Basic Information | |
---|---|
Family ID | F083423 |
Family Type | Metagenome / Metatranscriptome |
Number of Sequences | 113 |
Average Sequence Length | 43 residues |
Representative Sequence | VRARVRTAPARPAGTWTSWAIALPGADWEEHDEQAVWEEIDD |
Number of Associated Samples | 95 |
Number of Associated Scaffolds | 113 |
Quality Assessment | |
---|---|
Transcriptomic Evidence | Yes |
Most common taxonomic group | Bacteria |
% of genes with valid RBS motifs | 6.19 % |
% of genes near scaffold ends (potentially truncated) | 90.27 % |
% of genes from short scaffolds (< 2000 bps) | 91.15 % |
Associated GOLD sequencing projects | 86 |
AlphaFold2 3D model prediction | Yes |
3D model pTM-score | 0.54 |
Hidden Markov Model |
---|
Powered by Skylign |
Most Common Taxonomy | |
---|---|
Group | Bacteria (53.097 % of family members) |
NCBI Taxonomy ID | 2 |
Taxonomy | All Organisms → cellular organisms → Bacteria |
Most Common Ecosystem | |
---|---|
GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil (22.124 % of family members) |
Environment Ontology (ENVO) | Unclassified (31.858 % of family members) |
Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (57.522 % of family members) |
⦗Top⦘ |
⦗Top⦘ |
Predicted Topology & Secondary Structure | |||||
---|---|---|---|---|---|
Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 0.00% β-sheet: 22.86% Coil/Unstructured: 77.14% | Feature Viewer |
|
|||||
Powered by Feature Viewer |
Structure Viewer | |
---|---|
| |
Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.54 |
Powered by PDBe Molstar |
⦗Top⦘ |
Pfam ID | Name | % Frequency in 113 Family Scaffolds |
---|---|---|
PF12833 | HTH_18 | 9.73 |
PF03631 | Virul_fac_BrkB | 5.31 |
PF01740 | STAS | 3.54 |
PF11139 | SfLAP | 3.54 |
PF04087 | DUF389 | 1.77 |
PF13520 | AA_permease_2 | 1.77 |
PF13675 | PilJ | 1.77 |
PF07885 | Ion_trans_2 | 1.77 |
PF02627 | CMD | 0.88 |
PF00196 | GerE | 0.88 |
PF01734 | Patatin | 0.88 |
PF13276 | HTH_21 | 0.88 |
PF12680 | SnoaL_2 | 0.88 |
PF00571 | CBS | 0.88 |
PF00282 | Pyridoxal_deC | 0.88 |
PF02371 | Transposase_20 | 0.88 |
PF00230 | MIP | 0.88 |
PF00005 | ABC_tran | 0.88 |
PF06897 | DUF1269 | 0.88 |
PF00654 | Voltage_CLC | 0.88 |
PF01381 | HTH_3 | 0.88 |
PF02656 | DUF202 | 0.88 |
PF14347 | DUF4399 | 0.88 |
PF16859 | TetR_C_11 | 0.88 |
PF13230 | GATase_4 | 0.88 |
PF09851 | SHOCT | 0.88 |
PF02861 | Clp_N | 0.88 |
PF05973 | Gp49 | 0.88 |
PF07366 | SnoaL | 0.88 |
COG ID | Name | Functional Category | % Frequency in 113 Family Scaffolds |
---|---|---|---|
COG1295 | Uncharacterized membrane protein, BrkB/YihY/UPF0761 family (not an RNase) | Function unknown [S] | 5.31 |
COG1808 | Uncharacterized membrane protein AF0785, contains DUF389 domain | Function unknown [S] | 1.77 |
COG3621 | Patatin-like phospholipase/acyl hydrolase, includes sporulation protein CotR | General function prediction only [R] | 0.88 |
COG3657 | Putative component of the toxin-antitoxin plasmid stabilization module | Defense mechanisms [V] | 0.88 |
COG4667 | Predicted phospholipase, patatin/cPLA2 family | Lipid transport and metabolism [I] | 0.88 |
COG4679 | Phage-related protein gp49, toxin component of the Tad-Ata toxin-antitoxin system | Defense mechanisms [V] | 0.88 |
COG4803 | Uncharacterized membrane protein | Function unknown [S] | 0.88 |
COG0038 | H+/Cl- antiporter ClcA | Inorganic ion transport and metabolism [P] | 0.88 |
COG0076 | Glutamate or tyrosine decarboxylase or a related PLP-dependent protein | Amino acid transport and metabolism [E] | 0.88 |
COG0542 | ATP-dependent Clp protease, ATP-binding subunit ClpA | Posttranslational modification, protein turnover, chaperones [O] | 0.88 |
COG0580 | Glycerol uptake facilitator or related aquaporin (Major Intrinsic protein Family) | Carbohydrate transport and metabolism [G] | 0.88 |
COG0599 | Uncharacterized conserved protein YurZ, alkylhydroperoxidase/carboxymuconolactone decarboxylase family | General function prediction only [R] | 0.88 |
