NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome Family F083860

Metagenome Family F083860

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F083860
Family Type Metagenome
Number of Sequences 112
Average Sequence Length 46 residues
Representative Sequence MDRKQLMKTYVLFVAALGAAALAQSLRTLNLAHVDPLMLVILIGLAAAA
Number of Associated Samples 81
Number of Associated Scaffolds 112

Quality Assessment
Transcriptomic Evidence No
Most common taxonomic group Bacteria
% of genes with valid RBS motifs 100.00 %
% of genes near scaffold ends (potentially truncated) 99.11 %
% of genes from short scaffolds (< 2000 bps) 71.43 %
Associated GOLD sequencing projects 75
AlphaFold2 3D model prediction Yes
3D model pTM-score0.42

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Bacteria (95.536 % of family members)
NCBI Taxonomy ID 2
Taxonomy All Organisms → cellular organisms → Bacteria

Most Common Ecosystem
GOLD Ecosystem Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere
(16.964 % of family members)
Environment Ontology (ENVO) Unclassified
(30.357 % of family members)
Earth Microbiome Project Ontology (EMPO) Host-associated → Plant → Plant rhizosphere
(52.679 % of family members)


 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      

 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Globular Signal Peptide: No Secondary Structure distribution: α-helix: 53.25%    β-sheet: 0.00%    Coil/Unstructured: 46.75%
Feature Viewer
Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer
Per-residue confidence (pLDDT):
  0-50   51-70   71-90   91-100  		pTM-score: 0.42
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.

 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 112 Family Scaffolds
PF00082Peptidase_S8 80.36
PF02729OTCace_N 2.68
PF01865PhoU_div 2.68
PF13487HD_5 0.89
PF01061ABC2_membrane 0.89
PF01266DAO 0.89
PF13432TPR_16 0.89
PF01384PHO4 0.89
PF00005ABC_tran 0.89

Neighboring Clusters of Orthologous Genes (COGs)

COG IDNameFunctional Category % Frequency in 112 Family Scaffolds
COG1392Phosphate transport regulator YkaA, distantly related to PhoU, UPF0111/DUF47 familyInorganic ion transport and metabolism [P] 2.68
COG0306Phosphate/sulfate permeaseInorganic ion transport and metabolism [P] 0.89

