NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome Family F083550

Metagenome Family F083550

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F083550
Family Type Metagenome
Number of Sequences 112
Average Sequence Length 125 residues
Representative Sequence VSASEVHAPGQAGPGARPPPVAGHGVRAVLADLFPAPPGPAPRAGLARWAFLLLQVAVVALGAVVMLARLGGRPAWDSVYAEDPGIYLPGALAHPWHLLQSYGGYLQLVPRLI
Number of Associated Samples 87
Number of Associated Scaffolds 112

Quality Assessment
Transcriptomic Evidence No
Most common taxonomic group Bacteria
% of genes with valid RBS motifs 89.19 %
% of genes near scaffold ends (potentially truncated) 99.11 %
% of genes from short scaffolds (< 2000 bps) 87.50 %
Associated GOLD sequencing projects 83
AlphaFold2 3D model prediction Yes
3D model pTM-score0.32

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Bacteria (99.107 % of family members)
NCBI Taxonomy ID 2
Taxonomy All Organisms → cellular organisms → Bacteria

Most Common Ecosystem
GOLD Ecosystem Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil
(58.036 % of family members)
Environment Ontology (ENVO) Unclassified
(66.964 % of family members)
Earth Microbiome Project Ontology (EMPO) Unclassified
(58.929 % of family members)



 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      


 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Transmembrane (alpha-helical) Signal Peptide: No Secondary Structure distribution: α-helix: 34.04%    β-sheet: 0.00%    Coil/Unstructured: 65.96%
Feature Viewer
Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer
Per-residue confidence (pLDDT):
  0-50   51-70   71-90   91-100  
pTM-score: 0.32
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.


 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 112 Family Scaffolds
PF13450NAD_binding_8 3.57
PF04672Methyltransf_19 2.68
PF13185GAF_2 2.68
PF06800Sugar_transport 1.79
PF00583Acetyltransf_1 1.79
PF05762VWA_CoxE 1.79
PF00342PGI 1.79
PF01899MNHE 0.89
PF14016DUF4232 0.89
PF069833-dmu-9_3-mt 0.89
PF00805Pentapeptide 0.89
PF08940DUF1918 0.89
PF13360PQQ_2 0.89
PF02583Trns_repr_metal 0.89
PF13581HATPase_c_2 0.89
PF04978DUF664 0.89
PF13641Glyco_tranf_2_3 0.89
PF03706LPG_synthase_TM 0.89
PF10604Polyketide_cyc2 0.89
PF08282Hydrolase_3 0.89

Neighboring Clusters of Orthologous Genes (COGs)

COG IDNameFunctional Category % Frequency in 112 Family Scaffolds
COG4975Glucose uptake protein GlcUCarbohydrate transport and metabolism [G] 1.79
COG0166Glucose-6-phosphate isomeraseCarbohydrate transport and metabolism [G] 1.79
COG1877Trehalose-6-phosphate phosphataseCarbohydrate transport and metabolism [G] 0.89
COG1937DNA-binding transcriptional regulator, FrmR familyTranscription [K] 0.89
COG2217Cation-transporting P-type ATPaseInorganic ion transport and metabolism [P] 0.89
COG2764Zn-dependent glyoxalase, PhnB familyEnergy production and conversion [C] 0.89
COG3769Mannosyl-3-phosphoglycerate phosphatase YedP/MpgP, HAD superfamilyCarbohydrate transport and metabolism [G] 0.89
COG3865Glyoxalase superfamily enzyme, possible 3-demethylubiquinone-9 3-methyltransferaseGeneral function prediction only [R] 0.89
COG0392Predicted membrane flippase AglD2/YbhN, UPF0104 familyCell wall/membrane/envelope biogenesis [M] 0.89
COG0560Phosphoserine phosphataseAmino acid transport and metabolism [E] 0.89
COG0561Hydroxymethylpyrimidine pyrophosphatase and other HAD family phosphatasesCoenzyme transport and metabolism [H] 0.89
COG1357Uncharacterized conserved protein YjbI, contains pentapeptide repeatsFunction unknown [S] 0.89
COG1863Multisubunit Na+/H+ antiporter, MnhE subunitInorganic ion transport and metabolism [P] 0.89