COG1752 | Predicted acylesterase/phospholipase RssA, containd patatin domain | General function prediction only [R] | 0.88 |
COG2128 | Alkylhydroperoxidase family enzyme, contains CxxC motif | Inorganic ion transport and metabolism [P] | 0.88 |
COG2149 | Uncharacterized membrane protein YidH, DUF202 family | Function unknown [S] | 0.88 |
COG3547 | Transposase | Mobilome: prophages, transposons [X] | 0.88 |
⦗Top⦘ |
Name | Rank | Taxonomy | Distribution |
All Organisms | root | All Organisms | 53.10 % |
Unclassified | root | N/A | 46.90 % |
Visualization |
---|
Powered by ApexCharts |
Scaffold | Taxonomy | Length | IMG/M Link |
---|---|---|---|
2170459024|GZRSKLJ02GPPZA | Not Available | 504 | Open in IMG/M |
2170459024|GZRSKLJ02JGP2I | Not Available | 515 | Open in IMG/M |
3300001213|JGIcombinedJ13530_109180060 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → Capillimicrobiaceae → Capillimicrobium → Capillimicrobium parvum | 543 | Open in IMG/M |
3300001213|JGIcombinedJ13530_109819513 | Not Available | 514 | Open in IMG/M |
3300001400|JGI20183J14883_101367 | Not Available | 1102 | Open in IMG/M |
3300001427|JGI20200J14955_1003034 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micromonosporales → Micromonosporaceae → Actinoplanes → Actinoplanes digitatis | 2563 | Open in IMG/M |
3300001453|JGI20197J15136_1003536 | Not Available | 1789 | Open in IMG/M |
3300004006|Ga0055453_10002761 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 3529 | Open in IMG/M |
3300004067|Ga0055485_10190266 | Not Available | 579 | Open in IMG/M |
3300004152|Ga0062386_101041645 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 678 | Open in IMG/M |
3300005332|Ga0066388_105342445 | Not Available | 651 | Open in IMG/M |
3300005713|Ga0066905_101742663 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 573 | Open in IMG/M |
3300005834|Ga0068851_10763419 | Not Available | 599 | Open in IMG/M |
3300005995|Ga0066790_10346006 | Not Available | 635 | Open in IMG/M |
3300006059|Ga0075017_101253224 | Not Available | 581 | Open in IMG/M |
3300006102|Ga0075015_100968506 | Not Available | 519 | Open in IMG/M |
3300009156|Ga0111538_12617164 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Acidimicrobiia → unclassified Acidimicrobiia → Acidimicrobiia bacterium | 633 | Open in IMG/M |
3300009176|Ga0105242_11322183 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 745 | Open in IMG/M |
3300009520|Ga0116214_1227536 | Not Available | 705 | Open in IMG/M |
3300009522|Ga0116218_1253925 | Not Available | 790 | Open in IMG/M |
3300009522|Ga0116218_1558768 | Not Available | 508 | Open in IMG/M |
3300009523|Ga0116221_1117017 | Not Available | 1171 | Open in IMG/M |
3300009524|Ga0116225_1218325 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii | 859 | Open in IMG/M |
3300009525|Ga0116220_10065600 | All Organisms → cellular organisms → Bacteria | 1521 | Open in IMG/M |
3300009683|Ga0116224_10436128 | All Organisms → cellular organisms → Bacteria | 624 | Open in IMG/M |
3300009698|Ga0116216_10823933 | All Organisms → cellular organisms → Bacteria | 556 | Open in IMG/M |
3300009700|Ga0116217_10212470 | All Organisms → cellular organisms → Bacteria | 1268 | Open in IMG/M |
3300009700|Ga0116217_10399642 | All Organisms → cellular organisms → Bacteria | 872 | Open in IMG/M |
3300009822|Ga0105066_1042995 | All Organisms → cellular organisms → Bacteria | 939 | Open in IMG/M |
3300009824|Ga0116219_10185001 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Streptosporangiaceae | 1196 | Open in IMG/M |
3300009839|Ga0116223_10308041 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 944 | Open in IMG/M |
3300010046|Ga0126384_10312023 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 1297 | Open in IMG/M |
3300010341|Ga0074045_10269281 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii | 1122 | Open in IMG/M |
