300027793 | Freshwater lake microbial communities from Lake Erie, under a cyanobacterial bloom - NOAA_Erie_Diel1S_2200h metaG (SPAdes) | Environmental | Open in IMG/M |
3300027808 | Freshwater lake microbial communities from Lake Michigan, USA - Sp13.BD.MM15.DD (SPAdes) | Environmental | Open in IMG/M |
3300027963 | Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_130807_EF_MetaG (SPAdes) | Environmental | Open in IMG/M |
3300027969 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130626_EF_MetaG (SPAdes) | Environmental | Open in IMG/M |
3300028569 (restricted) | Freshwater microbial communities from meromictic Lake La Cruz, Castile-La Mancha, Spain - LaCruzMarch2017_8m | Environmental | Open in IMG/M |
3300031758 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 12 MA123 | Environmental | Open in IMG/M |
3300031813 | Freshwater microbial communities from Trout Bog Lake, Wisconsin, USA - 1anoA | Environmental | Open in IMG/M |
3300031857 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 2 MA125 | Environmental | Open in IMG/M |
3300031951 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 12 MA120 | Environmental | Open in IMG/M |
3300033980 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME09Aug2015-rr0007 | Environmental | Open in IMG/M |
3300033981 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME24Aug2014-rr0011 | Environmental | Open in IMG/M |
3300033993 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME20Jul2012-rr0037 | Environmental | Open in IMG/M |
3300033994 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME25Jul2006D11-rr0046 | Environmental | Open in IMG/M |
3300034021 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME01Oct2014-rr0057 | Environmental | Open in IMG/M |
3300034062 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME27Jul2012-rr0045 | Environmental | Open in IMG/M |
3300034112 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME27Aug2014-rr0191 | Environmental | Open in IMG/M |
3300034120 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME07Aug2014-rr0172 | Environmental | Open in IMG/M |
3300034356 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME17Jun2014-rr0152 | Environmental | Open in IMG/M |
Geographical Distribution | |
---|---|
Zoom: | Powered by OpenStreetMap |
⦗Top⦘ |
Note: Some of these sequences are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
Protein ID | Sample Taxon ID | Habitat | Sequence |
ErSWdraft_11100530 | 2035265000 | Freshwater | MYTIGKLITEWQKSHNKNLLDEVVLGTEVFHAIAK |
TB03JUN2009E_00011515 | 3300000176 | Freshwater | MHTIGRHITIWQREQSKDDLEEVLMGAEAFYAIAKELKRRSEHTL* |
TBL_comb47_HYPODRAFT_100783612 | 3300000553 | Freshwater | MEQSMHTIGRHITIWQREQSKDDLEEVLMGAEAFYAIAKELKRRSEHTL* |
