NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome / Metatranscriptome Family F083857

Metagenome / Metatranscriptome Family F083857

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F083857
Family Type Metagenome / Metatranscriptome
Number of Sequences 112
Average Sequence Length 43 residues
Representative Sequence MAQLGQFALALAFVVTAYSIVASLVGIRFKNDKLIASGRNA
Number of Associated Samples 101
Number of Associated Scaffolds 112

Quality Assessment
Transcriptomic Evidence Yes
Most common taxonomic group Bacteria
% of genes with valid RBS motifs 100.00 %
% of genes near scaffold ends (potentially truncated) 100.00 %
% of genes from short scaffolds (< 2000 bps) 97.32 %
Associated GOLD sequencing projects 98
AlphaFold2 3D model prediction Yes
3D model pTM-score0.48

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Bacteria (80.357 % of family members)
NCBI Taxonomy ID 2
Taxonomy All Organisms → cellular organisms → Bacteria

Most Common Ecosystem
GOLD Ecosystem Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil
(12.500 % of family members)
Environment Ontology (ENVO) Unclassified
(23.214 % of family members)
Earth Microbiome Project Ontology (EMPO) Free-living → Non-saline → Soil (non-saline)
(44.643 % of family members)


 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      

 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Transmembrane (alpha-helical) Signal Peptide: No Secondary Structure distribution: α-helix: 56.52%    β-sheet: 0.00%    Coil/Unstructured: 43.48%
Feature Viewer
Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer
Per-residue confidence (pLDDT):
  0-50   51-70   71-90   91-100  		pTM-score: 0.48
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.

 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 112 Family Scaffolds
PF03100CcmE 88.39
PF00676E1_dh 2.68
PF13462Thioredoxin_4 2.68
PF07884VKOR 0.89
PF16694Cytochrome_P460 0.89
PF14489QueF 0.89
PF08281Sigma70_r4_2 0.89
PF00155Aminotran_1_2 0.89

Neighboring Clusters of Orthologous Genes (COGs)

COG IDNameFunctional Category % Frequency in 112 Family Scaffolds
COG2332Cytochrome c biogenesis protein CcmEPosttranslational modification, protein turnover, chaperones [O] 88.39
COG05672-oxoglutarate dehydrogenase complex, dehydrogenase (E1) component, and related enzymesEnergy production and conversion [C] 2.68
COG1071TPP-dependent pyruvate or acetoin dehydrogenase subunit alphaEnergy production and conversion [C] 2.68
COG4243Vitamin K epoxide reductase (VKOR) family protein, predicted involvement in disulfide bond formationGeneral function prediction only [R] 0.89