 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms95.54 %
UnclassifiedrootN/A4.46 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
3300000956|JGI10216J12902_109475906All Organisms → cellular organisms → Bacteria504Open in IMG/M
3300002907|JGI25613J43889_10226383All Organisms → cellular organisms → Bacteria505Open in IMG/M
3300005172|Ga0066683_10166527All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium1357Open in IMG/M
3300005180|Ga0066685_10070050All Organisms → cellular organisms → Bacteria2296Open in IMG/M
3300005180|Ga0066685_10088832All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium2050Open in IMG/M
3300005180|Ga0066685_10621628All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium743Open in IMG/M
3300005330|Ga0070690_101394921All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium564Open in IMG/M
3300005336|Ga0070680_100965710All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi735Open in IMG/M
3300005445|Ga0070708_100969664All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi797Open in IMG/M
3300005445|Ga0070708_101624133All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium601Open in IMG/M
3300005446|Ga0066686_10397751All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium941Open in IMG/M
3300005458|Ga0070681_10278255All Organisms → cellular organisms → Bacteria1584Open in IMG/M
3300005467|Ga0070706_100069181All Organisms → cellular organisms → Bacteria3265Open in IMG/M
3300005467|Ga0070706_100166032All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium2061Open in IMG/M
3300005467|Ga0070706_100887797All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium824Open in IMG/M
3300005468|Ga0070707_100485170All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium1197Open in IMG/M
3300005471|Ga0070698_101331299Not Available668Open in IMG/M
3300005536|Ga0070697_100392485All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi1203Open in IMG/M
3300005546|Ga0070696_100165750All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi1630Open in IMG/M
3300005555|Ga0066692_10149200All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium1434Open in IMG/M
3300006845|Ga0075421_100003517All Organisms → cellular organisms → Bacteria18760Open in IMG/M
3300006845|Ga0075421_100277280All Organisms → cellular organisms → Bacteria2046Open in IMG/M
3300006847|Ga0075431_100008203All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi10438Open in IMG/M
3300006852|Ga0075433_10256979All Organisms → cellular organisms → Bacteria1549Open in IMG/M
3300006852|Ga0075433_10343930All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi1318Open in IMG/M
3300006852|Ga0075433_10656555All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium919Open in IMG/M
3300006854|Ga0075425_101132404All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi890Open in IMG/M
3300006876|Ga0079217_10814167All Organisms → cellular organisms → Bacteria651Open in IMG/M
3300006894|Ga0079215_10043521All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi1697Open in IMG/M
3300006894|Ga0079215_10981511Not Available618Open in IMG/M
3300006969|Ga0075419_10002822All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi11132Open in IMG/M
3300006969|Ga0075419_10082192All Organisms → cellular organisms → Bacteria2052Open in IMG/M
3300007004|Ga0079218_10574289All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium1021Open in IMG/M
3300007255|Ga0099791_10010250All Organisms → cellular organisms → Bacteria3910Open in IMG/M
3300007265|Ga0099794_10133829All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium1253Open in IMG/M
3300009012|Ga0066710_100109371All Organisms → cellular organisms → Bacteria3727Open in IMG/M
3300009012|Ga0066710_100321160All Organisms → cellular organisms → Bacteria2277Open in IMG/M
3300009012|Ga0066710_100390021All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium2072Open in IMG/M
3300009012|Ga0066710_102933441All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium667Open in IMG/M
3300009100|Ga0075418_10673106All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium1115Open in IMG/M
3300009147|Ga0114129_10063864All Organisms → cellular organisms → Bacteria5139Open in IMG/M
3300009147|Ga0114129_10322962All Organisms → cellular organisms → Bacteria2052Open in IMG/M
3300009147|Ga0114129_10326760All Organisms → cellular organisms → Bacteria2038Open in IMG/M
3300009147|Ga0114129_10366221All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi1906Open in IMG/M
3300009162|Ga0075423_10459873All Organisms → cellular organisms → Bacteria1338Open in IMG/M
3300010336|Ga0134071_10438165All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium669Open in IMG/M
3300010399|Ga0134127_10355882All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi1432Open in IMG/M
3300010399|Ga0134127_12013076All Organisms → cellular organisms → Bacteria655Open in IMG/M
3300010399|Ga0134127_12717928All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium575Open in IMG/M
3300010399|Ga0134127_12832250All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium564Open in IMG/M
3300010403|Ga0134123_12818057All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium555Open in IMG/M
3300012189|Ga0137388_10984791All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium778Open in IMG/M
3300012203|Ga0137399_10707127All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi848Open in IMG/M
3300012204|Ga0137374_10077691All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes3234Open in IMG/M
3300012208|Ga0137376_10142651All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium2056Open in IMG/M