JGI12421J11937_1000010945 | 3300000756 | Freshwater And Sediment | MYTIGKLITEWQKSHNKNLLDEVVLGTEVFNAIAKELKKRA* |
RCM27_10296473 | 3300001836 | Marine Plankton | PDLISWMEHSMYTIGKSLTSWQRTNDKTQLDDVLMGAEAFHAIAKELKRREV* |
RCM39_10399691 | 3300001837 | Marine Plankton | MYTIGKCITAWQKSPTDEMFDEVVLGAEAFYAIAKELKKRS* |
JGI24028J26656_10007889 | 3300002091 | Lentic | MFTIGKHITSWQRNQTQADLDELLMGAEAFYAIAKELKRRSSSSL* |
JGI24028J26656_10016414 | 3300002091 | Lentic | MFTIGKHITSWQRSQSQADLDEVVMGAEAFSAIAKELKRRSNPVL* |
JGI24218J26658_10071043 | 3300002092 | Lentic | MYTIGKHITVWQRSQSKADLDEVVMGAEAFYAIARELKRRSESRL* |
JGI24890J29729_10062717 | 3300002307 | Lentic | MFTIGKLITEWQRSQNNDALLDEVLMGAEAFHAIAKELKKRA* |
JGI24890J29729_10264681 | 3300002307 | Lentic | MFTIGKXITSWQRSQSQADLDEVVMGAEAFSAIAKELKRR |
JGI26470J50227_100022625 | 3300003375 | Freshwater | MYTIGRLITEWQKSQNDVLLDEVLLGAEAFHAIAKELKKRY* |
SLW02_1040933 | 3300003653 | Subglacial Freshwater | MEHSMYTIGKLMTEWQRSQNSDSLLDEVELGAEAFLAIAKELRSRR* |
Ga0007879_10207532 | 3300003813 | Freshwater | LVAWMEQSMFTIGKHISSWQRTQSKDDLAEVKLGAEVFHAIAQELERRSL* |
Ga0007856_100006412 | 3300003815 | Freshwater | MFTIGKHISSWQXTQSKDDLGEVKLGAEVFYAIAQELERRSL* |
Ga0066223_13991792 | 3300004461 | Marine | MFTIGKCITAWQKNPSDEMLDEVVMGAEAFHAIAKELRRRN* |
Ga0065171_10216822 | 3300004692 | Freshwater | MFTIGKHISSWQRTQSKDDLGEVKLGAEVFYAIAQELERRSL* |
Ga0007792_102701972 | 3300004805 | Freshwater | WMEQSMYILGKNLTSWQRQHSEAELDELLMGAEAFYAIAKELKKRS* |
Ga0007792_102815792 | 3300004805 | Freshwater | MFTVGKSISSWQRHQSEADLDEVVMGAEAFYAIAKELKRRSQSLL* |
Ga0068872_100746062 | 3300005528 | Freshwater Lake | MEHSMFLIGKHITIYQKQNSSADLDEVLMGAEAFHAIAKELKKRHVS* |
Ga0049081_1000006936 | 3300005581 | Freshwater Lentic | MYILGKNLTGWQKHQSDADLDELLMGAEAFYAIAKELKKRS* |
Ga0049080_100178204 | 3300005582 | Freshwater Lentic | TIGKCISAWQKNPSDEMLDEVVMGAEAFHAIAKELRRRN* |
Ga0049082_100033262 | 3300005584 | Freshwater Lentic | MYTIGKHITIWQRQQSEADLDEILMGAEVFHAIAKELKRRSKSVL* |
Ga0049082_100453844 | 3300005584 | Freshwater Lentic | MFTIGKCITAWQKSPTEEMLDEVVMGAEAFYEIAKELKRRA* |
Ga0079957_101443715 | 3300005805 | Lake | MFLIGKHITIYQKQNSAADLDEVLMGAEAFHAIAKELKKRHVL* |
Ga0079957_10165645 | 3300005805 | Lake | MFIIGKHITVWQRQQSEADLDEVLMGAEAFHAIAKELKRRSNPVL* |
Ga0079957_10214192 | 3300005805 | Lake | MYLIGKHITIYQKQNSPADLDEVLMGAEAFHAIAKELKKRHIS* |
Ga0079957_12294812 | 3300005805 | Lake | MYTIGKHITIWQRQQSEADLDEVLMGAEAFHAIAKELKRRSKSVL* |
Ga0007881_10012013 | 3300006072 | Freshwater | MEQSMFTIGKHISSWQRTQSKDDLGEVKLGAEVFYAIAQELERRSL* |
Ga0007857_10207862 | 3300006112 | Freshwater | MEHSMYTIGRLITEWQKSQNDVLLDEVLLGAEAFHAIAKELKKRY* |
Ga0075471_101802352 | 3300006641 | Aqueous | ITAWQRQQSEADLDEVLMGAEAFYAIAKELKRRSNPVL* |