 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms99.11 %
UnclassifiedrootN/A0.89 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
3300005434|Ga0070709_10126323All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1740Open in IMG/M
3300005435|Ga0070714_100453547All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia1218Open in IMG/M
3300005467|Ga0070706_100619097All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia1005Open in IMG/M
3300005518|Ga0070699_102096978All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micromonosporales → Micromonosporaceae → Hamadaea → Hamadaea tsunoensis516Open in IMG/M
3300005554|Ga0066661_10218509All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia1181Open in IMG/M
3300005764|Ga0066903_101732631All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1191Open in IMG/M
3300005764|Ga0066903_102248453All Organisms → cellular organisms → Bacteria1052Open in IMG/M
3300005764|Ga0066903_104643600All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Thermomonosporaceae → Actinomadura → Actinomadura madurae731Open in IMG/M
3300009792|Ga0126374_10251676All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium1154Open in IMG/M
3300010359|Ga0126376_11327549All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium741Open in IMG/M
3300010362|Ga0126377_10497464All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium1250Open in IMG/M
3300010366|Ga0126379_10168941All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium2065Open in IMG/M
3300010371|Ga0134125_11801105All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium666Open in IMG/M
3300010398|Ga0126383_10316238All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium1567Open in IMG/M
3300010401|Ga0134121_11820720All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium636Open in IMG/M
3300012210|Ga0137378_10244516All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium1670Open in IMG/M
3300012363|Ga0137390_10005524All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia10691Open in IMG/M
3300016294|Ga0182041_12230363All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium512Open in IMG/M
3300016371|Ga0182034_11842786All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium533Open in IMG/M
3300016387|Ga0182040_10506960All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Pseudonocardiales → Pseudonocardiaceae965Open in IMG/M
3300016404|Ga0182037_11063044All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium707Open in IMG/M
3300016404|Ga0182037_11425950All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium613Open in IMG/M
3300016404|Ga0182037_11588027All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium581Open in IMG/M
3300017924|Ga0187820_1133944All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium735Open in IMG/M
3300017932|Ga0187814_10446915All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium506Open in IMG/M
3300017970|Ga0187783_10887686All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium643Open in IMG/M
3300017973|Ga0187780_10836614All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium667Open in IMG/M
3300017974|Ga0187777_10114445All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1781Open in IMG/M
3300017974|Ga0187777_10276056All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1145Open in IMG/M
3300018062|Ga0187784_11021622All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium657Open in IMG/M
3300021407|Ga0210383_10264964All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium1476Open in IMG/M
3300021478|Ga0210402_11055368All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium740Open in IMG/M
3300021478|Ga0210402_11565998All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium586Open in IMG/M
3300025905|Ga0207685_10305541All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium789Open in IMG/M
3300025910|Ga0207684_10076358All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria2848Open in IMG/M
3300027853|Ga0209274_10580454All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium580Open in IMG/M
3300027855|Ga0209693_10278100All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium818Open in IMG/M
3300028906|Ga0308309_11757096All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium525Open in IMG/M
3300031543|Ga0318516_10484822All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micrococcales → Microbacteriaceae → Curtobacterium → Curtobacterium luteum710Open in IMG/M
3300031544|Ga0318534_10451733All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium736Open in IMG/M
3300031544|Ga0318534_10683995All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium580Open in IMG/M
3300031545|Ga0318541_10665607All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium582Open in IMG/M
3300031546|Ga0318538_10215704All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium1027Open in IMG/M
3300031546|Ga0318538_10762704All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micrococcales → Microbacteriaceae → Curtobacterium → Curtobacterium oceanosedimentum525Open in IMG/M
3300031561|Ga0318528_10530565All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium632Open in IMG/M
3300031564|Ga0318573_10530193All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium634Open in IMG/M
3300031572|Ga0318515_10046017All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Thermomonosporaceae → Actinomadura → Actinomadura rifamycini2180Open in IMG/M
3300031573|Ga0310915_10993511All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micrococcales → Microbacteriaceae → Curtobacterium → unclassified Curtobacterium → Curtobacterium sp. B8586Open in IMG/M
3300031640|Ga0318555_10002453All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria6892Open in IMG/M
3300031713|Ga0318496_10089892All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium1639Open in IMG/M
3300031713|Ga0318496_10815667All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium514Open in IMG/M
3300031719|Ga0306917_10352048All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium1145Open in IMG/M
3300031723|Ga0318493_10257190All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium934Open in IMG/M
3300031724|Ga0318500_10212355All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micromonosporales → Micromonosporaceae → Micromonospora → Micromonospora aurantiaca930Open in IMG/M
3300031751|Ga0318494_10419459All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium777Open in IMG/M
3300031764|Ga0318535_10302335All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium716Open in IMG/M
3300031764|Ga0318535_10469796All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium560Open in IMG/M
3300031765|Ga0318554_10258027All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium993Open in IMG/M
3300031769|Ga0318526_10091863All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium1205Open in IMG/M
3300031769|Ga0318526_10411454All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micrococcales → Microbacteriaceae → Curtobacterium → unclassified Curtobacterium → Curtobacterium sp. B8553Open in IMG/M
3300031770|Ga0318521_10771848All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium585Open in IMG/M
3300031770|Ga0318521_10884386All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micrococcales → Microbacteriaceae → Curtobacterium → unclassified Curtobacterium → Curtobacterium sp. B8546Open in IMG/M
3300031771|Ga0318546_10034754All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia3031Open in IMG/M
3300031795|Ga0318557_10014314All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria2974Open in IMG/M
3300031795|Ga0318557_10290417All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia750Open in IMG/M
3300031797|Ga0318550_10537879All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micrococcales → Microbacteriaceae → Curtobacterium → Curtobacterium luteum563Open in IMG/M
3300031799|Ga0318565_10009090All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria4040Open in IMG/M
3300031799|Ga0318565_10073467All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium1617Open in IMG/M
3300031799|Ga0318565_10456705All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium618Open in IMG/M
3300031805|Ga0318497_10048934All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria2175Open in IMG/M
3300031821|Ga0318567_10027477All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia2813Open in IMG/M
3300031821|Ga0318567_10352298All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium832Open in IMG/M
3300031831|Ga0318564_10087965All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium1376Open in IMG/M
3300031832|Ga0318499_10032799All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia1882Open in IMG/M
3300031833|Ga0310917_10312162All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium1064Open in IMG/M
3300031833|Ga0310917_10811297All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium632Open in IMG/M
3300031846|Ga0318512_10212566All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium948Open in IMG/M
3300031890|Ga0306925_12156469All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium520Open in IMG/M
3300031910|Ga0306923_12231028All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium548Open in IMG/M
3300031912|Ga0306921_12471330All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Pseudonocardiales → Pseudonocardiaceae → Lentzea → Lentzea guizhouensis540Open in IMG/M
3300031942|Ga0310916_10446367All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium1102Open in IMG/M
3300031945|Ga0310913_10350808All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1044Open in IMG/M
3300031945|Ga0310913_10639329All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium754Open in IMG/M
3300031946|Ga0310910_11090737All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium622Open in IMG/M
3300031946|Ga0310910_11437798All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium530Open in IMG/M
3300031947|Ga0310909_11485970All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium540Open in IMG/M
3300031954|Ga0306926_13021142All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium502Open in IMG/M
3300031981|Ga0318531_10468370All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium571Open in IMG/M
3300031981|Ga0318531_10491626All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium556Open in IMG/M
3300032001|Ga0306922_10377357All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1520Open in IMG/M
3300032009|Ga0318563_10125172All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1371Open in IMG/M
3300032010|Ga0318569_10134156All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium1133Open in IMG/M
3300032025|Ga0318507_10180554All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria908Open in IMG/M
3300032043|Ga0318556_10071663All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium1716Open in IMG/M
3300032052|Ga0318506_10223326All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium833Open in IMG/M
3300032055|Ga0318575_10119081All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium1294Open in IMG/M
3300032055|Ga0318575_10194120All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium1018Open in IMG/M
3300032063|Ga0318504_10247607All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Pseudonocardiales → Pseudonocardiaceae → Lentzea → Lentzea waywayandensis839Open in IMG/M
3300032064|Ga0318510_10050297All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1473Open in IMG/M
3300032065|Ga0318513_10514653All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium586Open in IMG/M
3300032066|Ga0318514_10005545All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria5103Open in IMG/M
3300032067|Ga0318524_10404778All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium712Open in IMG/M
3300032067|Ga0318524_10558733All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium602Open in IMG/M
3300032090|Ga0318518_10534298All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium600Open in IMG/M
3300032261|Ga0306920_101693568All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium896Open in IMG/M
3300032895|Ga0335074_10043780All Organisms → cellular organisms → Bacteria6200Open in IMG/M
3300032895|Ga0335074_10517813All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium1229Open in IMG/M
3300032898|Ga0335072_10008259All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia15105Open in IMG/M
3300032898|Ga0335072_10530738All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium1208Open in IMG/M
3300033290|Ga0318519_10198076All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia1145Open in IMG/M
3300033290|Ga0318519_10734076All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium605Open in IMG/M



 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil58.04%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil11.61%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil5.36%
Tropical PeatlandEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland4.46%
Corn, Switchgrass And Miscanthus RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere4.46%
SoilEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Soil3.57%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil2.68%
SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Soil2.68%
Freshwater SedimentEnvironmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment1.79%
Vadose Zone SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil1.79%
Terrestrial SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil1.79%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Soil0.89%
Agricultural SoilEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Agricultural Soil0.89%

