Basic Information | |
---|---|
Family ID | F084063 |
Family Type | Metagenome / Metatranscriptome |
Number of Sequences | 112 |
Average Sequence Length | 39 residues |
Representative Sequence | MGSLALLQSLKESVLGQASVKAIYGEPISAHEKTIIPVA |
Number of Associated Samples | 93 |
Number of Associated Scaffolds | 112 |
Quality Assessment | |
---|---|
Transcriptomic Evidence | Yes |
Most common taxonomic group | Bacteria |
% of genes with valid RBS motifs | 100.00 % |
% of genes near scaffold ends (potentially truncated) | 94.64 % |
% of genes from short scaffolds (< 2000 bps) | 86.61 % |
Associated GOLD sequencing projects | 90 |
AlphaFold2 3D model prediction | Yes |
3D model pTM-score | 0.37 |
Hidden Markov Model |
---|
Powered by Skylign |
Most Common Taxonomy | |
---|---|
Group | Bacteria (89.286 % of family members) |
NCBI Taxonomy ID | 2 |
Taxonomy | All Organisms → cellular organisms → Bacteria |
Most Common Ecosystem | |
---|---|
GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil (14.286 % of family members) |
Environment Ontology (ENVO) | Unclassified (28.571 % of family members) |
Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (49.107 % of family members) |
⦗Top⦘ |
⦗Top⦘ |
Predicted Topology & Secondary Structure | |||||
---|---|---|---|---|---|
Classification: | Fibrous | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 31.34% β-sheet: 8.96% Coil/Unstructured: 59.70% | Feature Viewer |
|
|||||
Powered by Feature Viewer |
Structure Viewer | |
---|---|
| |
Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.37 |
Powered by PDBe Molstar |
⦗Top⦘ |
Pfam ID | Name | % Frequency in 112 Family Scaffolds |
---|---|---|
PF02567 | PhzC-PhzF | 2.68 |
PF14534 | DUF4440 | 2.68 |
PF09579 | Spore_YtfJ | 1.79 |
PF13649 | Methyltransf_25 | 1.79 |
PF00072 | Response_reg | 0.89 |
PF00719 | Pyrophosphatase | 0.89 |
PF00873 | ACR_tran | 0.89 |
PF14294 | DUF4372 | 0.89 |
PF00232 | Glyco_hydro_1 | 0.89 |
PF00903 | Glyoxalase | 0.89 |
PF03167 | UDG | 0.89 |
PF07786 | HGSNAT_cat | 0.89 |
PF07681 | DoxX | 0.89 |
PF16576 | HlyD_D23 | 0.89 |
PF01243 | Putative_PNPOx | 0.89 |
PF00011 | HSP20 | 0.89 |
PF03473 | MOSC | 0.89 |
PF00848 | Ring_hydroxyl_A | 0.89 |
PF13360 | PQQ_2 | 0.89 |
PF03448 | MgtE_N | 0.89 |
PF00589 | Phage_integrase | 0.89 |
PF00754 | F5_F8_type_C | 0.89 |
PF01757 | Acyl_transf_3 | 0.89 |
PF07676 | PD40 | 0.89 |
PF00484 | Pro_CA | 0.89 |
PF13676 | TIR_2 | 0.89 |
PF02308 | MgtC | 0.89 |
PF01834 | XRCC1_N | 0.89 |
PF13544 | Obsolete Pfam Family | 0.89 |
PF04366 | Ysc84 | 0.89 |
PF00132 | Hexapep | 0.89 |
PF00782 | DSPc | 0.89 |
PF06778 | Chlor_dismutase | 0.89 |
PF00326 | Peptidase_S9 | 0.89 |
COG ID | Name | Functional Category | % Frequency in 112 Family Scaffolds |
---|---|---|---|
COG0384 | Predicted epimerase YddE/YHI9, PhzF superfamily | General function prediction only [R] | 2.68 |
COG4638 | Phenylpropionate dioxygenase or related ring-hydroxylating dioxygenase, large terminal subunit | Inorganic ion transport and metabolism [P] | 1.79 |
COG0071 | Small heat shock protein IbpA, HSP20 family | Posttranslational modification, protein turnover, chaperones [O] | 0.89 |
COG0221 | Inorganic pyrophosphatase | Energy production and conversion [C] | 0.89 |
COG0288 | Carbonic anhydrase | Inorganic ion transport and metabolism [P] | 0.89 |
COG0692 | Uracil-DNA glycosylase | Replication, recombination and repair [L] | 0.89 |
COG1285 | Magnesium uptake protein YhiD/SapB, involved in acid resistance | Inorganic ion transport and metabolism [P] | 0.89 |
COG1573 | Uracil-DNA glycosylase | Replication, recombination and repair [L] | 0.89 |
COG2239 | Mg/Co/Ni transporter MgtE (contains CBS domain) | Inorganic ion transport and metabolism [P] | 0.89 |
COG2259 | Uncharacterized membrane protein YphA, DoxX/SURF4 family | Function unknown [S] | 0.89 |
COG2723 | Beta-glucosidase/6-phospho-beta-glucosidase/beta-galactosidase | Carbohydrate transport and metabolism [G] | 0.89 |
COG2930 | Lipid-binding SYLF domain, Ysc84/FYVE family | Lipid transport and metabolism [I] | 0.89 |
COG3174 | Membrane component of predicted Mg2+ transport system, contains DUF4010 domain | Inorganic ion transport and metabolism [P] | 0.89 |
COG3253 | Coproheme decarboxylase/chlorite dismutase | Coenzyme transport and metabolism [H] | 0.89 |
COG3503 | Uncharacterized membrane protein, DUF1624 family | Function unknown [S] | 0.89 |
COG3663 | G:T/U-mismatch repair DNA glycosylase | Replication, recombination and repair [L] | 0.89 |
COG4270 | Uncharacterized membrane protein | Function unknown [S] | 0.89 |
⦗Top⦘ |
Name | Rank | Taxonomy | Distribution |
All Organisms | root | All Organisms | 89.29 % |
Unclassified | root | N/A | 10.71 % |
Visualization |
---|
Powered by ApexCharts |
Scaffold | Taxonomy | Length | IMG/M Link |
---|---|---|---|
3300000364|INPhiseqgaiiFebDRAFT_101465854 | All Organisms → cellular organisms → Bacteria | 1416 | Open in IMG/M |