3300012211|Ga0137377_10017083All Organisms → cellular organisms → Bacteria6313Open in IMG/M
3300012211|Ga0137377_10620137All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium1018Open in IMG/M
3300012351|Ga0137386_10559816All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium823Open in IMG/M
3300012353|Ga0137367_10792461Not Available658Open in IMG/M
3300012355|Ga0137369_10738644All Organisms → cellular organisms → Bacteria675Open in IMG/M
3300012360|Ga0137375_10516549All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi1013Open in IMG/M
3300012532|Ga0137373_10034302All Organisms → cellular organisms → Bacteria4888Open in IMG/M
3300012685|Ga0137397_10170554All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi1616Open in IMG/M
3300015245|Ga0137409_10354174All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi1279Open in IMG/M
3300015358|Ga0134089_10371927All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium606Open in IMG/M
3300017997|Ga0184610_1243359Not Available599Open in IMG/M
3300018027|Ga0184605_10128045All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium1134Open in IMG/M
3300018028|Ga0184608_10393374All Organisms → cellular organisms → Bacteria603Open in IMG/M
3300018052|Ga0184638_1242720All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi623Open in IMG/M
3300018071|Ga0184618_10068586All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi1332Open in IMG/M
3300018072|Ga0184635_10390652Not Available528Open in IMG/M
3300018076|Ga0184609_10166752All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi1018Open in IMG/M
3300018076|Ga0184609_10280982All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi779Open in IMG/M
3300018078|Ga0184612_10370058All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi724Open in IMG/M
3300022694|Ga0222623_10027033All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Clostridia → Eubacteriales2164Open in IMG/M
3300022694|Ga0222623_10161008All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi873Open in IMG/M
3300022694|Ga0222623_10166339All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium858Open in IMG/M
3300025167|Ga0209642_10312983All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium891Open in IMG/M
3300025904|Ga0207647_10516849All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi665Open in IMG/M
3300025907|Ga0207645_10820423All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium632Open in IMG/M
3300025910|Ga0207684_10710449All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi854Open in IMG/M
3300025917|Ga0207660_10063773All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes2658Open in IMG/M
3300025917|Ga0207660_10827874All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi755Open in IMG/M
3300025923|Ga0207681_11379635All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium592Open in IMG/M
3300025934|Ga0207686_10262318All Organisms → cellular organisms → Bacteria1267Open in IMG/M
3300025938|Ga0207704_10582056All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi914Open in IMG/M
3300025960|Ga0207651_10353332All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi1238Open in IMG/M
3300026075|Ga0207708_10751906All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi837Open in IMG/M
3300026323|Ga0209472_1038457All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi2130Open in IMG/M
3300026324|Ga0209470_1000848All Organisms → cellular organisms → Bacteria23844Open in IMG/M
3300026324|Ga0209470_1047217All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium2096Open in IMG/M
3300026343|Ga0209159_1051230All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium2028Open in IMG/M
3300026540|Ga0209376_1200317All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium908Open in IMG/M
3300027695|Ga0209966_1065744All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi789Open in IMG/M
3300027873|Ga0209814_10215767All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi830Open in IMG/M
3300027875|Ga0209283_10021690All Organisms → cellular organisms → Bacteria3944Open in IMG/M
3300027875|Ga0209283_10117872All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium1747Open in IMG/M
3300027880|Ga0209481_10043699All Organisms → cellular organisms → Bacteria2060Open in IMG/M
3300027886|Ga0209486_10041269All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi2272Open in IMG/M
3300027886|Ga0209486_10162610All Organisms → cellular organisms → Bacteria1238Open in IMG/M
3300027886|Ga0209486_10542558All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi729Open in IMG/M
3300027909|Ga0209382_10021960All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria7734Open in IMG/M
3300027909|Ga0209382_10333929All Organisms → cellular organisms → Bacteria1702Open in IMG/M
3300028796|Ga0307287_10088284All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium1166Open in IMG/M
3300028819|Ga0307296_10268569All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium929Open in IMG/M
3300028828|Ga0307312_10294875All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi1055Open in IMG/M
3300028828|Ga0307312_10306093All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi1035Open in IMG/M
3300028881|Ga0307277_10048989All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium1719Open in IMG/M
3300028884|Ga0307308_10267021All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi820Open in IMG/M
3300032180|Ga0307471_102418096All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi664Open in IMG/M
3300033233|Ga0334722_10004961All Organisms → cellular organisms → Bacteria13623Open in IMG/M
3300033233|Ga0334722_10046677All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium3446Open in IMG/M