 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms80.36 %
UnclassifiedrootN/A19.64 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
3300000787|JGI11643J11755_11307939All Organisms → cellular organisms → Bacteria796Open in IMG/M
3300000789|JGI1027J11758_12788165All Organisms → cellular organisms → Bacteria → Acidobacteria1224Open in IMG/M
3300000956|JGI10216J12902_120850426All Organisms → cellular organisms → Bacteria → Acidobacteria694Open in IMG/M
3300002558|JGI25385J37094_10097946All Organisms → cellular organisms → Bacteria → Acidobacteria875Open in IMG/M
3300004463|Ga0063356_102048087All Organisms → cellular organisms → Bacteria867Open in IMG/M
3300005332|Ga0066388_104273469All Organisms → cellular organisms → Bacteria728Open in IMG/M
3300005332|Ga0066388_108595033All Organisms → cellular organisms → Bacteria508Open in IMG/M
3300005347|Ga0070668_102148459All Organisms → cellular organisms → Bacteria516Open in IMG/M
3300005354|Ga0070675_100690376All Organisms → cellular organisms → Bacteria929Open in IMG/M
3300005447|Ga0066689_10510825All Organisms → cellular organisms → Bacteria → Acidobacteria758Open in IMG/M
3300005459|Ga0068867_100177949All Organisms → cellular organisms → Bacteria1689Open in IMG/M
3300005554|Ga0066661_10315229All Organisms → cellular organisms → Bacteria962Open in IMG/M
3300005559|Ga0066700_10885789All Organisms → cellular organisms → Bacteria594Open in IMG/M
3300005578|Ga0068854_102273543All Organisms → cellular organisms → Bacteria502Open in IMG/M
3300005713|Ga0066905_100124287All Organisms → cellular organisms → Bacteria → Acidobacteria1807Open in IMG/M
3300005719|Ga0068861_102137810All Organisms → cellular organisms → Bacteria → Acidobacteria560Open in IMG/M
3300005764|Ga0066903_103511173All Organisms → cellular organisms → Bacteria845Open in IMG/M
3300005834|Ga0068851_10953348All Organisms → cellular organisms → Bacteria539Open in IMG/M
3300006032|Ga0066696_10573768All Organisms → cellular organisms → Bacteria735Open in IMG/M
3300006845|Ga0075421_100364046All Organisms → cellular organisms → Bacteria1744Open in IMG/M
3300006852|Ga0075433_11865589All Organisms → cellular organisms → Bacteria516Open in IMG/M
3300006854|Ga0075425_102284496All Organisms → cellular organisms → Bacteria601Open in IMG/M
3300006937|Ga0081243_1369351All Organisms → cellular organisms → Bacteria573Open in IMG/M
3300009233|Ga0103856_10105431Not Available537Open in IMG/M
3300009249|Ga0103862_1048169Not Available595Open in IMG/M
3300009553|Ga0105249_12026013All Organisms → cellular organisms → Bacteria648Open in IMG/M
3300009597|Ga0105259_1114652All Organisms → cellular organisms → Bacteria → Acidobacteria646Open in IMG/M
3300010043|Ga0126380_10149225All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium RIFCSPLOWO2_12_FULL_68_91494Open in IMG/M
3300010114|Ga0127460_1042533All Organisms → cellular organisms → Bacteria → Acidobacteria512Open in IMG/M
3300010124|Ga0127498_1110833All Organisms → cellular organisms → Bacteria → Acidobacteria593Open in IMG/M
3300010358|Ga0126370_11121603All Organisms → cellular organisms → Bacteria → Acidobacteria726Open in IMG/M
3300010361|Ga0126378_13155152Not Available524Open in IMG/M
3300010376|Ga0126381_100555975All Organisms → cellular organisms → Bacteria → Acidobacteria1627Open in IMG/M
3300010398|Ga0126383_12740059All Organisms → cellular organisms → Bacteria → Acidobacteria575Open in IMG/M
3300010399|Ga0134127_11288919All Organisms → cellular organisms → Bacteria → Acidobacteria799Open in IMG/M
3300010399|Ga0134127_12236273All Organisms → cellular organisms → Bacteria → Acidobacteria626Open in IMG/M
3300010400|Ga0134122_10293789All Organisms → cellular organisms → Bacteria → Acidobacteria1392Open in IMG/M
3300010401|Ga0134121_13078922All Organisms → cellular organisms → Bacteria514Open in IMG/M
3300010403|Ga0134123_10987049All Organisms → cellular organisms → Bacteria856Open in IMG/M
3300010403|Ga0134123_11060956All Organisms → cellular organisms → Bacteria → Acidobacteria831Open in IMG/M
3300010895|Ga0138113_180862Not Available568Open in IMG/M
3300011119|Ga0105246_10193212All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1577Open in IMG/M
3300011119|Ga0105246_10400844Not Available1139Open in IMG/M
3300011120|Ga0150983_11150957All Organisms → cellular organisms → Bacteria → Acidobacteria579Open in IMG/M
3300012199|Ga0137383_10033856All Organisms → cellular organisms → Bacteria3603Open in IMG/M
3300012201|Ga0137365_10742134All Organisms → cellular organisms → Bacteria → Acidobacteria717Open in IMG/M
3300012212|Ga0150985_109375800All Organisms → cellular organisms → Bacteria → Acidobacteria552Open in IMG/M
3300012212|Ga0150985_110887181All Organisms → cellular organisms → Bacteria → Acidobacteria598Open in IMG/M
3300012372|Ga0134037_1070346All Organisms → cellular organisms → Bacteria → Acidobacteria569Open in IMG/M
3300012379|Ga0134058_1256864All Organisms → cellular organisms → Bacteria → Acidobacteria564Open in IMG/M
3300012382|Ga0134038_1144828All Organisms → cellular organisms → Bacteria → Acidobacteria526Open in IMG/M
3300012384|Ga0134036_1067579All Organisms → cellular organisms → Bacteria → Acidobacteria572Open in IMG/M
3300012385|Ga0134023_1109083All Organisms → cellular organisms → Bacteria → Acidobacteria604Open in IMG/M