3300000955|JGI1027J12803_104064796 | All Organisms → cellular organisms → Bacteria | 667 | Open in IMG/M |
3300004092|Ga0062389_103458345 | All Organisms → cellular organisms → Bacteria | 592 | Open in IMG/M |
3300004631|Ga0058899_10187717 | All Organisms → cellular organisms → Bacteria | 1070 | Open in IMG/M |
3300005167|Ga0066672_11006181 | All Organisms → cellular organisms → Bacteria | 509 | Open in IMG/M |
3300005177|Ga0066690_10178498 | All Organisms → cellular organisms → Bacteria | 1406 | Open in IMG/M |
3300005439|Ga0070711_100455560 | All Organisms → cellular organisms → Bacteria | 1048 | Open in IMG/M |
3300005534|Ga0070735_10722057 | All Organisms → cellular organisms → Bacteria | 588 | Open in IMG/M |
3300005538|Ga0070731_10479989 | All Organisms → cellular organisms → Bacteria | 827 | Open in IMG/M |
3300005541|Ga0070733_10407965 | All Organisms → cellular organisms → Bacteria | 905 | Open in IMG/M |
3300005591|Ga0070761_10898264 | All Organisms → cellular organisms → Bacteria | 560 | Open in IMG/M |
3300005617|Ga0068859_102684050 | All Organisms → cellular organisms → Bacteria | 547 | Open in IMG/M |
3300005618|Ga0068864_101580336 | All Organisms → cellular organisms → Bacteria | 660 | Open in IMG/M |
3300005712|Ga0070764_10874852 | All Organisms → cellular organisms → Bacteria | 562 | Open in IMG/M |
3300005719|Ga0068861_100187274 | All Organisms → cellular organisms → Bacteria | 1727 | Open in IMG/M |
3300006755|Ga0079222_11365837 | All Organisms → cellular organisms → Bacteria | 652 | Open in IMG/M |
3300006755|Ga0079222_12621194 | Not Available | 507 | Open in IMG/M |
3300006797|Ga0066659_10371333 | All Organisms → cellular organisms → Bacteria | 1116 | Open in IMG/M |
3300006800|Ga0066660_10682522 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Chitinophagia → Chitinophagales → Chitinophagaceae → Segetibacter → Segetibacter koreensis | 847 | Open in IMG/M |
3300006893|Ga0073928_11063781 | All Organisms → cellular organisms → Bacteria | 549 | Open in IMG/M |
3300007255|Ga0099791_10489915 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 596 | Open in IMG/M |
3300009089|Ga0099828_11924704 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 519 | Open in IMG/M |
3300009092|Ga0105250_10036241 | All Organisms → cellular organisms → Bacteria | 1979 | Open in IMG/M |
3300009137|Ga0066709_104526049 | Not Available | 508 | Open in IMG/M |
3300009174|Ga0105241_12233969 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 543 | Open in IMG/M |
3300009792|Ga0126374_11155925 | All Organisms → cellular organisms → Bacteria | 617 | Open in IMG/M |
3300010048|Ga0126373_12963524 | All Organisms → cellular organisms → Bacteria | 529 | Open in IMG/M |
3300010361|Ga0126378_13147471 | All Organisms → cellular organisms → Bacteria | 525 | Open in IMG/M |
3300010398|Ga0126383_13284369 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 528 | Open in IMG/M |
3300010398|Ga0126383_13379751 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 521 | Open in IMG/M |
3300012189|Ga0137388_11932436 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 520 | Open in IMG/M |
3300012199|Ga0137383_10260326 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1271 | Open in IMG/M |
3300012202|Ga0137363_10051373 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 2958 | Open in IMG/M |
3300012202|Ga0137363_11575983 | All Organisms → cellular organisms → Bacteria | 549 | Open in IMG/M |
3300012206|Ga0137380_10045387 | All Organisms → cellular organisms → Bacteria | 4038 | Open in IMG/M |
3300012349|Ga0137387_10445521 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 939 | Open in IMG/M |
3300012362|Ga0137361_10533229 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1077 | Open in IMG/M |
3300012918|Ga0137396_10618222 | All Organisms → cellular organisms → Bacteria | 801 | Open in IMG/M |
3300012989|Ga0164305_11075183 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 689 | Open in IMG/M |
3300013102|Ga0157371_10110731 | All Organisms → cellular organisms → Bacteria | 1949 | Open in IMG/M |
3300013296|Ga0157374_10006802 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 9725 | Open in IMG/M |
3300013296|Ga0157374_10539749 | All Organisms → cellular organisms → Bacteria | 1173 | Open in IMG/M |
3300013296|Ga0157374_12084538 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 594 | Open in IMG/M |
3300014489|Ga0182018_10251554 | All Organisms → cellular organisms → Bacteria | 972 | Open in IMG/M |
3300017927|Ga0187824_10126652 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 835 | Open in IMG/M |
3300017970|Ga0187783_10458502 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 925 | Open in IMG/M |
3300018020|Ga0187861_10346956 | All Organisms → cellular organisms → Bacteria | 629 | Open in IMG/M |
3300018026|Ga0187857_10505610 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis → Candidatus Koribacter versatilis Ellin345 | 541 | Open in IMG/M |