 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
Populus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere16.96%
Vadose Zone SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil15.18%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Soil10.71%
Corn, Switchgrass And Miscanthus RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere9.82%
Groundwater SedimentEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment8.04%
Agricultural SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil6.25%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil5.36%
Terrestrial SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil4.46%
Grasslands SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil4.46%
Corn RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere3.57%
Groundwater SedimentEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment2.68%
SedimentEnvironmental → Aquatic → Freshwater → Lake → Sediment → Sediment1.79%
Grasslands SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil1.79%
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere1.79%
Hardwood Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil0.89%
Switchgrass RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Switchgrass Rhizosphere0.89%
SoilEnvironmental → Terrestrial → Soil → Loam → Unclassified → Soil0.89%
Corn RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere0.89%
Arabidopsis Thaliana RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Arabidopsis Thaliana Rhizosphere0.89%
Miscanthus RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere0.89%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere0.89%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Miscanthus Rhizosphere0.89%

Visualization
Powered by ApexCharts



Associated Samples

Taxon OIDSample NameHabitat TypeIMG/M Link
3300000956Soil microbial communities from Great Prairies - Kansas, Native Prairie soilEnvironmentalOpen in IMG/M
3300002907Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_40cmEnvironmentalOpen in IMG/M
3300005172Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_132EnvironmentalOpen in IMG/M
3300005180Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_134EnvironmentalOpen in IMG/M
3300005330Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaGEnvironmentalOpen in IMG/M
3300005336Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaGEnvironmentalOpen in IMG/M
3300005445Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaGEnvironmentalOpen in IMG/M
3300005446Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_135EnvironmentalOpen in IMG/M
3300005458Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaGEnvironmentalOpen in IMG/M
3300005467Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaGEnvironmentalOpen in IMG/M
3300005468Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaGEnvironmentalOpen in IMG/M
3300005471Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaGEnvironmentalOpen in IMG/M
3300005536Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaGEnvironmentalOpen in IMG/M
3300005546Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaGEnvironmentalOpen in IMG/M
3300005555Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_141EnvironmentalOpen in IMG/M
3300006845Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD5Host-AssociatedOpen in IMG/M
3300006847Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5Host-AssociatedOpen in IMG/M
3300006852Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2Host-AssociatedOpen in IMG/M
3300006854Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD4Host-AssociatedOpen in IMG/M
3300006876Agricultural soil microbial communities from Utah to study Nitrogen management - NC AS200EnvironmentalOpen in IMG/M
3300006894Agricultural soil microbial communities from Utah to study Nitrogen management - NC ControlEnvironmentalOpen in IMG/M
3300006969Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD3Host-AssociatedOpen in IMG/M
3300007004Agricultural soil microbial communities from Utah to study Nitrogen management - NC CompostEnvironmentalOpen in IMG/M
3300007255Vadose zone soil and rhizosphere microbial communities from the Eel River Critical Zone Observatory, Northern California to study diel carbon cycling - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_1EnvironmentalOpen in IMG/M
3300007265Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1EnvironmentalOpen in IMG/M
3300009012Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_159EnvironmentalOpen in IMG/M
3300009100Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD2Host-AssociatedOpen in IMG/M
3300009147Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2)Host-AssociatedOpen in IMG/M
3300009162Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD2Host-AssociatedOpen in IMG/M
3300010336Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_5_09082015EnvironmentalOpen in IMG/M
3300010399Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-3EnvironmentalOpen in IMG/M
3300010403Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-3EnvironmentalOpen in IMG/M
3300012189Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h1.4A metaGEnvironmentalOpen in IMG/M
3300012203Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz3.16 metaGEnvironmentalOpen in IMG/M
3300012204Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_100_16 metaGEnvironmentalOpen in IMG/M
3300012208Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_20_16 metaGEnvironmentalOpen in IMG/M
3300012211Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_40_16 metaGEnvironmentalOpen in IMG/M
3300012351Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_100_16 metaGEnvironmentalOpen in IMG/M
3300012353Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_80_16 metaGEnvironmentalOpen in IMG/M
3300012355Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_113_16 metaGEnvironmentalOpen in IMG/M
3300012360Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_113_16 metaGEnvironmentalOpen in IMG/M
3300012532Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_80_16 metaGEnvironmentalOpen in IMG/M
3300012685Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz1.16 metaGEnvironmentalOpen in IMG/M
3300015245Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug1_16fungal (Hybrid Assembly)EnvironmentalOpen in IMG/M
3300015358Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Glu_40cm_5_24_1 metaGEnvironmentalOpen in IMG/M
3300017997Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_100_coexEnvironmentalOpen in IMG/M
3300018027Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM0_30_coexEnvironmentalOpen in IMG/M
3300018028Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_30_coexEnvironmentalOpen in IMG/M
3300018052Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3-1_50_b2EnvironmentalOpen in IMG/M
3300018071Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM0_30_b1EnvironmentalOpen in IMG/M
3300018072Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3_30_b2EnvironmentalOpen in IMG/M
3300018076Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_60_coexEnvironmentalOpen in IMG/M
3300018078Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3_60_coexEnvironmentalOpen in IMG/M
3300022694Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM2_30_coexEnvironmentalOpen in IMG/M
3300025167Soil microbial communities from Rifle, Colorado - Rifle CSP2_sed 19_2 (SPAdes)EnvironmentalOpen in IMG/M
3300025904Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes)Host-AssociatedOpen in IMG/M
3300025907Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025910Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025917Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025923Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025934Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025938Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300025960Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300026075Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300026323Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_130 (SPAdes)EnvironmentalOpen in IMG/M
3300026324Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_125 (SPAdes)EnvironmentalOpen in IMG/M
3300026343Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_144 (SPAdes)EnvironmentalOpen in IMG/M
3300026540Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_134 (SPAdes)EnvironmentalOpen in IMG/M
3300027695Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM (SPAdes)Host-AssociatedOpen in IMG/M
3300027873Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD1 (SPAdes)Host-AssociatedOpen in IMG/M
3300027875Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H1.8 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300027880Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD3 (SPAdes)Host-AssociatedOpen in IMG/M
3300027886Agricultural soil microbial communities from Utah to study Nitrogen management - NC Compost (SPAdes)EnvironmentalOpen in IMG/M
3300027909Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD5 (SPAdes)Host-AssociatedOpen in IMG/M
3300028796Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_141EnvironmentalOpen in IMG/M
3300028819Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_153EnvironmentalOpen in IMG/M
3300028828Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_202EnvironmentalOpen in IMG/M
3300028881Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_116EnvironmentalOpen in IMG/M
3300028884Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_195EnvironmentalOpen in IMG/M
3300032180Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_515EnvironmentalOpen in IMG/M
3300033233Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - C3_bottomEnvironmentalOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap


 ⦗Top⦘

Family Sequences

Protein ID Sample Taxon ID Habitat Sequence
JGI10216J12902_10947590623300000956SoilMRQGLRPYVLFVAALGGAAVAQSLRTLSFERVDPLMLAILIGLAAAAQRMPVFLFRSS
JGI25613J43889_1022638323300002907Grasslands SoilMRQGLRIYVLFVAALGAAALAQSLRTISLSHVDPLMLLILVALAAAAQRMPVFLFRSS
Ga0066683_1016652723300005172SoilMRQGLRAYVLFVAALGALALAQSLRTLSLAHVDPLMLVILV
Ga0066685_1007005033300005180SoilMDRTQLMKTYVLFVAALGALALAQSLRTLSLAHVDPLMLAILVALAAAAQ
Ga0066685_1008883233300005180SoilMRQGLRAYVLFVAALGALALAQSLRTLSLAHVDPLMLAILVALAAAAQ
Ga0066685_1062162813300005180SoilMDRKQLMKTYVLFVAALGALALAQSLRTLSLAHVDPLMLAILIGLAAAAQ
Ga0070690_10139492123300005330Switchgrass RhizosphereMDRKQLMKTYVLFVAALGAAALAQSLRTLNLAHVDPLMLV
Ga0070680_10096571023300005336Corn RhizosphereMDRKQLMKTYVLFVAALGAAALAQSLRTLNLAHVDPLMLVILIGL
Ga0070708_10096966413300005445Corn, Switchgrass And Miscanthus RhizosphereMDRKQLMKTYVLFVAGLGALALAQSLRTLSLVHVDPLMLAILIALAAAAQ
Ga0070708_10162413313300005445Corn, Switchgrass And Miscanthus RhizosphereMRQGLGLYVLFVAGLGALALAQSLRTLSLVHVDPLMLAILIALAAA
Ga0066686_1039775113300005446SoilMRQGLRVYVLFVAALGALALAQSLRTLSLAHVDPLMLAILIGLAAAAQ
Ga0070681_1027825513300005458Corn RhizosphereMRQGVRVYVLFVAALGAAALAQSLRTLNLAHVDPLMLVILIGLAAAAQRMPV
Ga0070706_10006918143300005467Corn, Switchgrass And Miscanthus RhizosphereMDRKQLLKTYVLFVAALGALALAQSLRTLSLVHVDPLMLAILIALAAAAQ
Ga0070706_10016603233300005467Corn, Switchgrass And Miscanthus RhizosphereMRQGLRFYVLFVAALGALALAQSLRTLSLVHVDPLMLAILIALAAAAQ
Ga0070706_10088779723300005467Corn, Switchgrass And Miscanthus RhizosphereMRQELRFYVLFVAALGAAALAQSLRTVSLAHVDPLMLAILIGLAAAAQR
Ga0070707_10048517013300005468Corn, Switchgrass And Miscanthus RhizosphereMRQGLRLYVLFVAGLGALALAQSLRTLSLVHVDPLMLAILIALAAAAQ
Ga0070698_10133129923300005471Corn, Switchgrass And Miscanthus RhizosphereMTSGLRVYVLFVAALGAAALAQSLRTLNLSHVDPLMLVILIALA
Ga0070697_10039248513300005536Corn, Switchgrass And Miscanthus RhizosphereMDRKQLIKTYVLFVAALGAAALAQSLRTLNLSHVDPLMLVILIALAAAA
Ga0070696_10016575023300005546Corn, Switchgrass And Miscanthus RhizosphereMDRKQLMKTYVLFVAALGAAALAQSLRTLNLAHVDPLMLVILIGLAAAAQRMPVFL
Ga0066692_1014920023300005555SoilMRQGLRAYVLFVAALGALALAQSLRTLSLAHVDPLMLAILVALA
Ga0075421_100003517233300006845Populus RhizosphereMDRKQLVKTYILFVAALGAAALAQSLRTVSFDRVDPLMLVILIGLAAAA
Ga0075421_10027728033300006845Populus RhizosphereMRQELRLYILFVAALGAAALAQSLRTVSFDRVDPLMLVILIGLAAAA
Ga0075431_10000820313300006847Populus RhizosphereMDRKQLVKTYILFVAALGAAALAQSLRTVSFDRVDPLMLVILIGL
Ga0075433_1025697913300006852Populus RhizosphereMTTALRFYVLFVAALGAAALAQSLRTLNLAHVDPLMLVILIALAAAA
Ga0075433_1034393013300006852Populus RhizosphereMDRKQLIKAYVLFVAALGAAALAQSLRTLNLAHVDPLMLVILIALAAAA