Visualization
Powered by ApexCharts



Associated Samples

Taxon OIDSample NameHabitat TypeIMG/M Link
3300005434Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaGEnvironmentalOpen in IMG/M
3300005435Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaGEnvironmentalOpen in IMG/M
3300005467Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaGEnvironmentalOpen in IMG/M
3300005518Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaGEnvironmentalOpen in IMG/M
3300005554Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_110EnvironmentalOpen in IMG/M
3300005764Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2)EnvironmentalOpen in IMG/M
3300009792Tropical forest soil microbial communities from Panama - MetaG Plot_12EnvironmentalOpen in IMG/M
3300010048Tropical forest soil microbial communities from Panama - MetaG Plot_11EnvironmentalOpen in IMG/M
3300010359Tropical forest soil microbial communities from Panama - MetaG Plot_15EnvironmentalOpen in IMG/M
3300010362Tropical forest soil microbial communities from Panama - MetaG Plot_22EnvironmentalOpen in IMG/M
3300010366Tropical forest soil microbial communities from Panama - MetaG Plot_24EnvironmentalOpen in IMG/M
3300010371Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-1EnvironmentalOpen in IMG/M
3300010398Tropical forest soil microbial communities from Panama - MetaG Plot_35EnvironmentalOpen in IMG/M
3300010401Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-1EnvironmentalOpen in IMG/M
3300012210Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_60_16 metaGEnvironmentalOpen in IMG/M
3300012363Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h2.4A metaGEnvironmentalOpen in IMG/M
3300016294Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.178EnvironmentalOpen in IMG/M
3300016371Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.172EnvironmentalOpen in IMG/M
3300016387Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.176EnvironmentalOpen in IMG/M
3300016404Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.082EnvironmentalOpen in IMG/M
3300017924Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_5EnvironmentalOpen in IMG/M
3300017932Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - ASW-S_4EnvironmentalOpen in IMG/M
3300017970Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_SJ02_MP02_20_MGEnvironmentalOpen in IMG/M
3300017973Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_Q2_SP10_20_MGEnvironmentalOpen in IMG/M
3300017974Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_Q2_SP5_10_MGEnvironmentalOpen in IMG/M
3300018062Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_SJ02_MP15_20_MGEnvironmentalOpen in IMG/M
3300021407Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-14-OEnvironmentalOpen in IMG/M
3300021478Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-7-MEnvironmentalOpen in IMG/M
3300025905Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025910Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300027853Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF1 (SPAdes)EnvironmentalOpen in IMG/M
3300027855Warmed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WRM 3 (SPAdes)EnvironmentalOpen in IMG/M
3300028906Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 5 (v2)EnvironmentalOpen in IMG/M
3300031543Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f20EnvironmentalOpen in IMG/M
3300031544Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.117b4f26EnvironmentalOpen in IMG/M
3300031545Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.166b4f26EnvironmentalOpen in IMG/M
3300031546Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.166b4f23EnvironmentalOpen in IMG/M
3300031561Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.052b4f26EnvironmentalOpen in IMG/M
3300031564Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f21EnvironmentalOpen in IMG/M
3300031572Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f19EnvironmentalOpen in IMG/M
3300031573Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.AN111EnvironmentalOpen in IMG/M
3300031640Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f23EnvironmentalOpen in IMG/M
3300031713Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.109b1f22EnvironmentalOpen in IMG/M
3300031719Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.000 (v2)EnvironmentalOpen in IMG/M
3300031723Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.108b1f23EnvironmentalOpen in IMG/M
3300031724Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.174b1f20EnvironmentalOpen in IMG/M
3300031751Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.108b1f24EnvironmentalOpen in IMG/M
3300031764Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.117b4f27EnvironmentalOpen in IMG/M
3300031765Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f22EnvironmentalOpen in IMG/M
3300031769Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.052b4f24EnvironmentalOpen in IMG/M
3300031770Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f17EnvironmentalOpen in IMG/M
3300031771Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f19EnvironmentalOpen in IMG/M
3300031795Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.065b5f19EnvironmentalOpen in IMG/M
3300031797Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f23EnvironmentalOpen in IMG/M
3300031799Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.066b5f21EnvironmentalOpen in IMG/M
3300031805Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.109b1f23EnvironmentalOpen in IMG/M
3300031821Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.088b5f20EnvironmentalOpen in IMG/M
3300031831Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.066b5f20EnvironmentalOpen in IMG/M
3300031832Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.109b1f25EnvironmentalOpen in IMG/M
3300031833Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.LF178EnvironmentalOpen in IMG/M
3300031846Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.171b2f19EnvironmentalOpen in IMG/M
3300031890Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.176 (v2)EnvironmentalOpen in IMG/M
3300031910Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.108 (v2)EnvironmentalOpen in IMG/M
3300031912Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.080 (v2)EnvironmentalOpen in IMG/M
3300031942Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.LF176EnvironmentalOpen in IMG/M
3300031945Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.OX082EnvironmentalOpen in IMG/M
3300031946Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.HF172EnvironmentalOpen in IMG/M
3300031947Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.T000HEnvironmentalOpen in IMG/M
3300031954Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.178 (v2)EnvironmentalOpen in IMG/M
3300031981Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.053b4f25EnvironmentalOpen in IMG/M
3300032001Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.082 (v2)EnvironmentalOpen in IMG/M
3300032009Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.066b5f19EnvironmentalOpen in IMG/M
3300032010Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.088b5f22EnvironmentalOpen in IMG/M
3300032025Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.084b2f20EnvironmentalOpen in IMG/M
3300032043Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f24EnvironmentalOpen in IMG/M
3300032052Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.084b2f19EnvironmentalOpen in IMG/M
3300032055Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f23EnvironmentalOpen in IMG/M
3300032063Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.084b2f17EnvironmentalOpen in IMG/M
3300032064Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.171b2f17EnvironmentalOpen in IMG/M
3300032065Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.171b2f20EnvironmentalOpen in IMG/M
3300032066Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f18EnvironmentalOpen in IMG/M
3300032067Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.052b4f22EnvironmentalOpen in IMG/M
3300032090Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f22EnvironmentalOpen in IMG/M
3300032261Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170 (v2)EnvironmentalOpen in IMG/M
3300032895Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_2.3EnvironmentalOpen in IMG/M
3300032898Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_2.1EnvironmentalOpen in IMG/M
3300033290Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f15EnvironmentalOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap



 ⦗Top⦘

Family Sequences

Protein ID Sample Taxon ID Habitat Sequence
Ga0070709_1012632333300005434Corn, Switchgrass And Miscanthus RhizosphereMFARDLRAPGQAGSGEFLPPAAGHGARGVLADLFPPPAGPALRTGWARWAFPLVQVALVALGAVVMLARISGRPAWASVWAEDPGIYLPAALAHPWQLLQS
Ga0070714_10045354723300005435Agricultural SoilMFARDLRAPGQAGSGEFLPPAAGHGARGVLADLFPPPAGPALRTGWARWAFPLVQVALVALGAVVMLARISGRPAWASVWAEDPGIYLPAALAHPWQLLQSYGGYLQLVPRLIGQVAALVPI
Ga0070706_10061909723300005467Corn, Switchgrass And Miscanthus RhizosphereVSAPELRAPGRAGSGAQLPPAAGHGFRDMLAELFPAPAEPAPRAGLPRWAFLLVQVGAVALGALVMLARIGGRPPWESIYAEDRGIYLPEALAHPWHLL
Ga0070699_10209697813300005518Corn, Switchgrass And Miscanthus RhizosphereVSAPELRVPGLAGRGARVQPGADHGVRAVLADLFPAPAEPGPRGGLPRWALVLVQVAVVALGAGMMLARVGGRPVWETIWAEDRGIYVPQALAHPWQLLQSYAGYLQLVPRLIGQ
Ga0066661_1021850913300005554SoilVSAPELRAPGQAGSGANLPAAAGRGVRAVLADLFPAPTGPAPRGGLARWALLLVQVATIVLGALVMLARIGGRPVWKSAYAEDPGIYLPGALAHPWHLLQSYGGYLQLIPRLIGQAAALLPIRDASVAFAVGGALVASACA
Ga0066903_10173263113300005764Tropical Forest SoilVVSWPGSGWGPGPAWQVPTVTAPEVRAPGQAGPGAHLPPAAGHRVRAVLAELFPEPPGPAPRASLARWALFVLVQVVVVALGAVVMLARVAGRPVWDTVYGEDWGIYLPWALAHPWHLLQSYAGYLQL
Ga0066903_10224845313300005764Tropical Forest SoilVSASDLRALGQAGSGTDLPPSAGRGVRAVLAGLFPAPAEPARRDGLARWAFWLVQVAAVAVGAAVMLARTPGRAAWDSIYGEDRGIYLPQALAHPWQLLQSYAGYLQLVPRLIGQIAALLPLRDASVAFAVGGALVASACGLF
Ga0066903_10464360013300005764Tropical Forest SoilVSAPELRVPGQAGPGARVQVGAGHGVRAVLADLFPAPAEPGPRGGLPRWALILVQVAAVALGALVMLARVGGRPVWETAWAEDRGIYVPDALAHPWHLLQSYGGYLQLVPRLIGQ
Ga0126374_1025167623300009792Tropical Forest SoilVHLPSATGHGVRAVLGDLFPAPAEPAPRAGLPRWAFLLVQVAVVALGALVMLARIGGRPAWGSVYGEDWGIYLPWALAHPWHLVQSYAGYLQLVPRLIGQVAALVPIRDASVAFAAGGAL
Ga0126373_1121124523300010048Tropical Forest SoilVLADLFPAPIQSAPRAGLPRWAFLLLQVAAITLGALAMLARIGGRPVWKSAYAEDPGIYLPGALAHPWQLLQSYGGYLQLVPRLIGQAAALLPIRDASAVFAVGGALVASGCGLFAYH
Ga0126376_1132754913300010359Tropical Forest SoilVHLPSATGHGVRAVLGDLFPAPAEPAPRAGLPRWAFLLVQVAVVALGALVMLARIGGRPAWGSVYGEDWGIYLPWALAHPWHLVQSYAGYLQLVPRLIGQVAALVPIRDAS
Ga0126377_1049746413300010362Tropical Forest SoilVSAPELSAPGQAGSAAQLPSDAGHGVRAALTDLFPEPAEPAPRAGLARWAFLPLQVAAVALGALVLLVRIGGRPSWQSVWAEDRGIYLPGALAHPWHLLQSYGGYLQLVPRLIGQVA
Ga0126379_1016894113300010366Tropical Forest SoilLRPAAGHGARAVLDDLFPAPPEPAPRTGLARWAFLLVQVAAVVLGALVMLIRIGGRRPAWESVWAEDKGVYVPEALAHPWHLLQSYGGYLQLVPRLIGQTATLVPIRDASVVLAVGGALVASACGLFAYHASAGQVSSRWLRVLVGLSVLLLPVAQLEIADTGVNSTWYLLAALFWAALWRPRSRAGR
Ga0134125_1180110523300010371Terrestrial SoilMFARDLRAPGQAGSGEFLPPAAGHGARGVLADLFPPPAGPALRTGWARWAFPLVQVALVALGAVVMLARISGRPAWASVWAEDPGIYLPAALAHPWQLLQSYGGYLQLVPRLIGQVAALVPIRHASV
Ga0126383_1031623813300010398Tropical Forest SoilVHLPSATGHGVRAVLGDLFPAPAEPAPRAGLPRWAFLLVQVAVVALGALVMLARIGGRPAWGSVYGEDWGIYLPWALAHPWHLVQSYAGYLQLVPRL
Ga0134121_1182072013300010401Terrestrial SoilVSAPELRAPGQAGAGADLPAAEGHRVRAVLADLFPEPAEPAARAGLARWVFLLVQVAAVALGGLVMLARIPGRPVWKSAYAEDPGIYLPGALAHPWHL
Ga0137378_1024451623300012210Vadose Zone SoilVSTPELRAPGKAGSGAHLPSAAGYGARAVLADLFPGPAGPAVRGGLARWAFFLAQVAAVVLGALVMLARIGGRPAWDSVWAEDLGIYLPQALAHPWQLLQSYGGYLQLIPRLIGQVAALLPVKYAS
Ga0137390_1000552413300012363Vadose Zone SoilVSGTELRAPGQAGSGAPLPSAAGRGFRDVLADLFPVPAEPAPRGGLPQWAFPLVQVVLVALGALVMLARVPGRPVWESAYGEDPRMYLPQALAHPWHLLQAYAGYLQL
Ga0182041_1223036313300016294SoilVSASELRAPGKAGPGTHLPSAAGHRARTVLADLFPEPAEPAPGAGLARWAFLLIQVVVVAVGAVVMLARIGGRPAWQSVYAEDPGIYLPQALAHPWHLLASYGGYLQLVPRVI
Ga0182034_1184278613300016371SoilMSASELRAAGQARPGAQPPPDAGHGFRGALAELFPEPAEIAPRAGLARWAFVPVQVALVALGAVVMLARIPGRPVWESAYGEDPRMYLPQALAHPWNLLQSYAGYLQLVPRVIGQAAALLPFRHASVAFAVGGALAASAC
Ga0182040_1050696013300016387SoilVSASDLRAPGQVGSGTDLPPTAGRGVRAVLADLFPAPAEPARRDGLARWAFWLVQVAAVAVGAAVMLARTPGRAAWDSIYGEDRGIYLPQALAHPGQLLQSYAGYLQLVPRLIGQIAALLPLRDASVAFAVGGALVASACGLFTYHASAGHVSSR