3300018034|Ga0187863_10122682 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → unclassified Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter sp. SbA7 | 1453 | Open in IMG/M |
3300018037|Ga0187883_10149309 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis → Candidatus Koribacter versatilis Ellin345 | 1203 | Open in IMG/M |
3300018037|Ga0187883_10247135 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 913 | Open in IMG/M |
3300018047|Ga0187859_10041901 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → unclassified Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter sp. SbA7 | 2447 | Open in IMG/M |
3300018060|Ga0187765_11393985 | Not Available | 500 | Open in IMG/M |
3300019890|Ga0193728_1225169 | All Organisms → cellular organisms → Bacteria | 770 | Open in IMG/M |
3300020579|Ga0210407_10065688 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2720 | Open in IMG/M |
3300020580|Ga0210403_10006892 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 9505 | Open in IMG/M |
3300020583|Ga0210401_10142965 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 2237 | Open in IMG/M |
3300020583|Ga0210401_11043031 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 676 | Open in IMG/M |
3300021170|Ga0210400_11421829 | Not Available | 552 | Open in IMG/M |
3300021180|Ga0210396_10617258 | All Organisms → cellular organisms → Bacteria | 942 | Open in IMG/M |
3300021181|Ga0210388_11302076 | All Organisms → cellular organisms → Bacteria | 613 | Open in IMG/M |
3300021404|Ga0210389_11206823 | All Organisms → cellular organisms → Bacteria | 582 | Open in IMG/M |
3300021404|Ga0210389_11366794 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 541 | Open in IMG/M |
3300021404|Ga0210389_11405016 | All Organisms → cellular organisms → Bacteria | 532 | Open in IMG/M |
3300021405|Ga0210387_10096254 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2468 | Open in IMG/M |
3300021433|Ga0210391_11578024 | Not Available | 502 | Open in IMG/M |
3300021478|Ga0210402_11866625 | All Organisms → cellular organisms → Bacteria | 527 | Open in IMG/M |
3300021559|Ga0210409_11254258 | Not Available | 617 | Open in IMG/M |
3300021560|Ga0126371_10132322 | All Organisms → cellular organisms → Bacteria | 2535 | Open in IMG/M |
3300021560|Ga0126371_11383480 | All Organisms → cellular organisms → Bacteria | 835 | Open in IMG/M |
3300022521|Ga0224541_1028862 | All Organisms → cellular organisms → Bacteria | 598 | Open in IMG/M |
3300022557|Ga0212123_10110105 | Not Available | 2220 | Open in IMG/M |
3300022557|Ga0212123_10358218 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → unclassified Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter sp. SbA7 | 994 | Open in IMG/M |
3300022557|Ga0212123_10891920 | All Organisms → cellular organisms → Bacteria | 524 | Open in IMG/M |
3300023250|Ga0224544_1062429 | Not Available | 539 | Open in IMG/M |
3300023255|Ga0224547_1029179 | All Organisms → cellular organisms → Bacteria | 709 | Open in IMG/M |
3300025898|Ga0207692_10825088 | All Organisms → cellular organisms → Bacteria | 607 | Open in IMG/M |
3300025906|Ga0207699_11110959 | All Organisms → cellular organisms → Bacteria | 585 | Open in IMG/M |
3300025928|Ga0207700_11329914 | Not Available | 640 | Open in IMG/M |
3300025935|Ga0207709_11218119 | All Organisms → cellular organisms → Bacteria | 621 | Open in IMG/M |
3300025940|Ga0207691_10834312 | All Organisms → cellular organisms → Bacteria | 773 | Open in IMG/M |
3300025986|Ga0207658_10157528 | All Organisms → cellular organisms → Bacteria | 1857 | Open in IMG/M |
3300025986|Ga0207658_10391257 | All Organisms → cellular organisms → Bacteria | 1220 | Open in IMG/M |
3300026088|Ga0207641_10011220 | All Organisms → cellular organisms → Bacteria | 7352 | Open in IMG/M |
3300026088|Ga0207641_11662677 | All Organisms → cellular organisms → Bacteria | 640 | Open in IMG/M |
3300026329|Ga0209375_1050473 | All Organisms → cellular organisms → Bacteria | 2077 | Open in IMG/M |
3300026524|Ga0209690_1165497 | Not Available | 777 | Open in IMG/M |
3300026557|Ga0179587_11025241 | All Organisms → cellular organisms → Bacteria | 543 | Open in IMG/M |
3300027069|Ga0208859_1017364 | All Organisms → cellular organisms → Bacteria | 811 | Open in IMG/M |
3300027616|Ga0209106_1062591 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → unclassified Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter sp. SbA7 | 833 | Open in IMG/M |
3300027867|Ga0209167_10219041 | All Organisms → cellular organisms → Bacteria | 1017 | Open in IMG/M |
3300027869|Ga0209579_10001633 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 18193 | Open in IMG/M |
3300027869|Ga0209579_10434897 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 712 | Open in IMG/M |
3300027895|Ga0209624_10248507 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1183 | Open in IMG/M |
3300028047|Ga0209526_10468394 | All Organisms → cellular organisms → Bacteria | 826 | Open in IMG/M |