Ga0075433_1065655523300006852Populus RhizosphereMRQGLRLYVLFVAGLGALALAQSLRTLSLVHVDPLMLAILIALAAAAQR
Ga0075425_10113240423300006854Populus RhizosphereMDRKQLMKTYVLFVAGLGALALAQSLRTLSLVHVDPLMLAILIA
Ga0079217_1081416713300006876Agricultural SoilMRQGLRFYVLFVAALGAAALAQSLRTVSFDRVDPLMLAILIGLAAAAQRMPVFLFCSSAI
Ga0079215_1004352123300006894Agricultural SoilMDRTQLMKTYVLFVAALGAAALAQSLRTVSFERVDPLMLAILIGLAAAAQ
Ga0079215_1098151123300006894Agricultural SoilMRQELRFYVLFVAALGAAALSQSLRTVCFERVDPLMLAILIGLAAAAQRMPVFLFR
Ga0075419_1000282213300006969Populus RhizosphereMDRKQLVKTYILFVAALGAAALAQSLRTVSFDRVDPLMLVILIGLAAAAQ
Ga0075419_1008219233300006969Populus RhizosphereMRQELRLYILFVAALGAAALAQSLRTVSFDRVDPLMLVILIGLAAAAQ
Ga0079218_1057428923300007004Agricultural SoilMRQELRFYVLFVAALGAAALAQSLRTVSFDRVDPFMLAILIGLAAAAQ
Ga0099791_1001025053300007255Vadose Zone SoilMDRKQLMKTYVLFVAGLGAVALAQSLRTLSLVHVDPLMLAILIALAA
Ga0099794_1013382913300007265Vadose Zone SoilVLFVAGLGAVALAQSLRTLSLVHVDPLMLAILIALAAA
Ga0066710_10010937113300009012Grasslands SoilMDRKQLMKTYVLFVAALGALALAQSLRTLSLVHVDPLMLAILIGLAAAAQ
Ga0066710_10032116013300009012Grasslands SoilMDRTQLMKTYVLFVAALGALALAQSLRTLSLAHVDPLMLAILVALAAAAQR
Ga0066710_10039002113300009012Grasslands SoilMRQGLRVYVLFVAALGALALAQSLRTLSLAHVDPLMLAILIGLAAAAQR
Ga0066710_10293344113300009012Grasslands SoilMDRKQLMKTYVLFVAALGALALAQSLRTLSLAHVDPLMLAILIGLAAAAQR
Ga0075418_1067310613300009100Populus RhizosphereLYILFVAALGAAALAQSLRTVSFDRVDPLMLVILI
Ga0114129_1006386463300009147Populus RhizosphereMDRKQLIKAYVLFVAALGAAALAQSLRTLNLAHVDPLMLVILIALAAAAQ
Ga0114129_1032296233300009147Populus RhizosphereLYILFVAALGAAALAQSLRTVSFDRVDPLMLVILIGLAAAAQ
Ga0114129_1032676033300009147Populus RhizosphereMTTALRFYVLFVAALGAAALAQSLRTLNLAHVDPLMLVILIALAAAAQ
Ga0114129_1036622123300009147Populus RhizosphereMDRKQLMKTYVLFVAGLGALALAQSLRTLSLVHVDPLMLAILIALAAAAQR
Ga0075423_1045987323300009162Populus RhizosphereMTTALRFYVLFVAALGAAALAQSLRTLNLAHVDPLMLVILIALA
Ga0134071_1043816523300010336Grasslands SoilMDRKQLMQTYVLFVAALGALALAQSLRTLSLTHVDPLMLAILIALAAAA
Ga0134127_1035588223300010399Terrestrial SoilMDRKQLMKTYVLFVAALGAAALAQSLRTLNLAHVDPLMLVILIGLAA
Ga0134127_1201307613300010399Terrestrial SoilMRQELRFYVLFVAALGAAALAQSLRTVSLAHVDPLMLAILIGLAAAAQRMPVFLFRS
Ga0134127_1271792813300010399Terrestrial SoilMDRKQLMKTYVLFVAALGAAALAQSLRTLNLAHVDPLMLVI
Ga0134127_1283225013300010399Terrestrial SoilMDRKQLMKTYVLFVAALGAAALAQSLRTLNLAHVDPL
Ga0134123_1281805713300010403Terrestrial SoilMTSGLRVYVLFVAALGAAALAQSLRTLNLAHVDPLMLVILI
Ga0137388_1098479113300012189Vadose Zone SoilVRQGLRLYVLFVAGLGAVALAQSLRTLSLVHVDPL
Ga0137399_1070712723300012203Vadose Zone SoilMDRKQLVKIFVLFVAALGAAALAQSLRTLSLERVDPLMLVILVGLAAAAQRM
Ga0137374_1007769133300012204Vadose Zone SoilMTSGLRIYVLFVAALGAAALAQSLRTLSLAHVDPLMLVILIG