Ga0079302_10022815 | 3300007165 | Deep Subsurface | MYTIGKLITEWQKSHNNDLLDEVVMGTEVFNAIAKELKKRA* |
Ga0102978_10961753 | 3300007177 | Freshwater Lake | MFIIGKHITAWQRQQSEADLDEVLMGAEAFYAIAKELKRRSNPVL* |
Ga0103958_11693252 | 3300007212 | Freshwater Lake | MEHSMYLIGKHITIYQKQNSSADLDEVLMGAEAFHAIAKELKKRHVS* |
Ga0114978_104279712 | 3300009159 | Freshwater Lake | ILWMEQSMYTIGKHITIWQRQQSEADLDEILMGAEAFQAIARELKRRSKTML* |
Ga0114974_102296821 | 3300009183 | Freshwater Lake | HISAWQRQQSEADLNEVLMGAEAFQAIAKELKRRSNTTL* |
Ga0114974_102332351 | 3300009183 | Freshwater Lake | QSMYTIGKHISTWQRHQSEADLDEVVMGAEAFYAIAKELKRRSQSSL* |
Ga0114971_102828181 | 3300009185 | Freshwater Lake | MEQSMYTIGKHITIWQRQQSEADLDEILMGAEAFHAIAKELKRRSKTML* |
Ga0129333_116597132 | 3300010354 | Freshwater To Marine Saline Gradient | WMEHSMYLIGKHITIYQKQNSPADLEEVLMGAEAFHAIAKELKKRHIS* |
Ga0129336_106633761 | 3300010370 | Freshwater To Marine Saline Gradient | ISTPDLIAWMEHSMYLIGKHITIYQKQNSVADLDEVLMGAEAFHAIAKELKKRHIS* |
Ga0119955_11636192 | 3300012006 | Freshwater | MFTIGKHLNQWSKGHSPDDLDEVVLGAEAFYAMARELKRRSML* |
Ga0181358_12079671 | 3300017774 | Freshwater Lake | MYTIGKHISTWQRHQSEADLDEVVMGAEAFYAIAKELKRR |
Ga0211734_104119206 | 3300020159 | Freshwater | MYTIGKLITEWQKSHNKDLLDEVVMGTEVFNAIAKELKKRA |
Ga0211734_104462843 | 3300020159 | Freshwater | MYTIGRHITIWQRQQSEADLDEIVMGAEVFHAIAKELKRRSKSVL |
Ga0211733_105845381 | 3300020160 | Freshwater | AKISTPDLVQWMEHSMFTIGKCISAWQKSPSDEMLDEVVMGAEAFHAIAKELRRRN |
Ga0211726_102658575 | 3300020161 | Freshwater | MYTIGRHITIWQRQQSEADLDEIVMGAEAFHAIAKELKRRSKSVL |
Ga0211729_104731442 | 3300020172 | Freshwater | WMEQSMYTIGRHITIWQRQQSEADLDEIVMGAEVFHAIAKELKRRSKSVL |
Ga0211731_110402622 | 3300020205 | Freshwater | MYTIGRHITIWQRQQSEADLDEILVGAEAFHAIAKELKRRSKSVL |
Ga0208364_10025854 | 3300020533 | Freshwater | MYTIGRHITIWQRQQSEADLDEILMGAEAFHAIAKELKRRSKSVL |
Ga0208856_10226953 | 3300020548 | Freshwater | MYTIGRHITIWQRQQSEADLDEILMGAEAFHAIAKELKRRSKAVL |
Ga0208358_100020713 | 3300020555 | Freshwater | MYTIGKLITEWQKSHNNDLLDEVVLGTEVFNAIAKELKKRA |
Ga0214178_10023342 | 3300020718 | Freshwater | MEQSMHTIGRHITIWQREQSKDDLEEVLMGAEAFYAIAKELKRRSEHTL |
Ga0214167_10298152 | 3300021136 | Freshwater | MYTIGKHITIWQRNQTQADLDEVLMGAEAFYAIAKELKRRSSSSL |
Ga0214167_10942312 | 3300021136 | Freshwater | MFTIGKHISSWQRTQSKDDLAEVKLGAEVFHAIAQELE |
Ga0214166_100076913 | 3300021139 | Freshwater | MEHSMYTIGRLITEWQKSQNDVLLDEVLLGAEAFHAIAKELKKRY |
Ga0214166_10219273 | 3300021139 | Freshwater | MYTIGKHITSWQRNQTQADLDEVLMGAEAFYAIAKELKRRSSSSL |
Ga0214192_1000051116 | 3300021142 | Freshwater | MYTIGRLITEWQKSQNDVLLDEVLLGAEAFHAIAKELKKRY |
Ga0194048_100396154 | 3300021519 | Anoxic Zone Freshwater | MYTIGKLITDWQKNPSNESFLDELLLGTEAFHAIAKELKKRA |