Ga0182037_1106304413300016404SoilVSAPELRTPGQAGSGERLPPDAGHGFRGALAELFPEPAEIAPRAGLARWAFVPVQVALVALGAVVMLARIPGRPVWESIYAEDRGIYLPWALAHPWHLLHSYGGYLQLMPRVIGQAAALL
Ga0182037_1142595013300016404SoilVSASDLRAPGQVGSGTDLPPSAGRGVRAVLADLFPAPAEPARRDALARWAFWLVQVAAVAVGAAVMLARTPGRAAWDSIYGEDRGIYLPQALAHPWQLLQSYAGYLQLVPRLISQM
Ga0182037_1158802713300016404SoilVSAPEVHAPGSAGPGAHLPAAAGHGVRAVLADLFPPPAESAPHTGLVRWTLLLAQVVAVPLGALVMLARIGGRAAWKSVWAEDPGIYLPGALAHPWH
Ga0187820_113394423300017924Freshwater SedimentVSAPDLRAPGQAGPAADEPAAPGQGVRDALADLFPAPPEPGPRAGLPRWAFILLQIAVIAAGALVMLARIGGNKPAWDRVWAEDPGIYLPWALSHPWHLLQSYAGYLQLVP
Ga0187814_1044691513300017932Freshwater SedimentVSASELCGPGQARSGAPLPSAAGRGVRAVLADLFPAPPGPARRAGLARWVFVLVQVAVVALGAVVMLARVSGRPVWESVYGEDPGIYLAQALAHPWHLLQSYAGY
Ga0187783_1088768623300017970Tropical PeatlandVSTVPLRKPGRTEPAQSPPGSGVRAVLGELFRAPAEPSAPGAGLPRWAVVLVQVAAIALGALVMLVRVGGRPVWETVYAEDPGIYLPWAIGHPWHLLEAYGGYLQLVPRLIAQ
Ga0187780_1083661413300017973Tropical PeatlandVTGWWYVPPVTAPEVRAPSRAGPGADLLPAAGHGVRAVLAELFPAPPGPAPRGGLARWAFFLLQAVVVAAGAAVMLARIPGRPVWESAYGEDWGIYLPQALAHPWHLLQSYAGYLQ
Ga0187777_1011444533300017974Tropical PeatlandVSAPELRAPGQAGSGAHVPSAAGHGAGAVLADLFPEPAKSAPRAGFARWAFLLVQVAVVALGALVMLARMGGRPAWDSVYAEDPGIYLPQALAHPWHLLQAYGGYLQLVPRVIGQAAALL
Ga0187777_1027605633300017974Tropical PeatlandVTGWWYVPPVTAPEVRAPSRAGPGADLLPAAGHGVRAVLAELFPAPPGPAPRGGLARWAFFLLQAVVVAAGAAVMLARIPGRPVWESAYGEDWGIYLPQALAHPWHLLQSYAGYLQLVPRLIGQVAALLPVRHAAVAFAVGGAVVASACGLFAYHACAGQVRSRWLRALVGL
Ga0187784_1102162223300018062Tropical PeatlandVSAPQLQAPGQAGAGAPAQVTDRGFRALLADLFPDPAEPRARPGAVARWALVLVQVVVVALGALVMLERIGGRPTWDSVYAEDPGL
Ga0210383_1026496413300021407SoilVSAPDVRAPGQAGPAAGEPPAPGHGVRDALADLFPAPAEPAPRAGLPRWAFILLQIAVIAAGALVMLARIGGNKPAWDRVWAEDPGIYLPWALAHPWHLLQSYGGYLQLAPRLIGQFAPLVPIRDASVVFAAG
Ga0210402_1105536823300021478SoilVSAPELRAPGQAGAGADLPAAEGHRVRAVLADLFPEPAEPAARTGLARWVFLLVQVAAVALGALVMLARIPGRPVWKSAYAEDPGIYLPGALAHPWHLLQSYGG
Ga0210402_1156599813300021478SoilVSAPDLRAPGQTGPGAHLPSAAERHRGRAVLAELFPAPAEPDSHTGLARWTFPFVQVAVVAIGALVMLARVGGRPALYRVYAEDPGIYLPQALAHPWDLLQSYGGYLQVVPRLIGQVAAL
Ga0207685_1030554113300025905Corn, Switchgrass And Miscanthus RhizosphereVSAPELRAPGQAGAGADLPAAEGHRVRAVLADLFPEPAEPAARAGLARWVFLLVQVAAVALGGLVMLARIPGRPVWKSAYAEDPGIYLPGALAHPWHLLQSYGGYLQLVPRLI
Ga0207684_1007635833300025910Corn, Switchgrass And Miscanthus RhizosphereVSAPVLRAPGRAGSRAQLPPAAGHGFRDMLADLFPAPAEPAPRAGLPRWAFPLLQVVLVALGALVMLARVPGRPVWESVYGEDPRMYLPQALAHPWHLLQSYGGYLQLVPR
Ga0209274_1058045423300027853SoilVPAPEIQAPGQAGPGTHLPPAAGRGERVRAVLTDLFPAPSERAPRTALARWAFVFIQVAVVAVGAAAMLARLGGRPAWESVYAEDPGIYLPAALAHPWHLLQSYGGYLQLVPRVIGQMAALLPV
Ga0209693_1027810023300027855SoilVSAPDVRAPGQAGPAADEPPAPGHGVRDALADLFPAPAGPAPRAGLPRWAFILLQIAVIAAGALVMLARIGGNKPAWDRVWAEDPGIYLPWALAHPWHLLQSY
Ga0308309_1175709613300028906SoilVSAPELRAPGQAGSGAHLPPVAVHGARAVLADLFPAPAGLPRGGLARWAVLPAEVAAVALGALVMLARIGGRPAWDSIYAEDLGIYLPAALAHPWHLLQSYGGYLQLIPRLIGQIAALLPIR
Ga0318516_1048482213300031543SoilVSAPELRTPGQAGSGARLPPDTGHGFRGALAELFPEPAEIAPRAGLARWAFVPVQVALVALGAVVMLARIPGRPVWKSAYGEDPRMYLPQALAHPWNLLQSYAGYLQLVPRVIGQAAALLPFRHASVAFAVGGALVASACGLFAYHASACG
Ga0318534_1045173313300031544SoilVSASELRAPGKPGPGAEPRSAAGHGVRTALADLFPAPAEPAPRTDLARRVLLILIQVVVVAIGALVMLDRVGGRPAWKSVWAEDPGIYLPGALAHPWQLLQSYGGYLQLLPRLIGQVA
Ga0318534_1068399513300031544SoilVSASELRAPGQAGSGTQLPSATRHGARAVLDDLFPAPPELVPRTGLARWAFLLVQVAAVVLGALVMLIRIGGRRPAWERVWAEDRDVYVPEALAHPWHLLQSYGGYLQLVPRLIGQIAALLPIRDASVVV
Ga0318541_1066560713300031545SoilVSASDLRAPGQVGSGTDLPPTAGRGVRAVLADLFPAPAEPARRDALARWAFWLVQVAAVAVGAAVMLARTPGRAAWDSIYGEDRGIYLPQALAHPGQ
Ga0318538_1021570413300031546SoilMSASELRAAGQARPGAQPPADAGHGFRGALAELFPEPAEIAPRAGLARWAFVPVQVALVALGAVVMLARIPGRPVWKSAYGEDPRMYLPQALAHPWNLLQSYAG