Ga0137376_1014265113300012208Vadose Zone SoilMRQGLRAYVLFVAALGALALAQSLRTLSLAHVDPLMLAILVALAAAAQR
Ga0137377_1001708383300012211Vadose Zone SoilMDRTQLMKTYVLFVAALGALALAQSLRTLSLAHVDP
Ga0137377_1062013713300012211Vadose Zone SoilVTNGLRVYVLFVAALGALALAQSLRTLSLAHVDPLMLAIL
Ga0137386_1055981623300012351Vadose Zone SoilMRQGLRVYVLFVAALGALALAQSLRTLSLAHVDPL
Ga0137367_1079246123300012353Vadose Zone SoilMDRKQLVKTYVLFVAALGAAALAQSLRTLSLERVDPLML
Ga0137369_1073864413300012355Vadose Zone SoilMRLGLRIYVLFIAALGAAALAQSLRTLSLAHVDPLMLVI
Ga0137375_1051654913300012360Vadose Zone SoilMDRKQLVKTYVLFVATLGAAALAQSLRTLSLERVDPLMLAILI
Ga0137373_1003430253300012532Vadose Zone SoilMERKQLMKTYVLFVAALGAAALAQSLRTLSLAHVDPLMLVILI
Ga0137397_1017055413300012685Vadose Zone SoilMERKQLMKNYVLFVAALGAAALAQSLRTVSLEHVDPLMLLILVALAAAAQRMPVFLF
Ga0137409_1035417413300015245Vadose Zone SoilMDRTQLMKTYVLFVAALGALALAQFLRTLSLAHVVPL
Ga0134089_1037192723300015358Grasslands SoilMRQGLRVYVLFVAALGALALAQSLRTLSLAHVDPLMLAILIGL
Ga0184610_124335923300017997Groundwater SedimentMDREQLVKIYVLFVAALGAAALAQSLRTLNLAHVDPLMLVILIALAAAAQR
Ga0184605_1012804513300018027Groundwater SedimentMRQGLRFYVLFVAALGAAALAQSLRTVSFERVDPLMLAILIG
Ga0184608_1039337423300018028Groundwater SedimentMRQGLRVYVLFVAALGAAALAQSLRTLNLAHVDPLMLVILISLAAAAQRMPVFLFR
Ga0184638_124272023300018052Groundwater SedimentMDRKQLIKTYVLFVAALGAAALAQSLRTLNLAHVDPLMLVILIALAAAAQR
Ga0184618_1006858623300018071Groundwater SedimentMERKQVMKTYVLFVAALGAAALAQSLRTLNLAHVDPLMLVILI
Ga0184635_1039065213300018072Groundwater SedimentMTSGLRFYVLFVAALGAAALAQSLRTLNLAHVDPLMLVILIALAAAAQRMP
Ga0184609_1016675213300018076Groundwater SedimentVDRKQLIKTYVLFVAALGAAALAQSLRTLNLAHVDP
Ga0184609_1028098223300018076Groundwater SedimentMERQQLMKTYVLFVAALGAAALAQSLRTLNLAHVDPLMLAILIGLA
Ga0184612_1037005823300018078Groundwater SedimentVDRKQLIKTYVLFVAALGAAALAQSLRTVSLERVDPLMLAILIGLAA
Ga0222623_1002703323300022694Groundwater SedimentMERQQLMKTYVLFVAALGAAALAQSLRTLNLATSTR
Ga0222623_1016100823300022694Groundwater SedimentMERKQLMKTYVLFVAALGAAALAQSLRTVSLEGVDPLMLAILIGLAAAA
Ga0222623_1016633913300022694Groundwater SedimentMTSGLRIYVLFVAALGAAALAQSLRTLNLSHVDPLMLVILI
Ga0209642_1031298323300025167SoilMRQGLRFYVLFIAALGAAALAQSLRTVSFERVDPLMLAIL
Ga0207647_1051684923300025904Corn RhizosphereMDRKQLMKTYVLFVAALGAAALAQSLRTLNLAHVDPLMLVILIALAAAAQ
Ga0207645_1082042313300025907Miscanthus RhizosphereMDRKQLMKTYVLFVAALGAAALAQSLRTLNLAHVDPLML
Ga0207684_1071044913300025910Corn, Switchgrass And Miscanthus RhizosphereMDRKQLMKTYVLFVAGLGALALAQSLRTLSLVHVDPLMLAILI
Ga0207660_1006377313300025917Corn RhizosphereMRQGVRVYVLFVAALGAAALAQSLRTLNLAHVDPLMLVIL
Ga0207660_1082787413300025917Corn RhizosphereMDRKQLMKTYVLFVAALGAAALAQSLRTLNLAHVDPLMLVILIGLAAAA