3300012390|Ga0134054_1131351All Organisms → cellular organisms → Bacteria → Acidobacteria551Open in IMG/M
3300012391|Ga0134035_1149053All Organisms → cellular organisms → Bacteria → Acidobacteria573Open in IMG/M
3300012395|Ga0134044_1172122All Organisms → cellular organisms → Bacteria → Acidobacteria652Open in IMG/M
3300012396|Ga0134057_1328350All Organisms → cellular organisms → Bacteria → Acidobacteria525Open in IMG/M
3300012397|Ga0134056_1128688All Organisms → cellular organisms → Bacteria → Acidobacteria635Open in IMG/M
3300012469|Ga0150984_113090227Not Available670Open in IMG/M
3300012519|Ga0157352_1098583Not Available515Open in IMG/M
3300012685|Ga0137397_10686245All Organisms → cellular organisms → Bacteria → Acidobacteria761Open in IMG/M
3300012948|Ga0126375_10416696All Organisms → cellular organisms → Bacteria → Acidobacteria976Open in IMG/M
3300012971|Ga0126369_12148724All Organisms → cellular organisms → Bacteria → Acidobacteria646Open in IMG/M
3300014154|Ga0134075_10382246All Organisms → cellular organisms → Bacteria → Acidobacteria620Open in IMG/M
3300014325|Ga0163163_10183681All Organisms → cellular organisms → Bacteria2139Open in IMG/M
3300014325|Ga0163163_11282649All Organisms → cellular organisms → Bacteria → Acidobacteria795Open in IMG/M
3300015372|Ga0132256_102338712All Organisms → cellular organisms → Bacteria → Acidobacteria637Open in IMG/M
3300015373|Ga0132257_102533959All Organisms → cellular organisms → Bacteria → Acidobacteria667Open in IMG/M
3300015373|Ga0132257_102774916All Organisms → cellular organisms → Bacteria → Acidobacteria638Open in IMG/M
3300015374|Ga0132255_104857661All Organisms → cellular organisms → Bacteria → Acidobacteria569Open in IMG/M
3300015374|Ga0132255_105467699All Organisms → cellular organisms → Bacteria538Open in IMG/M
3300016294|Ga0182041_11813777Not Available566Open in IMG/M
3300018083|Ga0184628_10025043All Organisms → cellular organisms → Bacteria2957Open in IMG/M
3300019263|Ga0184647_1176834All Organisms → cellular organisms → Bacteria → Acidobacteria630Open in IMG/M
3300019361|Ga0173482_10237528All Organisms → cellular organisms → Bacteria769Open in IMG/M
3300020064|Ga0180107_1079573All Organisms → cellular organisms → Bacteria → Acidobacteria577Open in IMG/M
3300020067|Ga0180109_1311072Not Available542Open in IMG/M
3300021080|Ga0210382_10418005All Organisms → cellular organisms → Bacteria → Acidobacteria594Open in IMG/M
3300021560|Ga0126371_11456371All Organisms → cellular organisms → Bacteria → Acidobacteria814Open in IMG/M
3300021560|Ga0126371_13361594Not Available540Open in IMG/M
3300022195|Ga0222625_1801673All Organisms → cellular organisms → Bacteria → Acidobacteria570Open in IMG/M
3300022722|Ga0242657_1252404Not Available506Open in IMG/M
3300022724|Ga0242665_10297161All Organisms → cellular organisms → Bacteria → Acidobacteria564Open in IMG/M
3300022726|Ga0242654_10217668All Organisms → cellular organisms → Bacteria → Acidobacteria671Open in IMG/M
3300022756|Ga0222622_10483538All Organisms → cellular organisms → Bacteria883Open in IMG/M
3300025324|Ga0209640_11085527Not Available611Open in IMG/M
3300025898|Ga0207692_10461718All Organisms → cellular organisms → Bacteria → Acidobacteria801Open in IMG/M
3300025905|Ga0207685_10312191Not Available781Open in IMG/M
3300025926|Ga0207659_10607424All Organisms → cellular organisms → Bacteria → Acidobacteria933Open in IMG/M
3300025935|Ga0207709_10967785Not Available694Open in IMG/M
3300025960|Ga0207651_10339408All Organisms → cellular organisms → Bacteria1262Open in IMG/M
3300026035|Ga0207703_10937562Not Available829Open in IMG/M
3300026324|Ga0209470_1246410All Organisms → cellular organisms → Bacteria → Acidobacteria719Open in IMG/M
3300026332|Ga0209803_1254700All Organisms → cellular organisms → Bacteria → Acidobacteria605Open in IMG/M
3300027909|Ga0209382_11057828All Organisms → cellular organisms → Bacteria → Acidobacteria841Open in IMG/M
3300031058|Ga0308189_10417210All Organisms → cellular organisms → Bacteria → Acidobacteria559Open in IMG/M
3300031081|Ga0308185_1050623All Organisms → cellular organisms → Bacteria → Acidobacteria535Open in IMG/M
3300031093|Ga0308197_10176637All Organisms → cellular organisms → Bacteria → Acidobacteria708Open in IMG/M
3300031099|Ga0308181_1143102Not Available554Open in IMG/M
3300031114|Ga0308187_10409509All Organisms → cellular organisms → Bacteria → Acidobacteria538Open in IMG/M
3300031421|Ga0308194_10252350All Organisms → cellular organisms → Bacteria → Acidobacteria592Open in IMG/M
3300031677|Ga0307480_1017671All Organisms → cellular organisms → Bacteria → Acidobacteria555Open in IMG/M
3300032138|Ga0315338_1204277Not Available576Open in IMG/M
3300032145|Ga0315304_1128249Not Available668Open in IMG/M
3300032145|Ga0315304_1141529All Organisms → cellular organisms → Bacteria → Acidobacteria633Open in IMG/M
3300034661|Ga0314782_139870Not Available584Open in IMG/M
3300034664|Ga0314786_027661All Organisms → cellular organisms → Bacteria → Acidobacteria955Open in IMG/M
3300034665|Ga0314787_104668Not Available529Open in IMG/M
3300034666|Ga0314788_172593All Organisms → cellular organisms → Bacteria → Acidobacteria541Open in IMG/M
3300034666|Ga0314788_176924Not Available537Open in IMG/M
3300034671|Ga0314796_156198Not Available537Open in IMG/M
3300034676|Ga0314801_116771All Organisms → cellular organisms → Bacteria → Acidobacteria614Open in IMG/M