Ga0318538_1076270413300031546SoilVSASDLRAPGQAESGTGLPPPAARGVRAVLADLFPAPAKPARRDGLARWVFLLVQVAAIAVGAVVMLARTPGRPAWDSIYGEDRGIYLPQALAHPWQLLQSYAGYLQLVPRLISQMAVLLPLRDAPVAFAAGGALVASACGLFAYHASAGHVSSRWLRALLGVS
Ga0318528_1053056523300031561SoilVSAPELRAPGQDGTGAHLPPAAGHSALVDLFPVPAEPAPRTGLVRWALVLVQVAVVALGALAMLARVGGRPAWDSVWAEDPGVYLPGALAHPWHLLQSYAGYLQLIPRLIGQVAALLPIRHASDAFAVGGALVASACAL
Ga0318573_1053019313300031564SoilVSASELRAPGKAGPGAQRPSAAGHGARAVLDDLFPAPAEPAPRTGLARWAWPLVQVAAVAVGALVMLVRIGGRRPAWESVWAEDRDMYVPEALAHPWHLLQSYGGYLQLVPRLFGQAATLLPIRDASVVLAAGGALVASACALFAYHASAGQVSSRWLRALLGLSVL
Ga0318515_1004601743300031572SoilVSASDLRAPGQVGSGTDLPPTAGRGVRAVLADLFPAPAEPARRDALARWAFWLVQVAAVAVGAAVMLARTPGRAAWDSIYGEDRGIYLPQALAHPGQLLQSYAGYLQLVPRLIGQIAALL
Ga0310915_1099351113300031573SoilVSASEVRAPGQAGPGEHLPSAAGHGVRAALGDLFPVSAEPTPRAGLPRWALVLIQVALVAAGALVMLARVGGRPAWDSVWAEDPGVYLPQALAHPWQLLQSYAGYLQLVPRLIGQIAALLPVRHASVAFAVGGALIASACGLFAYHA
Ga0318555_1000245313300031640SoilVSAPELRAPGQDGTGAHLPPAAGHSALVDLFPVPAEPAPRTGLVRWALVLVQVAVVALGALAMLARVGGRPAWDSVWAEDPGVYLPGALAHPWHLLQSYAGYLQLIPRLI
Ga0318496_1008989223300031713SoilVSASELRAPSQAGPRTDLPPPAGNDARAVLADLFPAPADSAPRGGLARWAFVLVQVAAVAAGAVVMLARTAGRPVWESLTGEDRGVYLPQAIAHPWQLLQSYAGYLQLVPRLLAQ
Ga0318496_1081566713300031713SoilVSAPELRAPGQAGTGADLPATAGRGVRAVLADLFPAPIESAPRAGLPRWAFVLVQVAAVSLGALAMLARIGGRPVWKSAYAEDPGIYLPGALAHHWQLLQSYGGYLQLVPRLIGQIAALL
Ga0306917_1035204823300031719SoilVSASELRAPGKAGPGAQRPSAAGHGARAVLDDLFPAPAEPAPRTGLARWAWPLVQVAAVAVGALVMLVRIGGRRPAWESVWAEDRDMYVPEALAHPWHLLQSYGGYLQLVPRLFGQAATLLPIRDASVVLAAGGALVASACALFAYHASAGQVSSRW
Ga0318493_1025719023300031723SoilVSAPELRTPGQAGSGERLPPDAGHGFRGALAELFPEPAEIAPRAGLARWAFVPVQVALVALGAVVMLARIPGRPVWESAYGEDPRMYLPQALAHPWNLLQSYAGYLQLVPRVIGQAAALLPLRHASVAFAV
Ga0318500_1021235523300031724SoilMSASELRAAGQARPGAQPPPDTGHGFRGALAELFPEPAEIAPRAGLARWAFVPVQVVVIALGALVMLARAGGGRPVWESIYAEDRGIYLPWALAHPWHLLHSYGGYLQLMPRVIGQAAALLPFRH
Ga0318494_1041945913300031751SoilVSASELRAPGKPGPGAEPRSAAGHGVRTALADLFPAPAEPAPRTDLARRVLLILIQVVVVAIGALVMLDRVGGRPAWKSVWAEDPGIYLPGALAHPWQLL
Ga0318535_1030233513300031764SoilVSASELRAPGKAGPGAQRPSAAGHGARAVLDDLFPAPAEPAPRTGLARWAWPLVQVAAVAIGALVMLVRIGGRRPAWESVWAEDRDMYVPEALAHPWHLLQSYGGYLQLVPRLFGQAATLLPIRDASVVLA
Ga0318535_1046979623300031764SoilVSASELRAPGQAGSGTQLTSATRHGARAVLDDLFPAPPELVPRTGLSRWAFLLVQVAAVVLGALVMLIRIGGRRPAWERVWAEDRDVYVPEALAHPWHLLQSYGGYLQLVPRLIGQIAALVPIRDASVVLAAGGALVASACGLFAYHAGAGHVGSRWLRALLGL
Ga0318554_1025802713300031765SoilVSASELRTPGRAGSGTQLPSATRHGARAVLDDLFPAPPELVPRTGLSRWAFLLVQVAAVVLGALVMLIRIGGRRPAWERVWAEDRDVYVPEALAHPWHLLQSYGGYLQLVPRLIGQIAALVPIRDASVVLAAGG
Ga0318526_1009186323300031769SoilVSASELRAPGKAGPGAQRPSAAGHGARAVLDDLFPAPAEPAPRTGLARWAWPLVQVAAVAIGALVMLVRIGGRRPAWESVWAEDRDMYVPEALAHPWHLLQSYGGYLQLVP
Ga0318526_1041145413300031769SoilVSASELRAPGRAGSGTQLPSATGHGARAVLADLFPAPPELAPRTGLARWAFPLVQVAAVVLGALVMLIRIGGRRPAWQSVWAEDRGVYVPEALAHPWHLLQSYGGYLQLVPRLIGQVAALVPVRDASVVLAAGGALVASGCGLFAYHASAG
Ga0318521_1077184813300031770SoilVSASELRAPGQAGPGAHPPSAAGHGVRAVIADLFPAPAEPASRGRLASWAFVLIQVALVALGALVMVARMGGRPAWRSVYAEDPGIYLPGALAHHWQLLQSYGGYLQLVPRLIGQTAALLPIRRGTSCRYPPYD
Ga0318521_1088438613300031770SoilVPAVSASELRTPGRAGSGTQLPSATGHGARAVLADLFPAPPELAPRTGLARWAFPLVQVAAVVLGALVMLIRIGGRRPAWQSVWAEDRGVYVPEALAHPWHLLQSYGGYLQLVPRLIGQVAALVPVRDASVVLAAGGALVASGCGLFAYHARAGHISSRWFRGLLGLSVVLLPVAQLEIADN
Ga0318546_1003475453300031771SoilVSAPELRAPGQDGTGAHLPPAAGHSALVDLFPVPAEPAPRTGLVRWALVLVQVAVVALGALAMLARVGGRPAWDSVWAEDPGVYLPGALAHPWHLLQSYAGYLQLIPRLIGQVAALLPIRHAS
Ga0318557_1001431453300031795SoilVSAPELRAPGQDGTGAHLPPAAGHSALVDLFPVPAEPAPRTGLVRWALVLVQVAVVALGALAMLARVGGRPAWDSVWAEDPGVYLPGALAHPWHLLQSYAGYLQLIPRLIGQVAALLPIRHASVAFAAGGAL
Ga0318557_1029041713300031795SoilVSASELRAPSQAGPRTDLPPPAGNDARAVLADLFPAPADSAPRGGLARWAFVLVQVAAVAAGAVVMLARTAGRPVWESLTGEDRGVYLPQAIAHPWQLLQSYA