3300028800|Ga0265338_11129457 | All Organisms → cellular organisms → Bacteria | 527 | Open in IMG/M |
3300028906|Ga0308309_10354724 | All Organisms → cellular organisms → Bacteria | 1251 | Open in IMG/M |
3300028906|Ga0308309_10516417 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1033 | Open in IMG/M |
3300031236|Ga0302324_100686164 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Granulicella | 1449 | Open in IMG/M |
3300031573|Ga0310915_11263789 | All Organisms → cellular organisms → Bacteria | 509 | Open in IMG/M |
3300031715|Ga0307476_10195291 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1468 | Open in IMG/M |
3300031720|Ga0307469_10134160 | All Organisms → cellular organisms → Bacteria | 1819 | Open in IMG/M |
3300031820|Ga0307473_10502531 | All Organisms → cellular organisms → Bacteria | 818 | Open in IMG/M |
3300031820|Ga0307473_11169032 | All Organisms → cellular organisms → Bacteria | 570 | Open in IMG/M |
3300031823|Ga0307478_10081246 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 2475 | Open in IMG/M |
3300031962|Ga0307479_10286501 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1628 | Open in IMG/M |
3300031962|Ga0307479_10395468 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1367 | Open in IMG/M |
3300032895|Ga0335074_10006537 | All Organisms → cellular organisms → Bacteria | 16184 | Open in IMG/M |
3300032895|Ga0335074_11532424 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 527 | Open in IMG/M |
3300032898|Ga0335072_10408833 | Not Available | 1452 | Open in IMG/M |
3300033158|Ga0335077_10911294 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 885 | Open in IMG/M |
3300033289|Ga0310914_10950957 | Not Available | 759 | Open in IMG/M |
⦗Top⦘ |
Habitat | Taxonomy | Distribution |
Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 14.29% |
Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 9.82% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 7.14% |
Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 6.25% |
Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 6.25% |
Peatland | Environmental → Aquatic → Freshwater → Wetlands → Bog → Peatland | 5.36% |
Surface Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil | 5.36% |
Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 4.46% |
Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 4.46% |
Iron-Sulfur Acid Spring | Environmental → Aquatic → Thermal Springs → Hot (42-90C) → Acidic → Iron-Sulfur Acid Spring | 3.57% |
Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 3.57% |
Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Soil | 3.57% |
Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 3.57% |
Soil | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Soil | 2.68% |
Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 2.68% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 1.79% |
Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 1.79% |
Tropical Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland | 1.79% |
Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere | 1.79% |
Bog Forest Soil | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog Forest Soil | 0.89% |
Freshwater Sediment | Environmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment | 0.89% |
Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 0.89% |
Palsa | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Palsa | 0.89% |
Palsa | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Palsa | 0.89% |
Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 0.89% |
Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 0.89% |
Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 0.89% |
Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 0.89% |
Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Rhizosphere | 0.89% |
Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Miscanthus Rhizosphere | 0.89% |
Visualization |
---|
Powered by ApexCharts |
Taxon OID | Sample Name | Habitat Type | IMG/M Link |
---|---|---|---|
3300000364 | Soil microbial communities from Great Prairies - Iowa, Native Prairie soil | Environmental | Open in IMG/M |
3300000955 | Soil microbial communities from Great Prairies - Iowa, Native Prairie soil | Environmental | Open in IMG/M |
3300004092 | Coassembly of ECP03_0M1, ECP03_OM2, ECP03_OM3, ECP04_OM1, ECP04_OM2, ECP04_OM3, ECP14_OM1, ECP14_OM2, ECP14_OM3 | Environmental | Open in IMG/M |
3300004631 | Forest soil microbial communities from Harvard Forest Long Term Ecological Research site in Petersham, Massachusetts, USA - MetaT HF234 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300005167 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_121 | Environmental | Open in IMG/M |
3300005177 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_139 | Environmental | Open in IMG/M |
3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Environmental | Open in IMG/M |
3300005534 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen07_05102014_R1 | Environmental | Open in IMG/M |