 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
Grasslands SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil12.50%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil8.04%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Soil8.04%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil6.25%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural → Soil6.25%
Terrestrial SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil5.36%
Groundwater SedimentEnvironmental → Aquatic → Freshwater → Sediment → Unclassified → Groundwater Sediment4.46%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil3.57%
Arabidopsis RhizosphereHost-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere3.57%
Populus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere3.57%
Vadose Zone SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil2.68%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil2.68%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere2.68%
River WaterEnvironmental → Aquatic → Freshwater → Unclassified → Unclassified → River Water1.79%
MarineEnvironmental → Aquatic → Marine → Oceanic → Unclassified → Marine1.79%
Corn, Switchgrass And Miscanthus RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere1.79%
Avena Fatua RhizosphereHost-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Avena Fatua Rhizosphere1.79%
Corn RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere1.79%
Switchgrass RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere1.79%
Switchgrass RhizosphereHost-Associated → Plants → Roots → Rhizosphere → Soil → Switchgrass Rhizosphere1.79%
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere1.79%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Miscanthus Rhizosphere1.79%
SeawaterEnvironmental → Aquatic → Marine → Intertidal Zone → Unclassified → Seawater0.89%
SoilEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Soil0.89%
Groundwater SedimentEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment0.89%
Groundwater SedimentEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment0.89%
Unplanted SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Unplanted Soil0.89%
Grasslands SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil0.89%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil0.89%
Hardwood Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil0.89%
Forest SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil0.89%
SoilEnvironmental → Terrestrial → Soil → Loam → Unclassified → Soil0.89%
Arabidopsis Thaliana RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Arabidopsis Thaliana Rhizosphere0.89%
Miscanthus RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere0.89%
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere0.89%
Arabidopsis RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Arabidopsis Rhizosphere0.89%
Avena Fatua RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Avena Fatua Rhizosphere0.89%
Tropical Rainforest SoilEnvironmental → Terrestrial → Soil → Unclassified → Tropical Rainforest → Tropical Rainforest Soil0.89%