3300010379|Ga0136449_100446434 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 2271 | Open in IMG/M |
3300010379|Ga0136449_100470237 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 2197 | Open in IMG/M |
3300010379|Ga0136449_100512308 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 2079 | Open in IMG/M |
3300010379|Ga0136449_100749360 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1626 | Open in IMG/M |
3300010379|Ga0136449_101927111 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 877 | Open in IMG/M |
3300010379|Ga0136449_102049943 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 842 | Open in IMG/M |
3300010880|Ga0126350_12329459 | Not Available | 675 | Open in IMG/M |
3300011107|Ga0151490_1653792 | All Organisms → cellular organisms → Bacteria | 580 | Open in IMG/M |
3300012358|Ga0137368_10670692 | Not Available | 654 | Open in IMG/M |
3300012514|Ga0157330_1027980 | All Organisms → cellular organisms → Bacteria | 689 | Open in IMG/M |
3300012948|Ga0126375_10448873 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 947 | Open in IMG/M |
3300014159|Ga0181530_10225197 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1018 | Open in IMG/M |
3300014261|Ga0075360_1091742 | Not Available | 586 | Open in IMG/M |
3300014318|Ga0075351_1108691 | Not Available | 609 | Open in IMG/M |
3300014969|Ga0157376_11823284 | Not Available | 645 | Open in IMG/M |
3300016371|Ga0182034_10252471 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptomycetales → Streptomycetaceae | 1392 | Open in IMG/M |
3300016422|Ga0182039_10488882 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptomycetales → Streptomycetaceae | 1061 | Open in IMG/M |
3300016445|Ga0182038_10785108 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptomycetales → Streptomycetaceae | 834 | Open in IMG/M |
3300016750|Ga0181505_11048749 | Not Available | 583 | Open in IMG/M |
3300017932|Ga0187814_10203617 | All Organisms → cellular organisms → Bacteria | 744 | Open in IMG/M |
3300017937|Ga0187809_10078191 | All Organisms → cellular organisms → Bacteria | 1089 | Open in IMG/M |
3300017937|Ga0187809_10162465 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 778 | Open in IMG/M |
3300017946|Ga0187879_10493736 | Not Available | 679 | Open in IMG/M |
3300017955|Ga0187817_10333653 | Not Available | 967 | Open in IMG/M |
3300017955|Ga0187817_10532236 | Not Available | 750 | Open in IMG/M |
3300017970|Ga0187783_10684665 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 740 | Open in IMG/M |
3300017970|Ga0187783_11361845 | All Organisms → cellular organisms → Bacteria | 511 | Open in IMG/M |
3300017974|Ga0187777_11378387 | Not Available | 520 | Open in IMG/M |
3300018085|Ga0187772_10133519 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1629 | Open in IMG/M |
3300018089|Ga0187774_11218517 | Not Available | 540 | Open in IMG/M |
3300018090|Ga0187770_10552516 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 913 | Open in IMG/M |
3300018090|Ga0187770_11047865 | Not Available | 657 | Open in IMG/M |
3300018481|Ga0190271_13083646 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Propionibacteriales → Nocardioidaceae → Nocardioides → unclassified Nocardioides → Nocardioides sp. Soil805 | 559 | Open in IMG/M |
3300024271|Ga0224564_1114220 | Not Available | 552 | Open in IMG/M |
3300025461|Ga0208851_1037206 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 885 | Open in IMG/M |
3300025479|Ga0208588_1007580 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micromonosporales → Micromonosporaceae → Actinoplanes → Actinoplanes digitatis | 2681 | Open in IMG/M |
3300025499|Ga0207931_1062681 | Not Available | 723 | Open in IMG/M |
3300025556|Ga0210120_1047941 | Not Available | 834 | Open in IMG/M |
3300025836|Ga0209748_1122089 | All Organisms → cellular organisms → Bacteria | 975 | Open in IMG/M |
3300025878|Ga0209584_10298687 | Not Available | 619 | Open in IMG/M |