3300005538 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen03_05102014_R1 | Environmental | Open in IMG/M |
3300005541 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen05_05102014_R1 | Environmental | Open in IMG/M |
3300005591 | Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF1 | Environmental | Open in IMG/M |
3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Host-Associated | Open in IMG/M |
3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Host-Associated | Open in IMG/M |
3300005712 | Warmed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WRM 4 | Environmental | Open in IMG/M |
3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Host-Associated | Open in IMG/M |
3300006755 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Plitter | Environmental | Open in IMG/M |
3300006797 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_108 | Environmental | Open in IMG/M |
3300006800 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_109 | Environmental | Open in IMG/M |
3300006893 | Iron sulfur acid spring bacterial and archeal communities from Banff, Canada, to study Microbial Dark Matter (Phase II) - Paint Pots PPA 5.5 metaG | Environmental | Open in IMG/M |
3300007255 | Vadose zone soil and rhizosphere microbial communities from the Eel River Critical Zone Observatory, Northern California to study diel carbon cycling - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_1 | Environmental | Open in IMG/M |
3300009089 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H1.8 metaG | Environmental | Open in IMG/M |
3300009092 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG | Host-Associated | Open in IMG/M |
3300009137 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_158 | Environmental | Open in IMG/M |
3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Host-Associated | Open in IMG/M |
3300009792 | Tropical forest soil microbial communities from Panama - MetaG Plot_12 | Environmental | Open in IMG/M |
3300010048 | Tropical forest soil microbial communities from Panama - MetaG Plot_11 | Environmental | Open in IMG/M |
3300010361 | Tropical forest soil microbial communities from Panama - MetaG Plot_23 | Environmental | Open in IMG/M |
3300010398 | Tropical forest soil microbial communities from Panama - MetaG Plot_35 | Environmental | Open in IMG/M |
3300012189 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h1.4A metaG | Environmental | Open in IMG/M |
3300012199 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_40_16 metaG | Environmental | Open in IMG/M |
3300012202 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_115_16 metaG | Environmental | Open in IMG/M |
3300012206 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_100_16 metaG | Environmental | Open in IMG/M |
3300012349 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Sage2_R_115_16 metaG | Environmental | Open in IMG/M |
3300012362 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_80_16 metaG | Environmental | Open in IMG/M |
3300012918 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czcobulk3.16 metaG | Environmental | Open in IMG/M |
3300012989 | Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_237_MG | Environmental | Open in IMG/M |
3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Host-Associated | Open in IMG/M |
3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Host-Associated | Open in IMG/M |
3300014489 | Permafrost microbial communities from Stordalen Mire, Sweden - 812P2M metaG | Environmental | Open in IMG/M |
3300017927 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SourceSoil_4 | Environmental | Open in IMG/M |
3300017970 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_SJ02_MP02_20_MG | Environmental | Open in IMG/M |
3300018020 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_10_100 | Environmental | Open in IMG/M |
3300018026 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_8_100 | Environmental | Open in IMG/M |
3300018034 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_11_10 | Environmental | Open in IMG/M |
3300018037 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_20_10 | Environmental | Open in IMG/M |
3300018047 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_10_10 | Environmental | Open in IMG/M |
3300018060 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_QUI02_MP05_10_MG | Environmental | Open in IMG/M |
3300019890 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U1c1 | Environmental | Open in IMG/M |
3300020579 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-27-M | Environmental | Open in IMG/M |
3300020580 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-19-M | Environmental | Open in IMG/M |
3300020583 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-32-M | Environmental | Open in IMG/M |
3300021170 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-26-M | Environmental | Open in IMG/M |