Visualization
Powered by ApexCharts



Associated Samples

Taxon OIDSample NameHabitat TypeIMG/M Link
3300000787Soil microbial communities from Great Prairies - Iowa, Continuous Corn soilEnvironmentalOpen in IMG/M
3300000789Soil microbial communities from Great Prairies - Iowa, Native Prairie soilEnvironmentalOpen in IMG/M
3300000956Soil microbial communities from Great Prairies - Kansas, Native Prairie soilEnvironmentalOpen in IMG/M
3300002558Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 09_27_2013_1_40cmEnvironmentalOpen in IMG/M
3300004463Combined assembly of Arabidopsis thaliana microbial communitiesHost-AssociatedOpen in IMG/M
3300005332Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly)EnvironmentalOpen in IMG/M
3300005347Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaGHost-AssociatedOpen in IMG/M
3300005354Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaGHost-AssociatedOpen in IMG/M
3300005447Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_138EnvironmentalOpen in IMG/M
3300005459Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2Host-AssociatedOpen in IMG/M
3300005554Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_110EnvironmentalOpen in IMG/M
3300005559Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_149EnvironmentalOpen in IMG/M
3300005578Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2Host-AssociatedOpen in IMG/M
3300005713Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 36 (version 2)EnvironmentalOpen in IMG/M
3300005719Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2Host-AssociatedOpen in IMG/M
3300005764Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2)EnvironmentalOpen in IMG/M
3300005834Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2Host-AssociatedOpen in IMG/M
3300006032Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_145EnvironmentalOpen in IMG/M
3300006845Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD5Host-AssociatedOpen in IMG/M
3300006852Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2Host-AssociatedOpen in IMG/M
3300006854Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD4Host-AssociatedOpen in IMG/M
3300006937Tropical rainforest soil microbial communities from the Amazon Forest, Brazil, analyzing deforestation - Metatranscriptome F II A01 (Metagenome Metatranscriptome) (version 2)EnvironmentalOpen in IMG/M
3300009233Microbial communities of water from Amazon river, Brazil - RCM9EnvironmentalOpen in IMG/M
3300009249Microbial communities of water from Amazon river, Brazil - RCM15EnvironmentalOpen in IMG/M
3300009553Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaGHost-AssociatedOpen in IMG/M
3300009597Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMZT299EnvironmentalOpen in IMG/M
3300010043Tropical forest soil microbial communities from Panama - MetaG Plot_26EnvironmentalOpen in IMG/M
3300010114Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Wat_40_5_16_2 metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300010124Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Met_40_5_4_2 metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300010358Tropical forest soil microbial communities from Panama - MetaG Plot_3EnvironmentalOpen in IMG/M
3300010361Tropical forest soil microbial communities from Panama - MetaG Plot_23EnvironmentalOpen in IMG/M
3300010376Tropical forest soil microbial communities from Panama - MetaG Plot_28EnvironmentalOpen in IMG/M
3300010398Tropical forest soil microbial communities from Panama - MetaG Plot_35EnvironmentalOpen in IMG/M
3300010399Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-3EnvironmentalOpen in IMG/M
3300010400Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-2EnvironmentalOpen in IMG/M
3300010401Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-1EnvironmentalOpen in IMG/M
3300010403Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-3EnvironmentalOpen in IMG/M
3300010895Grasslands soil microbial communities from Angelo Coastal Reserve, California, USA - 15_R_Wat_40_2_8_2 metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300011119Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaGHost-AssociatedOpen in IMG/M
3300011120Combined assembly of Microbial Forest Soil metaTEnvironmentalOpen in IMG/M
3300012199Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_40_16 metaGEnvironmentalOpen in IMG/M
3300012201Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_40_16 metaGEnvironmentalOpen in IMG/M
3300012212Combined assembly of Hopland grassland soilHost-AssociatedOpen in IMG/M
3300012372Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Glu_20cm_5_0_2 metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300012379Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Glu_40cm_5_4_2 metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300012382Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Glu_20cm_5_4_2 metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300012384Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Glu_20cm_5_24_1 metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300012385Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Glu_20cm_2_4_1 metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300012390Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Glu_40cm_5_8_1 metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300012391Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Glu_20cm_5_16_1 metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300012395Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Glu_40cm_2_8_1 metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300012396Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Glu_40cm_5_0_2 metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300012397Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Glu_40cm_5_24_1 metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300012469Combined assembly of Soil carbon rhizosphereHost-AssociatedOpen in IMG/M
3300012519Unplanted soil (control) microbial communities from North Carolina - M.Soil.7.yng.070610EnvironmentalOpen in IMG/M
3300012685Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz1.16 metaGEnvironmentalOpen in IMG/M
3300012948Tropical forest soil microbial communities from Panama - MetaG Plot_14EnvironmentalOpen in IMG/M
3300012971Tropical forest soil microbial communities from Panama - MetaG Plot_1EnvironmentalOpen in IMG/M
3300014154Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_5_09212015EnvironmentalOpen in IMG/M
3300014325Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaGHost-AssociatedOpen in IMG/M
3300015372Soil combined assemblyHost-AssociatedOpen in IMG/M
3300015373Combined assembly of cpr5 rhizosphereHost-AssociatedOpen in IMG/M
3300015374Col-0 rhizosphere combined assemblyHost-AssociatedOpen in IMG/M
3300016294Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.178EnvironmentalOpen in IMG/M
3300018083Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM4_5_b1EnvironmentalOpen in IMG/M
3300019263Metatranscriptome of groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM4_5 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300019361Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S133-311R-2 (version 2)EnvironmentalOpen in IMG/M
3300020064Metatranscriptome of soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River metaT ERMLIBT27_16_1Ra (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300020067Metatranscriptome of soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River metaT ERMLIBT47_16_1Ra (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300021080Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM0_60_coex redoEnvironmentalOpen in IMG/M
3300021560Tropical forest soil microbial communities from Panama - MetaG Plot_4EnvironmentalOpen in IMG/M
3300022195Metatranscriptome of groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM2_5 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300022722Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-C-12-M (Metagenome Metatranscriptome) (v2)EnvironmentalOpen in IMG/M
3300022724Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-H-17-M (Metagenome Metatranscriptome) (v2)EnvironmentalOpen in IMG/M
3300022726Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-C-30-M (Metagenome Metatranscriptome) (v2)EnvironmentalOpen in IMG/M
3300022756Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM2_5_b1EnvironmentalOpen in IMG/M
3300025324Soil microbial communities from Rifle, Colorado - Rifle CSP2_sed 10_1 (SPAdes)EnvironmentalOpen in IMG/M
3300025898Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025905Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025926Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025935Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025960Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300026035Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300026324Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_125 (SPAdes)EnvironmentalOpen in IMG/M
3300026332Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_138 (SPAdes)EnvironmentalOpen in IMG/M
3300027909Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD5 (SPAdes)Host-AssociatedOpen in IMG/M
3300031058Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_184 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300031081Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_159 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300031093Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_198 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300031099Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_152 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300031114Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_182 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300031421Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_195 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300031677Metatranscriptome of hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_05 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300032138Ammonia-oxidizing marine archaeal communities from Monterey Bay, California, United States - ASW #8EnvironmentalOpen in IMG/M
3300032145Metatranscriptome of marine microbial communities from Western Arctic Ocean, Canada - CBN3_1000m_313 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300034661Metatranscriptome of lab incibated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T60R3 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300034664Metatranscriptome of lab incibated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T20R3 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300034665Metatranscriptome of lab incibated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T20R4 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300034666Metatranscriptome of lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C8R2 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300034671Metatranscriptome of lab incibated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C24R1 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300034676Metatranscriptome of lab incibated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C48R2 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap


 ⦗Top⦘

Family Sequences

Protein ID Sample Taxon ID Habitat Sequence
JGI11643J11755_1130793933300000787SoilMAQVGQFALALAFVVTAYSIAASLIGIRLKNDKLIASGRNAAVAAF
JGI1027J11758_1278816513300000789SoilMAAQIGQFALALAWVVTAYSVMASILGIRYKHDKLIAS
JGI10216J12902_12085042613300000956SoilMAAQIGQFALALAWVVTAYSVLASSLGIRYKHDKLIASGRNAA
JGI25385J37094_1009794613300002558Grasslands SoilMAQLGQFALALAFVVTAYSIIASLIGIRLKHDNLIASGRNAA
Ga0063356_10204808733300004463Arabidopsis Thaliana RhizosphereMAAQLGQFALALAWVTAAYSVVASLLGIRFKHDKLIASGRNA
Ga0066388_10427346923300005332Tropical Forest SoilMAQVGQFALALAFVVSAYSVIASLVGIRLKNDKIIASGKHAAIATFLCVTL
Ga0066388_10859503313300005332Tropical Forest SoilMVQVGQFALALAFVVTAYSIIASLVGIRLKNDKLIDSGKRAAIGTFICITLAI
Ga0070668_10214845923300005347Switchgrass RhizosphereMAQFGQFALAIAFIVAIYAIVASVIGIRSRNDKLIASGRNA
Ga0070675_10069037613300005354Miscanthus RhizosphereMAQVGQFALALAFVVTAYSIAASLIGIRLKNDKLIASGRN
Ga0066689_1051082533300005447SoilMAQIGQFALALAWVVTAYSIVASLLGIRLKHDNLIASGRNAA
Ga0068867_10017794943300005459Miscanthus RhizosphereMGQVGQFSLALAFVVTIYSIAASLLGIRIKNDRLIASGRNAAVAVF
Ga0066661_1031522933300005554SoilMAQLGQFALALAWVVTAYSIVASLLGIRLKHDNLIASG
Ga0066700_1088578923300005559SoilMAAQLGQFALAVAWVVTAYSVIASLLGIRLKNDKLIASGRNAALGAALC
Ga0068854_10227354313300005578Corn RhizosphereMAAQLGQFALALAWVTAAYSVVASLLGIRFKYDKLIASGRNAAIGTAVGITTAIACLGYL
Ga0066905_10012428713300005713Tropical Forest SoilMAAQLGQFALALAWVVTAYSVVASILGIRLKHDKLIASGR
Ga0068861_10213781023300005719Switchgrass RhizosphereMAAQLGQFALALAWVVTAYSVVASVLGIRLKHDKLIASGRNA
Ga0066903_10351117313300005764Tropical Forest SoilMAQVGQFALALAFVVTAYSIAASLIGIRLKNDKLIA
Ga0068851_1095334823300005834Corn RhizosphereMGQVGQFALALAFVVTIYSIAASLLGIRIKNDKLIASGRNAAVAVFVLISTAIG
Ga0066696_1057376813300006032SoilMAAQLGQFALALAWVATAYSVVASILGIRFKHDKLIASGR
Ga0075421_10036404613300006845Populus RhizosphereMAQVGQFALALAFVVTVYSIAASLIGIRLKNDKLIASGR
Ga0075433_1186558913300006852Populus RhizosphereMAQIGQFALALAFVVTVYSIVASIIGIRFKHDKLIASGR
Ga0075425_10228449613300006854Populus RhizosphereMAQVGQFALALAFVVSAYSVVASLIGIRIKNDKIIASGKHAAIATFLCIT
Ga0081243_136935113300006937Tropical Rainforest SoilMAAQLGQFALALAWVVTAYSIVASILGIRLKHDKLIASGRNAA
Ga0103856_1010543123300009233River WaterMAQFGQFALALAFVVTLYSIAASLIGIRFRNDKLIASGRNAAV
Ga0103862_104816913300009249River WaterMAQFGQFALALAFVVTLYSIAASLIGIRFRNDKLIASGRNAAVGNFLAISAAFATL
Ga0105249_1202601313300009553Switchgrass RhizosphereMGQVGQFSLALAFVVTIYSIAASLLGIRIKNDRLIASGRN
Ga0105259_111465213300009597SoilMAAQLGQFALALAWVVTVYSVIASLLGIRLKHDKLIAS
Ga0126380_1014922533300010043Tropical Forest SoilMAAQFGQFALALAWVVTAYSVVASILGIRLKHDKLIASGR
Ga0127460_104253323300010114Grasslands SoilMAAQFGQFALALAWVVTAYSVVASVLGIRFKHDKLIASGRNAALAATAS
Ga0127498_111083313300010124Grasslands SoilMAQIGQFALALAFVVTVYSIAASLIGIRVKHDKLIASGRNAAVGT
Ga0126370_1112160313300010358Tropical Forest SoilMAAQLGQFALALAWVVTAYSIVASILGIRFKNDKLI
Ga0126378_1315515213300010361Tropical Forest SoilMAAQIGQFALALAWVVTAYSIVASLLGIRLKNDNLIASG
Ga0126381_10055597513300010376Tropical Forest SoilMAAQIGQFALALAWVVTAYSIIASLVGIRFKNDSLIASGRNAA
Ga0126383_1274005923300010398Tropical Forest SoilMAAQLGQFALALAWVVSAYSVVASILGIRLKHDKL
Ga0134127_1128891913300010399Terrestrial SoilMAQVGQFSLALAFIVAVYSIVASLVGIRTRNDKLIASGRN
Ga0134127_1223627313300010399Terrestrial SoilMAQVGQFALALAFVVTAYSIAASLIGIRLKNDKLIASGRNAAVATF
Ga0134122_1029378933300010400Terrestrial SoilMMAAQIGQFALALAWVVTAYSVVASILGIRFKHDKLIASGR