3300026294|Ga0209839_10046449 | Not Available | 1588 | Open in IMG/M |
3300027497|Ga0208199_1134019 | Not Available | 504 | Open in IMG/M |
3300027523|Ga0208890_1002692 | All Organisms → cellular organisms → Bacteria | 1935 | Open in IMG/M |
3300027568|Ga0208042_1148940 | All Organisms → cellular organisms → Bacteria | 587 | Open in IMG/M |
3300027568|Ga0208042_1158398 | Not Available | 566 | Open in IMG/M |
3300027577|Ga0209874_1042895 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1198 | Open in IMG/M |
3300027604|Ga0208324_1009156 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → Conexibacteraceae → Conexibacter → Conexibacter woesei | 3271 | Open in IMG/M |
3300027604|Ga0208324_1214106 | Not Available | 508 | Open in IMG/M |
3300027902|Ga0209048_10017578 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 6266 | Open in IMG/M |
3300028665|Ga0302160_10020738 | Not Available | 1206 | Open in IMG/M |
3300028770|Ga0302258_1100030 | Not Available | 702 | Open in IMG/M |
3300028796|Ga0307287_10380981 | Not Available | 531 | Open in IMG/M |
3300028868|Ga0302163_10063593 | Not Available | 892 | Open in IMG/M |
3300030000|Ga0311337_11661140 | Not Available | 560 | Open in IMG/M |
3300030673|Ga0302287_10163643 | Not Available | 643 | Open in IMG/M |
3300031170|Ga0307498_10251076 | Not Available | 641 | Open in IMG/M |
3300031170|Ga0307498_10370272 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 556 | Open in IMG/M |
3300031231|Ga0170824_120467734 | Not Available | 521 | Open in IMG/M |
3300031521|Ga0311364_10512291 | Not Available | 1213 | Open in IMG/M |
3300031521|Ga0311364_11436398 | Not Available | 682 | Open in IMG/M |
3300031682|Ga0318560_10045837 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Streptosporangiaceae → Acrocarpospora → Acrocarpospora macrocephala | 2136 | Open in IMG/M |
3300031708|Ga0310686_108848709 | Not Available | 507 | Open in IMG/M |
3300031744|Ga0306918_10867107 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 704 | Open in IMG/M |
3300031765|Ga0318554_10434923 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptomycetales → Streptomycetaceae | 744 | Open in IMG/M |
3300031781|Ga0318547_10665394 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 647 | Open in IMG/M |
3300031805|Ga0318497_10260637 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptomycetales → Streptomycetaceae | 963 | Open in IMG/M |
3300031902|Ga0302322_101657910 | Not Available | 782 | Open in IMG/M |
3300031918|Ga0311367_10867424 | Not Available | 910 | Open in IMG/M |
3300031981|Ga0318531_10314021 | Not Available | 708 | Open in IMG/M |
3300032043|Ga0318556_10295980 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptomycetales → Streptomycetaceae | 846 | Open in IMG/M |
3300032055|Ga0318575_10599279 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptomycetales → Streptomycetaceae | 558 | Open in IMG/M |
3300032160|Ga0311301_10396399 | Not Available | 2117 | Open in IMG/M |
3300032160|Ga0311301_12495317 | Not Available | 578 | Open in IMG/M |
3300032256|Ga0315271_10484662 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1047 | Open in IMG/M |
3300032770|Ga0335085_11902650 | Not Available | 606 | Open in IMG/M |
3300032783|Ga0335079_10954897 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 877 | Open in IMG/M |
3300032805|Ga0335078_12712513 | All Organisms → cellular organisms → Bacteria | 504 | Open in IMG/M |
3300032954|Ga0335083_11136374 | All Organisms → cellular organisms → Bacteria | 608 | Open in IMG/M |
3300034354|Ga0364943_0454432 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Rubrobacteria → Gaiellales → Gaiellaceae → Gaiella → unclassified Gaiella → Gaiella sp. SCGC AG-212-M14 | 500 | Open in IMG/M |
3300034358|Ga0370485_0175689 | Not Available | 661 | Open in IMG/M |
⦗Top⦘ |
Habitat | Taxonomy | Distribution |
Peatlands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil | 22.12% |