3300021180 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-17-O | Environmental | Open in IMG/M |
3300021181 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-19-O | Environmental | Open in IMG/M |
3300021404 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-28-O | Environmental | Open in IMG/M |
3300021405 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-7-O | Environmental | Open in IMG/M |
3300021433 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-12-O | Environmental | Open in IMG/M |
3300021478 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-7-M | Environmental | Open in IMG/M |
3300021559 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-17-M | Environmental | Open in IMG/M |
3300021560 | Tropical forest soil microbial communities from Panama - MetaG Plot_4 | Environmental | Open in IMG/M |
3300022521 | Peat soil microbial communities from Stordalen Mire, Sweden - 717 E3 20-24 | Environmental | Open in IMG/M |
3300022557 | Paint Pots_combined assembly | Environmental | Open in IMG/M |
3300023250 | Peat soil microbial communities from Stordalen Mire, Sweden - 717 P1 10-14 | Environmental | Open in IMG/M |
3300023255 | Peat soil microbial communities from Stordalen Mire, Sweden - 717 P2 10-14 | Environmental | Open in IMG/M |
3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) | Environmental | Open in IMG/M |
3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) | Environmental | Open in IMG/M |
3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) | Environmental | Open in IMG/M |
3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) | Host-Associated | Open in IMG/M |
3300026329 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_131 (SPAdes) | Environmental | Open in IMG/M |
3300026524 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_150 (SPAdes) | Environmental | Open in IMG/M |
3300026557 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_08_16fungal | Environmental | Open in IMG/M |
3300027069 | Forest soil microbial communities from Harvard Forest Long Term Ecological Research site in Petersham, Massachusetts, USA - MetaG HF002 (SPAdes) | Environmental | Open in IMG/M |
3300027616 | Forest soil microbial communities from El Dorado National Forest, California, USA - Mediterranean Blodgett CA OM1_M3 (SPAdes) | Environmental | Open in IMG/M |
3300027867 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen05_05102014_R1 (SPAdes) | Environmental | Open in IMG/M |
3300027869 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen03_05102014_R1 (SPAdes) | Environmental | Open in IMG/M |
3300027895 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM2H0_O1 (SPAdes) | Environmental | Open in IMG/M |
3300028047 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM2H0_M1 (SPAdes) | Environmental | Open in IMG/M |
3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Host-Associated | Open in IMG/M |
3300028906 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 5 (v2) | Environmental | Open in IMG/M |
3300031236 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Palsa_T0_1 | Environmental | Open in IMG/M |
3300031573 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.AN111 | Environmental | Open in IMG/M |
3300031715 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM2C_05 | Environmental | Open in IMG/M |
3300031720 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM2C_515 | Environmental | Open in IMG/M |
3300031820 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_515 | Environmental | Open in IMG/M |
3300031823 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM4C_05 | Environmental | Open in IMG/M |
3300031962 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM4C_515 | Environmental | Open in IMG/M |
3300032895 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_2.3 | Environmental | Open in IMG/M |
3300032898 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_2.1 | Environmental | Open in IMG/M |
3300033158 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.1 | Environmental | Open in IMG/M |
3300033289 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.AN108 | Environmental | Open in IMG/M |
Geographical Distribution | |
---|---|
Zoom: | Powered by OpenStreetMap |
⦗Top⦘ |
Protein ID | Sample Taxon ID | Habitat | Sequence |
INPhiseqgaiiFebDRAFT_1014658543 | 3300000364 | Soil | MSSLALLQSLKESILTQANVKAVYGEPIAAQGKTVVPVAKI |
JGI1027J12803_1040647962 | 3300000955 | Soil | MGSLALLQALKESVLGQANVNAIYGEPISAHEKTIIPVAK |
Ga0062389_1034583451 | 3300004092 | Bog Forest Soil | MGSVALLQSLKESIFSHVGVKAIYGEPISAQGKTVIPVAKLMY |
Ga0058899_101877171 | 3300004631 | Forest Soil | MGSLAILQSLKESVLGQASVKAIYGEPISAQGKTVIPVAKVMYA |
Ga0066672_110061812 | 3300005167 | Soil | MGSLALLQSLKESILGQANVKAIYGEPISAHDKTIIPVAK |
Ga0066690_101784983 | 3300005177 | Soil | MGSLALLQSLRDSVLTQASVKTIYGEPIAAQGKTIIPVAR |
Ga0070711_1004555602 | 3300005439 | Corn, Switchgrass And Miscanthus Rhizosphere | MGSLALLQSLKESILGQANVKAIYGEPISAHEKTIIPVAKIMY |