Ga0318550_1053787913300031797SoilVSAPELRTPGQAGSGARLPPDTGHGFRGALAELFPEPAEIAPRAGLARWAFVPVQVALVALGAVVMLARIPGRPVWESAYGEDPRMYLPQALAHPWNLLQSYAGYLQLVPRVIGQAAALLPLRHASVAFAVGGALAASACGLFAYHASA
Ga0318565_1000909013300031799SoilVSASEVHAPGQAGPGARPPPVAGHGVRAVLADLFPAPPGPAPRAGLARWAFLLLQVAVVALGAVVMLARLGGRPAWDSVYAEDPGIYLPGALAHPWHLLQSYGGYLQLVPRLI
Ga0318565_1007346713300031799SoilVSASDLRAPGQVGSGTDLPPTAGRGVRAVLADLFPAPAEPARRDALARWAFWLVQVAAVAVGAAVMLARTPGRAAWDSIYGEDRGIYLPQALAHPWQLLQSYAGYLQLVPRLISQMAVLLPLRDAPVAFAAGGALVASACGLFAYHASAGHVSSRWLRA
Ga0318565_1045670513300031799SoilMSASELRAAGQARPGAQPPADTGHGFRGALAELFPEPAEIAPRAGLARWAFVPVQVALVALGAVVMLARIPGRPVWESAYGEDPRMYLPQALAHPWNLLQSYAGYLQLVPRVIGQAAALLPLRHASVA
Ga0318497_1004893413300031805SoilVSASDLRAPGQVGSGTDLPPTAGRGVRAVLADLFPAPAEPARRDALARWAFWLVQVAAVAVGAAVMLARTPGRAAWDSIYGEDRGIYLPQALAHPGQLLQSYAGYLQLVPRLIGQIAALLPLRDASVAFAVGGALVASACGLFTYHASAGHVSSRWRGK
Ga0318567_1002747743300031821SoilVSAPELRAPGQDGTGAHLPPAAGHSALVDLFPVPAEPAPRTGLVRWALVLVQVAVVALGALAMLARVGGRPAWDSVWAEDPGVYLPGALAHPWHLLQSYAGYLQLIPRLIGQVAALL
Ga0318567_1035229813300031821SoilVSASELRAPGKAGPGAQRPSAAGHGARAVLDDLFPAPAEPAPRTGLARWAWPLVQVAAVAIGALVMLVRIGGRRPAWESVWAEDRDMYVPEALAHPWHLLQSYG
Ga0318564_1008796523300031831SoilVSASELRAPGKAGPGAQRPSAAGHGARAVLDDLFPAPAEPAPRTGLARWAWPLVQVAAVAVGALVMLVRIGGRRPAWESVWAEDRDMYVPEALAHPWHLLQSYGGYLQLVPRLFGQAATLLPIRDASVVLAAGGALVASACALFAYHASAGQVSSRWLRAL
Ga0318499_1003279913300031832SoilVSASEVHAPGQAGPGARPPPVAGHGVRAVLADLFPAPPGPAPRAGLARWAFLLLQVAVVALGAVVMLARLGGRPAWDSVYAEDPGIYLPGALAHPWQLLQSYGGYLQLVPR
Ga0310917_1031216213300031833SoilVSASDLRAPGQVGSGTDLPPTAGRGVRAVLADLFPAPAEPARRDALARWAFWLVQVAAVAVGAAVMLARTPGRAAWDSIYGEDRGIYLPQALAHPGQLLQSYAGYLQLVPRLIGQIAALLPLRDASVAFAVGGALVASACGLFTYHASAGHVSSRWLR
Ga0310917_1081129723300031833SoilVSASEVRAPGQAGPGEHLPSAAGHGVRAALGDLFPVSAEPTPRAGLPRWALVLIQVALVAAGALVMLARVGGRPAWDSVWAEDPGVYLPQALAHPWQLLQSYAGYLQLVPR
Ga0318512_1021256613300031846SoilVSASDLRAPGQVGSGTDLPPTAGRGVRAVLADLFPAPAEPARRDGLARWAFWLVQVAAVAVGAAVMLARTPGRAAWDSIYGEDRGIYLPQALAHPGQ
Ga0306925_1215646923300031890SoilVSAPELRAPGQDGTGAHLPPAAGHSALVDLFPVPAEPAPRTGLVRWALVLVQVAVVALGALAMLARVGGRPAWDSVWAEDPGVYLPGALAHPWHLLLSYAGYLQLI
Ga0306923_1223102813300031910SoilVSASDLRAPGQAESGTGLPPPAARGVRAVLADLFPAPAKPARRDGLARWVFLLVQVAAIAVGAVVMLARTPGRPAWDSIYGEDRGIYLPQALAHPWQLLQSYAGYLQLVPRLISQMAVLLPLRDALVAF
Ga0306921_1247133013300031912SoilVSASDLRAPGQAESGTGLPPPAARGVRAVLADLFPAPAKPARRDGLARWVFLLVQVAAIAVGAVVMLARTPGRPAWDSIYGEDRGIYLPQALAHPWQLLQSYAGYLQLVPRLISQMAVLLPLRDAPVAFAAGGALVASACGLFAYHASAGHV
Ga0310916_1044636723300031942SoilVSASEVRAPGQAGLGEHLPSAAGHGVRAALGDLFPVSAEPTPRAGLPRWALVLIQVALVAAGALVMLARVGGRPAWDSVWAEDPGVYLPQALAHPWHL
Ga0310913_1035080823300031945SoilVSAPELRAPGQDGTGAHLPPAAGHSALVDLFPVPAEPAPRTGLVRWALVLVQVAVVALGALAMLARVGGRPAWDSVWAEDPGVYLPGALAHPWHLLQSYAGYLQLIPRLIGQVAALLPIRHASVAFAAG
Ga0310913_1063932923300031945SoilMSASELRAAGQARPGAQPPPDAGHGFRGALAELFPEPAEIAPRAGLARWAFVPVQVALVALGALVMLARVGGGRPVWESAYGEDPRMYLPQALAHPWNLLQSYAGYLQLVPRVI
Ga0310910_1109073713300031946SoilVSAPELRAAGQAGPGARPPPDTGHGFRGALAELFPEPAEIAPRAGLARWAFVPVQVVVIALGALVMLARAGGGRPVWESIYAEDRGIYLPWALAHPWHLLHS
Ga0310910_1143779813300031946SoilVSASELRAPGKAGTGAHPPPAAGHRVRTVLADLFPEPAEPAPGAGLARWAFLLIQVVVVAVGTVVMLARIGGRPAWESVYAEDPGIYLPQALAHPWHLLA
Ga0310909_1148597013300031947SoilVSASELRAPGKAGTGAHPPPAAGHRVRTVLADLFPEPAEPAPGAGLARWAFLLIQVVVVAVGTVVMLARIGGRPAWESVYAEDPGIYLPQALAHPWHLLASYGGY
Ga0306926_1302114213300031954SoilVSAPELRAPGAAGAGARLQPDADHGVRATLADLFPAPAEPGPRLGVARWSALILGQAALIALGGLVMLARMGGRPAWESVWAEDRGIYVPDALAHPWHLLQSYGGYLQLAPRLIGQVAALLPIRHA
Ga0318531_1046837023300031981SoilVSAPELRAPGQDGTGAHLPPAAGHSALVDLFPVPAEPAPRTGLVRWALVLVQVAVVALGALAMLARVGGRPAWDSVWAEDPGVYLPGALAHPWHLLLSYAGYLQLIPRLIGQIAALLPIR
Ga0318531_1049162613300031981SoilVSAPELRTPGQAGSGERLPPDAGHGFRGALAELFPEPAEIAPRAGLARWAFVPVQVVVIALGALVMLARAGGGRPVWESIYAEDRGIYLPWALAHPWHLLHSYGGYLQLM