Ga0134121_1307892223300010401Terrestrial SoilMMAAQIGQFALALAWVVTAYSVVASILGIRFKHDKLIASGRNAAIGAFACI
Ga0134123_1098704913300010403Terrestrial SoilMAAQLGQFALALAWVTAAYSVVASLLGIRFKHDKL
Ga0134123_1106095633300010403Terrestrial SoilMTAQLGQFALALAWVVTAYSVVASLLGIRFKHDKLIASA
Ga0138113_18086213300010895Grasslands SoilMAQIGQFALALAWVVTAYSIVASLLGIRLKHDNLIASGRNA
Ga0105246_1019321243300011119Miscanthus RhizosphereMGQVGQFALALAFVVTIYSIAASLLGIRIKNDKLIA
Ga0105246_1040084433300011119Miscanthus RhizosphereMAQLGQFALALAFIVTAYAIVASLVGIRARNDKLIASGRNAAI
Ga0150983_1115095713300011120Forest SoilMVQVGQFALALALVVTVYSIVASLVGIRLKNDKLIDSGKRAAIGTFICITVAIGSLAY
Ga0137383_1003385613300012199Vadose Zone SoilMAQLGQFALALAFVVTAYSIVASLVGIRFKNDKLIDSGRNAAVGAFVCVTTTFVC
Ga0137365_1074213413300012201Vadose Zone SoilMAQLGQFALALALVVTAYSIVASLIGIRFKNDKLIDSGRNAAVG
Ga0150985_10937580023300012212Avena Fatua RhizosphereMAAQLGQFALALAWVVTAYSVVASLLGIRFKHDKLI
Ga0150985_11088718113300012212Avena Fatua RhizosphereMAAQLGQFALALAWVVTAYSVVASVLGIRFKNDKLIASGRNAAIGTTICITTTI
Ga0134037_107034613300012372Grasslands SoilMAQLGQFALALAWVVTAYSIVASLLGIRLKHDNLIASGRNA
Ga0134058_125686423300012379Grasslands SoilMAQVGQFALALAFVVTLYSIVASLAGIRLKNDKLIA
Ga0134038_114482823300012382Grasslands SoilMAQIGQFALALAWVVTAYSIIASLLGIRLKHDNLI
Ga0134036_106757923300012384Grasslands SoilMAQIGQFALALAWVVTAYSIVASLLGIHLKHDKLVASGRNAALG
Ga0134023_110908323300012385Grasslands SoilMAQLGQFALALAFVVTAYSIVASLVGIRFKNDKLIDSGRNAAVGAFVCVT
Ga0134054_113135123300012390Grasslands SoilMAQIGQFALALAWVVTAYSVVASLLGIHLKHDKLIASGRN
Ga0134035_114905323300012391Grasslands SoilMAQIGQFALALAWVVTAYSIVASLLGIRLKHDKLIASGRNAAIA
Ga0134044_117212213300012395Grasslands SoilMAQLGQFALALAFVVTAYSIVASLVGIRFKNDKLIASGRNA
Ga0134057_132835023300012396Grasslands SoilMAQLGQFALALAFVVTAYSIVASLVGIRFKNDKLIDSGRNAAVGAFVCVTT
Ga0134056_112868813300012397Grasslands SoilMAQLGQFALALACVVTAYSVVASLIGIRFKNDKLIDSGRNAAVGVFACIT
Ga0150984_11309022723300012469Avena Fatua RhizosphereMAAQLGQFALALAWVVTAYAIVASILGIRFKNDKLIASGRNAALG
Ga0157352_109858313300012519Unplanted SoilMAQFGQFSLALAFVVTIYSIVASLLGIRFKNDRLI
Ga0137397_1068624513300012685Vadose Zone SoilMAQIGQFALALAFVVTVYSIVASVIGIRFKHDKLIASVRNAAVGTFACLTTAFLCLTDL
Ga0126375_1041669633300012948Tropical Forest SoilMAAQLGQFALALAWVTAAYSVVASLLGIRFKYDKLIASGR
Ga0126369_1214872423300012971Tropical Forest SoilMAAQLGQFALALAWVVTAYSLVASIIGIRLKHDKLIASGRNAALGTTACITITIICLGYLFA
Ga0134075_1038224623300014154Grasslands SoilMAAQIGQFALALAWVVTAYSIIASLLGIRLKNDNLIASG
Ga0163163_1018368153300014325Switchgrass RhizosphereMGQVGQFALALAFVVTIYSIAASLLGIRIKNDKLIASGRNAAVAVFVLISTAI
Ga0163163_1128264913300014325Switchgrass RhizosphereMAAQLGQFALALAWVTAAYSVVASLLGVRFKYDKLIASGRNA
Ga0132256_10233871213300015372Arabidopsis RhizosphereMAAQLGQFALALAWVVSAYSVVASVLGIRIKHDKLIASGRNAAL
Ga0132257_10253395923300015373Arabidopsis RhizosphereMAQLGQFALALAWVVTAYSIVASLLGIRLKHDNLIASGRNAAL
Ga0132257_10277491623300015373Arabidopsis RhizosphereMAAQLGQFALALAWVVTAYSVVASILGIRLKHDKLIA
Ga0132255_10485766123300015374Arabidopsis RhizosphereMVQVGQFALALALVVTAYSIAASLIGIRTKNDKLIASGKHAAIGT
Ga0132255_10546769913300015374Arabidopsis RhizosphereMGQVGQFALALAFVVTIYSIAASLLGIRIKNDKLIASGRNAAVAV
Ga0182041_1181377713300016294SoilMAAQIGQFALALAWVVTAYSVVASLLGIRLKNDRLIASGRNAAL
Ga0184628_1002504313300018083Groundwater SedimentMGQVGQFALALAFVVTIYSIGASLLGIRIKNDKLIA