Fen | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Fen | 7.96% |
Arctic Peat Soil | Environmental → Terrestrial → Soil → Unclassified → Permafrost → Arctic Peat Soil | 7.08% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 6.19% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 6.19% |
Tropical Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland | 6.19% |
Freshwater Sediment | Environmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment | 4.42% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 3.54% |
Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 3.54% |
Natural And Restored Wetlands | Environmental → Aquatic → Marine → Wetlands → Unclassified → Natural And Restored Wetlands | 2.65% |
Peatland | Environmental → Aquatic → Freshwater → Wetlands → Bog → Peatland | 1.77% |
Wetland | Environmental → Aquatic → Marine → Wetlands → Sediment → Wetland | 1.77% |
Watersheds | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds | 1.77% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 1.77% |
Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 1.77% |
Grass Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grass Soil | 1.77% |
Natural And Restored Wetlands | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Natural And Restored Wetlands | 1.77% |
Soil | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Soil | 1.77% |
Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 1.77% |
Groundwater Sand | Environmental → Terrestrial → Soil → Sand → Unclassified → Groundwater Sand | 1.77% |
Freshwater Lake Sediment | Environmental → Aquatic → Freshwater → Lentic → Sediment → Freshwater Lake Sediment | 0.89% |
Sediment | Environmental → Aquatic → Freshwater → Lake → Sediment → Sediment | 0.89% |
Bog Forest Soil | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog Forest Soil | 0.89% |
Bog | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog | 0.89% |
Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 0.89% |
Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil | 0.89% |
Untreated Peat Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Untreated Peat Soil | 0.89% |
Bog Forest Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Bog Forest Soil | 0.89% |
Sediment | Environmental → Terrestrial → Floodplain → Sediment → Unclassified → Sediment | 0.89% |
Corn Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere | 0.89% |
Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 0.89% |
Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 0.89% |
Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 0.89% |
Boreal Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Boreal Forest Soil | 0.89% |
Visualization |
---|
Powered by ApexCharts |
Taxon OID | Sample Name | Habitat Type | IMG/M Link |
---|---|---|---|
2170459024 | Grass soil microbial communities from Rothamsted Park, UK - FD1 (NaCl 300g/L 5ml) | Environmental | Open in IMG/M |
3300001213 | Combined assembly of wetland microbial communities from Twitchell Island in the Sacramento Delta (Jan 2013 JGI Velvet Assembly) | Environmental | Open in IMG/M |
3300001400 | Arctic peat soil from Barrow, Alaska - NGEE Surface sample 415-3 deep-072012 | Environmental | Open in IMG/M |
3300001427 | Arctic peat soil from Barrow, Alaska - NGEE Surface sample 415-2 shallow-092012 | Environmental | Open in IMG/M |
3300001453 | Arctic peat soil from Barrow, Alaska - NGEE Surface sample 415-1 deep-092012 | Environmental | Open in IMG/M |
3300004006 | Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - Goodyear_PhragA_D2 | Environmental | Open in IMG/M |
3300004067 | Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - RushMan_ThreeSqA_D2 | Environmental | Open in IMG/M |
3300004152 | Coassembly of ECP12_OM1, ECP12_OM2, ECP12_OM3 | Environmental | Open in IMG/M |
3300005332 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly) | Environmental | Open in IMG/M |