Ga0194048_100599263 | 3300021519 | Anoxic Zone Freshwater | MFTIGKHITTWQRSQNPSDLDELVMGAEAFHAIAKELKRRSQSVL |
Ga0194048_100862722 | 3300021519 | Anoxic Zone Freshwater | KHITTWQRSQNPSDLDELVMGAEAFHAIAKELKRRSQSVL |
Ga0222714_100197854 | 3300021961 | Estuarine Water | MYTIGKHITEWQKSHNQDLLDEVVLGTEVFHAIAKELKKRA |
Ga0222714_102148653 | 3300021961 | Estuarine Water | MEHSMFLIGKHITIYQKQNSAADLDEVLMGAEAFHAIAKELKKRHVL |
Ga0181351_11982642 | 3300022407 | Freshwater Lake | WMEQSMYTIGKHITIWQRQQSEADLDEILMGAEAFHAIAKELKRRSKSVL |
Ga0236341_100145611 | 3300022591 | Freshwater | MEHSMYTIGKLITEWQKSPNSDQLLDEVVLGAEAFHAIAKELKRRA |
Ga0236341_10182483 | 3300022591 | Freshwater | HITVWQRQQSDADLDEVLMGAEAFYAIAKELKKRSA |
Ga0214921_1000102288 | 3300023174 | Freshwater | MFILGRHLTTWQRNQSQADIDEVVMGAEAFYAIAKELKRRSQSVL |
Ga0214921_1000749511 | 3300023174 | Freshwater | MFTIGKCITAWQKNPSDEMLDEVVMGAEAFHAIAKELRRRN |
Ga0214921_100691843 | 3300023174 | Freshwater | MYTIGKHITIWQRQQSEADLDEILMGAEAFQAIARELKRRSKTVL |
Ga0214919_100795493 | 3300023184 | Freshwater | MYTIGKHITIWQRQQSEADLDEILMGAEAFHAIAKELKRRSKTML |
Ga0256681_112085002 | 3300023311 | Freshwater | IGKHITSWQRSQSDVDLEEVNIGAEAFYAIARELKRRSNSKL |
Ga0244777_1000154631 | 3300024343 | Estuarine | MYTIGKLITEWQKSHNKNLLDEVVLGTEVFNAIAKELKKRA |
Ga0207957_10024522 | 3300025372 | Freshwater | MEQSMFTIGKHISSWQRTQSKDDLGEVKLGAEVFYAIAQELERRSL |
Ga0207959_10545281 | 3300025387 | Freshwater | MEHSMYTIGRLITEWQKSQNDVLLDEVLLGAEAFHAIAK |
Ga0208379_10089984 | 3300025598 | Freshwater | MFTIGKHISSWQRTQSKDDLGEVKLGAEVFYAIAQELERRSL |
Ga0208009_10063553 | 3300027114 | Deep Subsurface | MYTIGKLITEWQKSHNNDLLDEVVMGTEVFNAIAKELKKRA |
Ga0208966_10282832 | 3300027586 | Freshwater Lentic | MFTIGKCITAWQKSPTEEMLDEVVMGAEAFYEIAKELKRRA |
Ga0208974_100098120 | 3300027608 | Freshwater Lentic | MYILGKNLTGWQKHQSDADLDELLMGAEAFYAIAKELKKRS |
Ga0208974_10636422 | 3300027608 | Freshwater Lentic | TIGKCISAWQKNPSDEMLDEVVMGAEAFHAIAKELRRRN |
Ga0209188_100010635 | 3300027708 | Freshwater Lake | MYTIGKLITEWQKSPNSDALLDEVLLGAEAFYAIAKELKKRA |
Ga0209188_100070637 | 3300027708 | Freshwater Lake | MFTIGKCITAWQKSPTEEMLDEVVMGAEAFYEIAKELRRRA |
(restricted) Ga0247833_100602012 | 3300027730 | Freshwater | MYTIGKHITIWQRQQSDADLNEILMGAEAFYAIAKELKKRSAPVL |
Ga0209190_10054965 | 3300027736 | Freshwater Lake | MYTIGKHITIWQRLQSEADLDEILMGAEAFQAIARELKRRSKTVL |
Ga0209190_10341281 | 3300027736 | Freshwater Lake | MYTIGKHITIWQRQQSESDLDEILMGAEAFQAIAKELKRRSKTVL |
Ga0209085_13914022 | 3300027741 | Freshwater Lake | MYTIGKHITIWQRQQSEADLDEILMGAEAFQAIARELKRRSKTML |
Ga0209084_10260212 | 3300027749 | Freshwater Lake | MYTIGKHITIWQRQQSESDLDEILMGAEAFQAIARELKRRSKTVL |