Ga0070735_107220572 | 3300005534 | Surface Soil | MSSVAILQSLKESIAAANVKAVYGEPIAAQGKTIIPVAKI |
Ga0070731_104799893 | 3300005538 | Surface Soil | MSSVAILQSLTESILTANVKAVFGEPIAAQGKTVIPVAKIIFGY |
Ga0070733_104079651 | 3300005541 | Surface Soil | MSTLAVLESLKESILSQASVKAIYGEPISAHGRTV |
Ga0070761_108982641 | 3300005591 | Soil | MSSLALLQSLKESILLQANVKAISGEPIVAHGKTVIPAEKIMYP |
Ga0068859_1026840502 | 3300005617 | Switchgrass Rhizosphere | MGSLALLQSLKESILGQASVKTIYGEPILSQGKTI |
Ga0068864_1015803362 | 3300005618 | Switchgrass Rhizosphere | MGSLALLQYLKESVLGQANVKAIYGEPISAHEKTIIPVAKIMY |
Ga0070764_108748521 | 3300005712 | Soil | MSSLAILQSLKESILTANVKAVYGEPIAAQGKTIIPVAK |
Ga0068861_1001872741 | 3300005719 | Switchgrass Rhizosphere | MGSLALLQSLKDSVLGQANVKTIYGEPISAHEKTIIPVAKIM |
Ga0079222_113658371 | 3300006755 | Agricultural Soil | MSSLALLQSLKDTIITQANVKSVYGEPIAAQGKTIVPVAKII |
Ga0079222_126211942 | 3300006755 | Agricultural Soil | MSSLAILQSLKESILTEANVKTIYGEPIDAQGKTIIPVAKIVF |
Ga0066659_103713331 | 3300006797 | Soil | MSTQALLQSLKESILSQASVKAIYGEPIAAHGKTVIQVARIM |
Ga0066660_106825221 | 3300006800 | Soil | MGSLALLQSLRDSVLTQASVKTIYGEPIAAQGKTIIP |
Ga0073928_110637812 | 3300006893 | Iron-Sulfur Acid Spring | VPYFGVSEMSTQALLQSLKESVLSQASVKALYGEPISAHGKTVIPVAK* |
Ga0099791_104899151 | 3300007255 | Vadose Zone Soil | MFSFKEFPMGSLALLQSLKESILGQASVKAIYGEPISAHEK |
Ga0099828_119247041 | 3300009089 | Vadose Zone Soil | MGSLALLQSLKDSVLTQASVKTIYGEPIAAQGKTIIPVA |
Ga0105250_100362411 | 3300009092 | Switchgrass Rhizosphere | MGSLALLQSLKDSVLGQANVKTIYGEPISAHEKTII |
Ga0066709_1045260491 | 3300009137 | Grasslands Soil | MSSLALLQSLKESILTQANVKAVYGEPIAAQGQTVVPVA |
Ga0105241_122339691 | 3300009174 | Corn Rhizosphere | MGSLALLQTLKDSVLSQASVKAIYGEPISAQGKTIIPVARIT |
Ga0126374_111559252 | 3300009792 | Tropical Forest Soil | MGSLAILQSLKESVLGQANVKAIYGEPISAHEKTIIPVAKIM* |
Ga0126373_129635241 | 3300010048 | Tropical Forest Soil | MGSLALLQSLKESVLSQANVKAIYGEPVSAHDKTIIPVARI |
Ga0126378_131474713 | 3300010361 | Tropical Forest Soil | MGSLALLQSLKESVLGQASVKAIYGEPISAHEKTI |
Ga0126383_132843692 | 3300010398 | Tropical Forest Soil | MGSIALLQSLKESVLGQANVKAIYGEPISAHEKTIIPVA |
Ga0126383_133797512 | 3300010398 | Tropical Forest Soil | MEVPMGSVALLQSVKDGILSQASVKAIYGDPVAAHGKT |
Ga0137388_119324361 | 3300012189 | Vadose Zone Soil | MGSVMLLQSLKDGILSQASVKAIYGEPIVAQGKTIIPV |
Ga0137383_102603263 | 3300012199 | Vadose Zone Soil | MSTLAVLQSLKESILSQASVKAIYGEPIAAQGKTVIPIAKI |
Ga0137363_100513731 | 3300012202 | Vadose Zone Soil | MSALALLQSLKESILSQASVKAIYGEPIVAQGKTVIPV |
Ga0137363_115759832 | 3300012202 | Vadose Zone Soil | MGSLALLQSLKESILGQANVNAIYGEPISAHDKTIIP |
Ga0137380_100453876 | 3300012206 | Vadose Zone Soil | MSTHALLQSLKESILSQASVKAIYGEPIAAQGRTVIRLPK* |
Ga0137387_104455211 | 3300012349 | Vadose Zone Soil | MSTLAVLQSLKESILSQASVKPIYGEPNAAQGKTVIPVAKIMY |
Ga0137361_105332294 | 3300012362 | Vadose Zone Soil | MSALALLQSLKESILSQASVKAIYGEPIVAQGKTVIPVAKI |
Ga0137396_106182222 | 3300012918 | Vadose Zone Soil | MGSVALLQSLKESILGQASVKTIYGEPVSTHGKTIIPV |
Ga0164305_110751832 | 3300012989 | Soil | MSSSLALLQSLKESILTQANVKAVYGEPITTQGKTIVP |
Ga0157371_101107311 | 3300013102 | Corn Rhizosphere | MGSLALLQSLKDSVLGQANVKTIYGEPISAHEKTIIPVAKIMY |
Ga0157374_1000680213 | 3300013296 | Miscanthus Rhizosphere | MGSLALLQSLKESVLGQANVKAIYGEPISAHEKTIIPVAKI |
Ga0157374_105397491 | 3300013296 | Miscanthus Rhizosphere | VGSLALLQSLKESVLGQANVKAIYGEPISAHEKTIIPVAKI |
Ga0157374_120845381 | 3300013296 | Miscanthus Rhizosphere | MGSLALLQSLKESILGQASVKTIYGEPILSQGKTII |
Ga0182018_102515542 | 3300014489 | Palsa | MGSVALLQSLKESILGQVSVKTIYGEPIPAHGKTII |
Ga0187824_101266521 | 3300017927 | Freshwater Sediment | MSSVAILQSLKESIVSANVKAVYGEPVVAQGKTIIPVAKIM |
Ga0187783_104585021 | 3300017970 | Tropical Peatland | MGALSLLQSLKESVLTQASVKSIYGEPIAAQGKTVIPV |
Ga0187861_103469561 | 3300018020 | Peatland | MSTQALLQSLKESILSQASVKAIYGEPISANGKTVIPV |
Ga0187857_105056102 | 3300018026 | Peatland | MSTQALLQSLKESILSQASVKAIYGEPISAHGKTVIP |
Ga0187863_101226821 | 3300018034 | Peatland | MGSVALLQSLKEGILGQASVKTIYGEAVSAHGKTIIPV |
Ga0187883_101493092 | 3300018037 | Peatland | MSTQALLQSLKESILSQASVKAIYGEPISAHGKTVI |
Ga0187883_102471351 | 3300018037 | Peatland | MSTLAILQSLKESILSQASVKAIYGEPISAHGKTVIPVARIMY |
Ga0187859_100419011 | 3300018047 | Peatland | VSSVALLQSLKDGILGQVSVKTIYGEPVSAHGKTIIPV |
Ga0187765_113939852 | 3300018060 | Tropical Peatland | MSSVAILQSLKESIVTANVKAIYGEPIAAQGKTVIPVAKIIY |
Ga0193728_12251692 | 3300019890 | Soil | MSTQALLQSLKESILSQASVKAIYGEPISAQGKTVIPIAK |
Ga0210407_100656882 | 3300020579 | Soil | MSSLALLQSLKDSILGQASVKAIYGEPISAHGKTVVP |
Ga0210403_100068928 | 3300020580 | Soil | MGSVALLQSLKESILGQASVKTIYGEPISAHGKTIIPV |
Ga0210401_101429652 | 3300020583 | Soil | MGSLAILQSLKESVLGQASVKAIYGEPISAQGKTVI |
Ga0210401_110430311 | 3300020583 | Soil | MSSLALLQSLKDSVLGQASVKAIYGEPISAHGKTV |
Ga0210400_114218293 | 3300021170 | Soil | MSSPPPLQSLKESILSQANVKAIYGEPITAHFKNGHP |