Ga0207681_1137963523300025923Switchgrass RhizosphereMDRKQLMKTYVLFVAALGAAALAQSLRTLNLAHVDPLMLVILIALAAAAQRMPVFLFR
Ga0207686_1026231813300025934Miscanthus RhizosphereMTSGLRVYVLFVAALGAAALAQSLRTLNLAHVDPLM
Ga0207704_1058205623300025938Miscanthus RhizosphereMDRKQLMKTYVLFVAALGAAALAQSLRTLNLAHVDP
Ga0207651_1035333213300025960Switchgrass RhizosphereMDRKQLMKTYVLFVAALGAAALAQSLRTLNLAHVD
Ga0207708_1075190623300026075Corn, Switchgrass And Miscanthus RhizosphereMDRKQLMKTYVLFVAALGAAALAQSLRTLNLAHVDPLMLVIL
Ga0209472_103845733300026323SoilMDRTQLMKTYVLFVAALGALALAQSLRTLSLAHVDPLMLAILVALAAAAQRM
Ga0209470_100084813300026324SoilMDRKQLMKTYVLFVAALGALALAQSLRTLSLAHVDPLMLAILIGLAAAAQRM
Ga0209470_104721713300026324SoilMRQGLRVYVLFVAALGALALAQSLRTLSLAHVDPLMLAILIGLAAAAQRM
Ga0209159_105123013300026343SoilMRQGLRAYVLFVAALGALALAQSLRTLSLAHVDPLMLA
Ga0209376_120031713300026540SoilMRQGLRAYVLFVAALGALALAQSLRTLSLAHVDPLMLAILVALAAAAQRM
Ga0209966_106574413300027695Arabidopsis Thaliana RhizosphereMDRKQLMKTYVLFVAALGAAALAQSLRTLNLAHVDPLMLVILIGLA
Ga0209814_1021576723300027873Populus RhizosphereMDRKQLVKTYILFVAALGAAALAQSLRTVSFDRVDPLMLVI
Ga0209283_1002169053300027875Vadose Zone SoilMDRKTLIKTYVLFVAGLGAVALAQSLRTLSLVHVD
Ga0209283_1011787223300027875Vadose Zone SoilVRQGLRLYVLFVAGLGAVALAQSLRTLSLVHVDPLMLAILIALAAA
Ga0209481_1004369933300027880Populus RhizosphereMRQELRLYILFVAALGAAALAQSLRTVSFDRVDPLMLVILIGLAAAAQR
Ga0209486_1004126913300027886Agricultural SoilMDRTQLMKTYVLFVAALGAAALAQSLRTVSFERVDPLMLAILIGLAAAAQR
Ga0209486_1016261013300027886Agricultural SoilMRQELRFYVLFVAALGAAALAQSLRTVSFERVDPLMLAILIGLAAAAQR
Ga0209486_1054255813300027886Agricultural SoilMDRKQLVKTYVLFVAALGAAALAQSLRTVSLERVDPLMLAILIGLAAAAQR
Ga0209382_1002196013300027909Populus RhizosphereMDRKQLVKTYILFVAALGAAALAQSLRTVSFDRVDPLMLVIL
Ga0209382_1033392913300027909Populus RhizosphereMRQELRLYILFVAALGAAALAQSLRTVSFDRVDPLMLVILI
Ga0307287_1008828413300028796SoilMRQGLRVYVLFVAALGAAALAQSLRTLNLAHVDPLMLVILISLAAAAQR
Ga0307296_1026856923300028819SoilVYVLFVAALGAAALAQSLRTLNLSHVDPLMLVILIGLAAAA
Ga0307312_1029487523300028828SoilMERKQVMKTYVLFVAALGAAALAQSLRTLNLAHVDPLM
Ga0307312_1030609323300028828SoilMDRKQLVKTYVLFVAALGAAALAQSLRTLNLSHVDPLMLVILIGLAAAAQR
Ga0307277_1004898913300028881SoilMRQGLRFYVLFIAALGAAALAQSLRTVSFERVDPLMLAILIGLAAAAQRI
Ga0307308_1026702123300028884SoilMDRKQLVKTYVLFVAALGAAALAQSLRTLNLSHVDPLMLVILIGLAA
Ga0307471_10241809623300032180Hardwood Forest SoilMDRKQLMKTYVLFVAALGAAALAQSLRTLSLSHVDPLMLVILI
Ga0334722_10004961173300033233SedimentVKLGQYVLTVAALGAVVLAQSARSVSFDGVDPLMLAI
Ga0334722_1004667743300033233SedimentMGKDQDEKGQREVNRLQLYVLTVAALGAVVLAQSARSVSFDGVDPLMLAILIG

 ⦗Top⦘


Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.