Ga0306922_1037735713300032001SoilVSAPELRTPGQAGSGERLPPDAGHGFRGALAELFPEPAEIAPRAGLARWAFVPVQVALVALGAVVMLARIPGRPVWESAYGEDPRMYLPQALAHPWNLLQSYAGYLQLVPRVIGQAAALLPLRHASVAFAVGGALVASACGLFAYH
Ga0318563_1012517213300032009SoilMSASELRAAGQARPGAQPPPDAGHGFRGALAELFPEPAEIAPRAGLARWAFVPVQVALVALGAVVMLARIPGRPVWESAYGEDPRMYLPQALAHPWNLLQSYAGYLQLVPRVIGQAAALLPLRHASVAFAVGGA
Ga0318569_1013415613300032010SoilVSASELRAPGKAGPGAQRPSAAGHGARAVLDDLFPAPAEPAPRTGLARWAWPLVQVAAVAVGALVMLVRIGGRRPAWESVWAEDRDMYVPEALAHPWHLLQSYGGYLQLVPRLFGQAATLLPIRDASVVLAAGGALVASACALFAYHASAGQVSSRWLRALLGLSV
Ga0318507_1018055423300032025SoilVSAPELRAPGQDGTGAHLPPAAGHSALVDLFPVPAEPAPRTGLVRWALVLVQVAVVALGALAMLARVGGRPAWDSVWAEDPGVYLPGALAHPWHLLQSYAGYLQLIPRLIGQVAALLPIRHASDAFAVGGALVASA
Ga0318556_1007166323300032043SoilVSASELRAPGKAGPGAQRPSAAGHGARAVLDDLFPAPAEPAPRTGLARWAWPLVQVAAVAIGALVMLVRIGGRRPAWESVWAEDRDMYVPEALAHPWH
Ga0318506_1022332613300032052SoilVSASELRAPGKAGPGAQRPSAAGHGARAVLDDLFPAPAEPAPRTGLARWAWPLVQVAAVAVGALVMLVRIGGRRPAWESVWAEDRDMYVPEALAHPWHLLQSYGGYLQLVPRLFGQAATLLPIRDASVVLAAGGALVASACALFAYHASAGQVSSRWLRALLGLSVLLL
Ga0318575_1011908113300032055SoilVSASELRAPGKAGPGAQRPSAAGHGARAVLDDLFPAPAEPAPRTGLARWAWPLVQVAAVAVGALVMLVRIGGRRPAWESVWAEDRDMYVPEALAHPWHLLQSYGGYLQLVPRLFGQAATLLPIRDASVVLAAGGALVASACALFAYHASAGQV
Ga0318575_1019412023300032055SoilMSASELRAAGQARPGAQPPPDAGHGFRGALAELFPEPAEIAPRAGLARWAFVPVQVALVALGAVVMLARIPGRPVWESAYGEDPRMYLPQALAHPWNLLQS
Ga0318504_1024760713300032063SoilVSASDLRAPGQVGSGTDLPPTAGRGVRAVLADLFPAPAEPARRDGLARWAFWLVQVAAVAVGAAVMLARTPGRAAWDSIYGEDRGIYLPQALAHPGQLLQSYAGYLQLVPRLIGQIAALLPLRDATVAFAVGGALVASACGLFTYHASAGHVSSRWR
Ga0318510_1005029713300032064SoilVSAPELRAPGQAGPGAQLPPAAGPGLRTVLGDLFPEPAEPAPRAPLARWALVLVQIVLVALGALVMLARVGGRPAWDSVWAEDPGVYLPGALAHPWH
Ga0318513_1051465313300032065SoilVSASELRAPGQAGSGTQLTSATRHGARAVLDDLFPAPPELVPRTGLARWAFLLVQVAAVVLGALVMLVRIGGRRPAWQNVWAEDRGVYVPEALAHPWHLLQSYGGYLQLVPRLIGQVAALAPIRDASVVLAAGGALVASGCGLFAYHACAGQVGSRWLR
Ga0318514_1000554543300032066SoilVSASELRAPGKAGPGAQRPSAAGHGARAVLDDLFPAPAEPAPRTGLARWAWPLVQVAAVAIGALVMLVRIGGRRPAWESVWAEDRDMYVPEALAHPWHLLQSYGGYLQLVPRLFGQAATLLPIRDASVVLAAGGAL
Ga0318524_1040477813300032067SoilVSAPELRTPGQAGSGERLPPDAGHGFRGALAELFPEPAEIAPRAGLARWAFVPVQVALVALGAVVMLARIPGRPVWESAYGEDPRMYLPQALAHPWNLLQSYAGY
Ga0318524_1055873313300032067SoilVSASELRAPGQAGSGTQLTSATRHGARAVLDDLFPAPPELVPRTGLARWAFLLVQVAAVVLGALVMLVRIGGRRPAWQNVWAEDRGVYVPEALAHPWHLLQSYGGYLQLVPRLIGQVAALAPIRDASVVL
Ga0318518_1053429813300032090SoilVSAPELRTPGQAGSGERLPPDAGHGFRGALAELFPEPAEIAPRAGLARWAFVPVQVVVIALGALVMLARAGGGRPVWESIYAEDRGIYLPWALAHPWHLLHSYGGYLQLMPR
Ga0306920_10169356813300032261SoilVSASDLRAPGQAESGTGLPPPAARGVRAVLADLFPAPAKPARRDGLARWVFLLVQVAAIAVGAVVMLARTPGRPAWDSIYGEDRGIYLPQALAHPWQLLQSYAGYLQLVPRLISQMAVLLPLRDAPVAFAAGGALVASACGL
Ga0335074_1004378013300032895SoilVSAPDVRAPGQAGPAADEPAAPGQGVRDALADLFPAPAEPATRAGLPRWAFILLQIALIAAGALVMLARIGGTKPAWDRVWAEDPGIYLPWALSHPWHLLQSYGGYLQLAPRLIGQ
Ga0335074_1051781313300032895SoilVSAPDVRAPGQAGSAAHEPPAPGQRVRDTLADLFPAPAEPARAGLPRWAFILLQIAVIAAGALVMLARIGGTRPAWDRVWAEDPGIYLPWALSHPWHLLQSYGGYLQLAPRLIGQ
Ga0335072_10008259173300032898SoilVSAPDVRAPGQAGPAADEPAGPGQGVRDALADLFPAPAEPAPRAGLPRWAFILLQIAVIAAGALVMLARIGGTKPAWDRVWAEDPGIYLPWALSHPWHLLQSYGGYLQLAPRLIGQFAA
Ga0335072_1053073813300032898SoilVSAPDVRAPGQAGSAAHEPPAPGQRVRDTLADLFPAPAEPARAGLPRWAFILLQIAVIAAGALVMLARIGGTRPAWDRVWAEDPGIYLPWALSHPWHLLQSYGGYLQL
Ga0318519_1019807623300033290SoilVSAPELRTPGQAGSGERLPPDAGHGFRGALAELFPEPAEIAPRAGLARWAFVPVQVALVALGAVVMLARIPGRPVWESAYGEDPRMYLPQALAHPWNLLQSYAGYLQLVPRVIGQAAALLPFRHASVAFAVGGAL
Ga0318519_1073407623300033290SoilVSASELRAPGKAGPGAQRPSAAGHGARAVLDDLFPAPAEPAPRTGLARWAWPLVQVAAVAVGALVMLVRIGGRRPAWESVWAEDRDMYVPEALAHPWHLLQSYGGYLQLVPRLFGQAATLLPIRDASVVLAAGGALVASACALFAYHASAGQVSSRWLRALLGLSVLL


 ⦗Top⦘


© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.