Ga0210396_106172583 | 3300021180 | Soil | MGSVALLQSLRDSILGQAGVKAVYGEPISAQGKTVIPVAK |
Ga0210388_113020762 | 3300021181 | Soil | MGSLALLQSLKESVTSQASVKTLYGEPISAHEKTIIPVAKIM |
Ga0210389_112068232 | 3300021404 | Soil | MGSLALLQSLKESVTSQASVKTLYGEPISAHEKTIIPVAK |
Ga0210389_113667942 | 3300021404 | Soil | MGSVALLQSLKESILSGAGVKAIYGEPITAQGKTVIPV |
Ga0210389_114050161 | 3300021404 | Soil | MGSVALLQSLKDGILGQANVKTIYGEPIPANGKTIIPVA |
Ga0210387_100962541 | 3300021405 | Soil | MALLQSLKESILSQASAKAIYGEPVSALGKTVIPVAKIMYG |
Ga0210391_115780242 | 3300021433 | Soil | MSTLAVLQSLKESVLSQASVKAIYGEPISAHGKTVVP |
Ga0210402_118666251 | 3300021478 | Soil | MSALTILQSLKESILSQANVKAIYGDPITAHGKTV |
Ga0210409_112542582 | 3300021559 | Soil | MSTQPVLQSLKESVLCQASVKALYGEPVLANGKTVIPVAKIA |
Ga0126371_101323223 | 3300021560 | Tropical Forest Soil | MGSLALLQSLKESVLGQASVKAIYGEPISAHEKTIIPVA |
Ga0126371_113834803 | 3300021560 | Tropical Forest Soil | MSSLALLQSLKDSILTQANVKSVYGEPIAAQGKTIIPVAKI |
Ga0224541_10288621 | 3300022521 | Soil | MSTQALLQSLKESILSQASVKAIYGEPISAHGKTVIPVA |
Ga0212123_101101051 | 3300022557 | Iron-Sulfur Acid Spring | VGSQALLQSLKEGILSQASVKAIYGEPVSIQGKTVI |
Ga0212123_103582181 | 3300022557 | Iron-Sulfur Acid Spring | MSTLAVLQSLKESVLSQASVKAIYGEPISAHGRTVVP |
Ga0212123_108919201 | 3300022557 | Iron-Sulfur Acid Spring | MSSLALLQSLKESILSQANVKAIYGEPIAAHGKTVIPVAKS |
Ga0224544_10624291 | 3300023250 | Soil | MGSVALLQSLKDSIVGQAGVKTVFGEPISAQGKTIIPIA |
Ga0224547_10291791 | 3300023255 | Soil | MSTLPLLQSLKESVLSQASVKAIYGEPISAQGKTVIPV |
Ga0207692_108250881 | 3300025898 | Corn, Switchgrass And Miscanthus Rhizosphere | MGSLALLQSLKESVLAQANVKAIYGEPISAHEKTIIPVAK |
Ga0207699_111109591 | 3300025906 | Corn, Switchgrass And Miscanthus Rhizosphere | MGSLALLQSLKESVLAQANVKAIYGEPISAHEKTIIPVA |
Ga0207700_113299143 | 3300025928 | Corn, Switchgrass And Miscanthus Rhizosphere | MSRLALLQSLKESILSQASVKAIYGEPIAAQGKTIIPVAR |
Ga0207709_112181191 | 3300025935 | Miscanthus Rhizosphere | MGSLALLQSLKESILGQASVKTIYGEPILSQGKTIIPV |
Ga0207691_108343122 | 3300025940 | Miscanthus Rhizosphere | MGSLALLQYLKESVLGQANVKAIYGEPISAHEKTIIPVAKIM |
Ga0207658_101575284 | 3300025986 | Switchgrass Rhizosphere | MGSLALLQSLKDSVLGQANVKTIYGEPISAHEKTIIPV |
Ga0207658_103912571 | 3300025986 | Switchgrass Rhizosphere | MGSLALLQSLKESILGQASVKTICGEPISSPGKTIIPVA |
Ga0207641_100112209 | 3300026088 | Switchgrass Rhizosphere | MGSLALLQSLKESILGQASVKTIYGEPISSPGKTIIPVAKI |
Ga0207641_116626772 | 3300026088 | Switchgrass Rhizosphere | VGSLALLQSLKESVLGQANVKAIYGEPISAHEKTIIPVA |
Ga0209375_10504734 | 3300026329 | Soil | MTSVALLQSLKESFLTQADVKAVYGEPITAQGKTVVPVARIIY |
Ga0209690_11654971 | 3300026524 | Soil | MGSLALLQSLRDSVLTQASVKTIYGEPIAAQGKPIIPV |
Ga0179587_110252412 | 3300026557 | Vadose Zone Soil | MSSLALLQSLKESILSQANVKAIYGEPISAYGKTIIP |
Ga0208859_10173641 | 3300027069 | Forest Soil | MGSLALLQSLKDSVLGQANVKAIYGEPVSAHEKTI |
Ga0209106_10625912 | 3300027616 | Forest Soil | VGSLALLQSLKESILGQASVKTIYGEPISAHGKTII |
Ga0209167_102190411 | 3300027867 | Surface Soil | MSSLAFLQSLKDSVLGQASVKAIYGEPISAHGKTVIP |
Ga0209579_100016331 | 3300027869 | Surface Soil | MGALALLQSLKESVLSQASVKSIYGEPISAQGKTV |
Ga0209579_104348971 | 3300027869 | Surface Soil | MGTLTVLQSLKDNILSQASVKAIYGEPISANGKTV |
Ga0209624_102485071 | 3300027895 | Forest Soil | MSTQAILQSLKESILSQASVKAIYGEPISAHGKTVVPVAKIMYG |
Ga0209526_104683941 | 3300028047 | Forest Soil | MSTLSLLQSLKESILSQASVKAIYGEPISAHGKTVVPIAKIMY |
Ga0265338_111294571 | 3300028800 | Rhizosphere | MGSVALLQSLKDGILGQASVKAIYGEPIPAHGKTIVPVAKIL |
Ga0308309_103547243 | 3300028906 | Soil | MGSLALLQSLKESVLGQANVKAIYGEPISAHEKTIIPVAK |
Ga0308309_105164171 | 3300028906 | Soil | MSALTILQSLKESILSQANVKAIYGDPITAHGKTVI |
Ga0302324_1006861642 | 3300031236 | Palsa | VGSVALLQSLKEGILGQVSVKTIYGEPIPAHGKTIIPV |
Ga0310915_112637892 | 3300031573 | Soil | MGTFALLQSLKESILADANVKAIYGEPISAHEKTIIPVARIMY |
Ga0307476_101952911 | 3300031715 | Hardwood Forest Soil | MSSLALLQSLKESILSQANVKAVYGEPIAAQGKTIIPVAKII |
Ga0307469_101341603 | 3300031720 | Hardwood Forest Soil | MGSLALLQSLKESVLSQANVKAIYGEPISAHEKTIIPVAKM |
Ga0307473_105025311 | 3300031820 | Hardwood Forest Soil | MGSLALLQSLKESVLSQANVKAIYGEPISAHEKTIIPVAKMMY |
Ga0307473_111690322 | 3300031820 | Hardwood Forest Soil | MGSLALLQSLKDSVLGQASVRTIYGEPISAHGKTIIPV |
Ga0307478_100812462 | 3300031823 | Hardwood Forest Soil | MSSLALLQSLKESILSQANVKAIYGEPIVAQAKTVIPVAKIMYG |
Ga0307479_102865011 | 3300031962 | Hardwood Forest Soil | MGSLALLQSLKDSVLGQANVKAIYGEPVSAHEKTII |
Ga0307479_103954681 | 3300031962 | Hardwood Forest Soil | MGSLALMQSLKESVLTQANVKTIYGEPIQAQGKTIIPVAKI |
Ga0335074_100065379 | 3300032895 | Soil | MGSAALLQSLKEGILGQARVKAIYGEPITPQGKTIIPVAKLVYG |
Ga0335074_115324242 | 3300032895 | Soil | MGSVALLQSLKESILSGAGVKAIYGEPITAQGKTIVP |
Ga0335072_104088332 | 3300032898 | Soil | MSSVAILQSLKDSTLAANVKSVYGEPITAQGKTVIPV |
Ga0335077_109112941 | 3300033158 | Soil | MGALAVLQSLRDGILGQATVKTIYGEPIAANGKTVI |
Ga0310914_109509573 | 3300033289 | Soil | MEVLKMSGQALLQSLKESFVTQANVKAVYGEPITARG |
⦗Top⦘ |