Ga0184647_117683423300019263Groundwater SedimentMAQIGQFALALAFVVTAYSVIASLIGIRLKNDKIIASGKHAAIATFLCITLSIG
Ga0173482_1023752813300019361SoilMGQVGQFALALAFVVTIYSIGASLLGIRIKNDKLIASGRNAAVAVFALISTAIGTL
Ga0180107_107957313300020064Groundwater SedimentMAQLGQFSLALALVVTAYSVIASLIGIRLKNDKLIASGRNA
Ga0180109_131107213300020067Groundwater SedimentMAQLGQFALALAFVVTAYSIVASLLGIRVKNDKLIA
Ga0210382_1041800523300021080Groundwater SedimentMAAQIGQFALALAWVVTAYSVVASILGIRFKHDKLIAS
Ga0126371_1145637133300021560Tropical Forest SoilMAAQIGQFALALAWVVTAYSVIASLLGIRLKNDNLIASGRNAALG
Ga0126371_1336159413300021560Tropical Forest SoilMVQVGQFALALAFAVTAYSIVASLVGIRLKNDKLIDSGKRAAVGTFICVTVAIGALGYL
Ga0222625_180167313300022195Groundwater SedimentMAQLGQFALALALVVTAYSIVASLVGIRFKNDKLIDSGRN
Ga0242657_125240423300022722SoilMFAAQLGQFALALAWVVTAYSIVASILGIRFKNDKLISSGRNAALG
Ga0242665_1029716113300022724SoilMAAQIGQFALALAWVVTAYSILASLLGIRLKNDNLIASGRNAAL
Ga0242654_1021766813300022726SoilMAAQIGQFALALAWVVTAYSVIASLIGIRLKNDNLIVSARNAAL
Ga0222622_1048353813300022756Groundwater SedimentMGQVGQFALALAFVVTIYSIAASLLGIRIKNDKLIASGRNAAIAVFVLISTAIG
Ga0209640_1108552723300025324SoilMAQVGQFALALAFIVTAYAIVASLIGIRARNDKLIASGRVA
Ga0207692_1046171813300025898Corn, Switchgrass And Miscanthus RhizosphereMAAQIGQFALALAWVVTAYSIVASLVGIRFKNDRLIAS
Ga0207685_1031219133300025905Corn, Switchgrass And Miscanthus RhizosphereMGQVGQFALALAFVVTIYSIASSLLGIRIKNDKLIASGRNAAVAV
Ga0207659_1060742433300025926Miscanthus RhizosphereMAQVGQFALALAFVVTAYSIAASLIGIRLKNDKLIASGRNA
Ga0207709_1096778513300025935Miscanthus RhizosphereMGQVGQFSLALAFVVTIYSITASLLGIRLKNDRLIAS
Ga0207651_1033940833300025960Switchgrass RhizosphereMAAQLGQFALALAWVVTAYSVVASLLGIRFKHDKLIASGRN
Ga0207703_1093756233300026035Switchgrass RhizosphereMGQVGQFALALAFVVTIYSIAASLLGIRIKNDKLIAS
Ga0209470_124641033300026324SoilMAQIGQFALALAWVVTAYSIVASLLGIRLKHDNLI
Ga0209803_125470013300026332SoilMAQIGQFALALAWVVTAYSIVASLLGIRLKHDNLIAS
Ga0209382_1105782833300027909Populus RhizosphereMAAQLGQFALALAWVVTAYSVVASILGIRLKHDKLIASGRNAALGT
Ga0308189_1041721013300031058SoilMAQVGQFALALAFVVTAYSIIASLVGIRLRNDKIIAS
Ga0308185_105062313300031081SoilMAAQLGQFALALAWVVTAYSVVASILGIRFKHDKLIASGRNAALGTAA
Ga0308197_1017663713300031093SoilMAAQLGQFALALAWVVTAYSVVASILGIRFKHDKLIASGRNAALGTA
Ga0308181_114310213300031099SoilMGQVGQFALALAFVVTIYSIGASLLGIRIKNDNLIASGRNAAIAVFVLISTAIG
Ga0308187_1040950913300031114SoilMAAQLGQFALALAWVVTAYSVVASILGIRFKHDKLIA
Ga0308194_1025235013300031421SoilMVQVGQFALALAFVVTAYSIAASLIGIRSKNDKLIASGKHAAIGTFV
Ga0307480_101767113300031677Hardwood Forest SoilMAQIGQFALALAWVVTAYSIVASLLGIRLKHDKLIA
Ga0315338_120427723300032138SeawaterMAQFGQFSLALAFVLAIYAIAASLFGIRLKNDRLISSGRNSAVAV
Ga0315304_112824913300032145MarineMAQLGQFALALAFTVAVYAIAASLYGIRIKNDRLIASGRNAGISVFASLTIAIAC
Ga0315304_114152913300032145MarineMAAFGQFALALGFVVTVYSIGASLLGIRLGNDRLIASGRNAGIGAFACLSSATVSL
Ga0314782_139870_474_5843300034661SoilMAQLGQFALAIAFIVAIYAIVASLIGIRSRNDKLIAS
Ga0314786_027661_805_9543300034664SoilMAQVGQFALALAFVVTAYSIAASLIGIRLKNDKLIASGRNAAVATFVCIT
Ga0314787_104668_2_1123300034665SoilMAQFGQFALAIAFIVAIYAIVASLIGIRARNDKLIAS
Ga0314788_172593_431_5413300034666SoilMAAQLGQFALALAWVTAAYSVVASLLGIRFKHDKLIA
Ga0314788_176924_3_1253300034666SoilMAQFGQFALALAFIVSAYSIIASLVGIRYRNDKLIASGRNA
Ga0314796_156198_429_5363300034671SoilMAQFGQFSLALAFVVTIYSIVASLLGIRFKNDKLIA
Ga0314801_116771_480_6143300034676SoilMAAQLGQFALALAWVVSAYSVVASLLGIRLKHDKLIASGRNAALG

 ⦗Top⦘


Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.