3300005713 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 36 (version 2) | Environmental | Open in IMG/M |
3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Host-Associated | Open in IMG/M |
3300005995 | Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Organic soil replicate 3 DNA2013-050 | Environmental | Open in IMG/M |
3300006059 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Alex Branch Run_MetaG_ABR_2012 | Environmental | Open in IMG/M |
3300006102 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Alex Branch Run_MetaG_ABR_2013 | Environmental | Open in IMG/M |
3300009156 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD1 (version 2) | Host-Associated | Open in IMG/M |
3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Host-Associated | Open in IMG/M |
3300009520 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_1_NS metaG | Environmental | Open in IMG/M |
3300009522 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_5_LS metaG | Environmental | Open in IMG/M |
3300009523 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_8_FC metaG | Environmental | Open in IMG/M |
3300009524 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_c_BC metaG | Environmental | Open in IMG/M |
3300009525 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_7_NC metaG | Environmental | Open in IMG/M |
3300009683 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_b_LC metaG | Environmental | Open in IMG/M |
3300009698 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_3_AS metaG | Environmental | Open in IMG/M |
3300009700 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_4_PS metaG | Environmental | Open in IMG/M |
3300009822 | Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW S1_30_40 | Environmental | Open in IMG/M |
3300009824 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_6_BS metaG | Environmental | Open in IMG/M |
3300009839 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_a_PC metaG | Environmental | Open in IMG/M |
3300010046 | Tropical forest soil microbial communities from Panama - MetaG Plot_36 | Environmental | Open in IMG/M |
3300010341 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - Bog Forest MetaG ECP23OM2 | Environmental | Open in IMG/M |
3300010379 | Sb_50d combined assembly | Environmental | Open in IMG/M |
3300010880 | Boreal forest soil eukaryotic communities from Alaska, USA - C5-1 Metatranscriptome (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
3300011107 | Soil and rhizosphere microbial communities from Centre INRS-Institut Armand-Frappier, Laval, Canada - Soil microcosm metaTmtHAC (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
3300012358 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_100_16 metaG | Environmental | Open in IMG/M |
3300012514 | Unplanted soil (control) microbial communities from North Carolina - M.Soil.1.old.130510 | Environmental | Open in IMG/M |
3300012948 | Tropical forest soil microbial communities from Panama - MetaG Plot_14 | Environmental | Open in IMG/M |
3300014159 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin10_60_metaG | Environmental | Open in IMG/M |
3300014261 | Natural and restored wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - WestPond_TuleC_D1 | Environmental | Open in IMG/M |
3300014318 | Natural and restored wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - Sandmound_ThreeSqA_D1_rd | Environmental | Open in IMG/M |
3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Host-Associated | Open in IMG/M |
3300016371 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.172 | Environmental | Open in IMG/M |
3300016422 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.111 | Environmental | Open in IMG/M |
3300016445 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.108 | Environmental | Open in IMG/M |