Ga0209596_10030134 | 3300027754 | Freshwater Lake | MFTIGRHITTWQRNQSEADLDEVLMGSEVFYAIARELKRRSKSVL |
Ga0209596_10092195 | 3300027754 | Freshwater Lake | MYTIGKHITIWQRQQSEADLDEILMGAEVFHAIAKELKRRSKSVL |
Ga0209598_103936582 | 3300027760 | Freshwater Lake | ISTPDLVQWMEHSMFTIGKCITAWQKNPSDEMLDEVVMGAEAFHAIAKELRRRN |
Ga0209086_10000052156 | 3300027770 | Freshwater Lake | MYTIGKHISTWQRHQSEADLDEVVMGAEAFYAIAKELKRRTQSSI |
Ga0209500_1000413312 | 3300027782 | Freshwater Lake | MYTIGKLITEWQKSPNSDALLDEVEMGAEAFLAIARELKRRK |
Ga0209972_103821812 | 3300027793 | Freshwater Lake | MEHSMFLIGKHITIYQKQNSSADLDEVLMGAEAFHAIAKELKKRHVS |
Ga0209354_101199831 | 3300027808 | Freshwater Lake | MYTIGKHITIWQRQQSEADLDEILMGAEAFHAIAKELKR |
Ga0209400_13531801 | 3300027963 | Freshwater Lake | MFTIGKCITAWQKNPSDEMLDEVVMGAEAFHAIAK |
Ga0209191_12419863 | 3300027969 | Freshwater Lake | MEQSMYTIGKHISAWQRQQSEADLEEVLMGAEAFQAIAKELKRRSNTT |
(restricted) Ga0247843_100532722 | 3300028569 | Freshwater | MYTIGKHITIWQRQQSDADLNEILMGAEAFYAIAKELKKRSALVL |
Ga0315907_10000165123 | 3300031758 | Freshwater | MFLIGKHITIYQKQNSSADLDEVLMGAEAFHAIAKELKKRHVS |
Ga0315907_102547832 | 3300031758 | Freshwater | MYLIGKHITIYQKQNSVADLDEVLMGAEAFHAIAKELKKRHVS |
Ga0316217_100345122 | 3300031813 | Freshwater | MHTIGRHITIWQREQSKDDLEEVLMGAEAFYAIAKELKRRSEHTL |
Ga0315909_100462705 | 3300031857 | Freshwater | MEQSMYTIGKHISAWQRQQSEADLEEVLMGAEAFQAIARELKRRSQTTL |
Ga0315904_100442662 | 3300031951 | Freshwater | MEHSMYLIGKHITIYQKQNSVADLDEVLMGAEAFHAIAKELKKRHVS |
Ga0315904_103411791 | 3300031951 | Freshwater | YLIGKHITIYQKQNSAADLDEVLMGAEAFHAIAKELKKRHVS |
Ga0315904_103985791 | 3300031951 | Freshwater | DLIAWMEHSMYLIGKHITVYQKQNSAADLDEVLMGAEAFHAIAKELKKRHIS |
Ga0334981_0171301_805_954 | 3300033980 | Freshwater | MEQSMYTIGKHITIWQRQQSEADLDEILMGAEAFHAIAKELKRRSKSVL |
Ga0334982_0090041_1275_1406 | 3300033981 | Freshwater | MYLIGKHVTIYQKQNSSADLDEVLMGAEAFHAIAKELKKRHVS |
Ga0334994_0253722_252_389 | 3300033993 | Freshwater | MYTIGKHITIWQRQQSEADLDEVLMGAEAFHAIAKELKRRSKSVL |
Ga0334996_0013070_3603_3746 | 3300033994 | Freshwater | MEHSMYSIGKHITIYQKQNSTADLDEVLMGAEAFHAIAKELKKRHVL |
Ga0335004_0046513_831_968 | 3300034021 | Freshwater | MFIIGKHITVWQRQQSEADLDEVLMGAEAFHAIAKELKRRSNPVL |
Ga0334995_0001090_16046_16183 | 3300034062 | Freshwater | MYTIGRHITIWQRQQSEADLDEIVMGAEVFHAIARELKRRSKSVL |
Ga0335066_0035540_2957_3100 | 3300034112 | Freshwater | MEHSMYLIGKHVTIYQKQNSSADLDEVLMGAEAFHAIAKELKKRHVS |
Ga0335066_0666148_409_528 | 3300034112 | Freshwater | HITIWQRQQSEADLDEILMGAEAFHAIAKELKRRSKSVL |
Ga0335056_0369180_637_777 | 3300034120 | Freshwater | SMYTIGRHITIWQRQQSEADLDEIVMGAEVFHAIARELKRRSKSVL |
Ga0335048_0057471_2315_2479 | 3300034356 | Freshwater | DLISWMEQAMFTIGKNISTWQRHQSQADLDEVVMGAEAFYAIAKELKRRSQSSL |
⦗Top⦘ |