3300016750 | Metatranscriptome of peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin05_30_metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300017932 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - ASW-S_4 | Environmental | Open in IMG/M |
3300017937 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - ASW_4 | Environmental | Open in IMG/M |
3300017946 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_19_10 | Environmental | Open in IMG/M |
3300017955 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_2 | Environmental | Open in IMG/M |
3300017970 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_SJ02_MP02_20_MG | Environmental | Open in IMG/M |
3300017974 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_Q2_SP5_10_MG | Environmental | Open in IMG/M |
3300018085 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP15_20_MG | Environmental | Open in IMG/M |
3300018089 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_BV02_MP05_20_MG | Environmental | Open in IMG/M |
3300018090 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP02_20_MG | Environmental | Open in IMG/M |
3300018481 | Populus adjacent soil microbial communities from riparian zone of Weber River, Utah, USA - 356 T | Environmental | Open in IMG/M |
3300024271 | Soil microbial communities from Bohemian Forest, Czech Republic ? CSU5 | Environmental | Open in IMG/M |
3300025461 | Arctic peat soil from Barrow, Alaska - NGEE Surface sample 415-2 shallow-092012 (SPAdes) | Environmental | Open in IMG/M |
3300025479 | Arctic peat soil from Barrow, Alaska - NGEE Surface sample 415-3 shallow-092012 (SPAdes) | Environmental | Open in IMG/M |
3300025499 | Arctic peat soil from Barrow, Alaska - NGEE Surface sample 415-1 deep-092012 (SPAdes) | Environmental | Open in IMG/M |
3300025556 | Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - Goodyear_PhragA_D2 (SPAdes) | Environmental | Open in IMG/M |
3300025836 | Arctic peat soil from Barrow, Alaska - Barrow Graham LP Incubations 004-21A (SPAdes) | Environmental | Open in IMG/M |
3300025878 | Arctic peat soil microbial communities from the Barrow Environmental Observatory site, Barrow, Alaska, USA - NGEE PermafrostAB12-D (SPAdes) | Environmental | Open in IMG/M |
3300026294 | Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Organic soil replicate 3 DNA2013-050 (SPAdes) | Environmental | Open in IMG/M |
3300027497 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_1_NS metaG (SPAdes) | Environmental | Open in IMG/M |
3300027523 | Soil and rhizosphere microbial communities from Laval, Canada - mgHPA (SPAdes) | Environmental | Open in IMG/M |
3300027568 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_7_NC metaG (SPAdes) | Environmental | Open in IMG/M |
3300027577 | Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW N1_20_30 (SPAdes) | Environmental | Open in IMG/M |
3300027604 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_5_LS metaG (SPAdes) | Environmental | Open in IMG/M |
3300027902 | Freshwater lake sediment microbial communities from the University of Notre Dame, USA, for methane emissions studies - CRP12 CR (SPAdes) | Environmental | Open in IMG/M |
3300028665 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Fen_E1_3 | Environmental | Open in IMG/M |
3300028770 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Fen_N2_4 | Environmental | Open in IMG/M |
3300028796 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_141 | Environmental | Open in IMG/M |
3300028868 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Fen_E2_3 | Environmental | Open in IMG/M |
3300030000 | I_Fen_N3 coassembly | Environmental | Open in IMG/M |
3300030673 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - III_Fen_E2_4 | Environmental | Open in IMG/M |
3300031170 | Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 12_S | Environmental | Open in IMG/M |
3300031231 | Coassembly Site 11 (all samples) - Champenoux / Amance forest | Environmental | Open in IMG/M |
3300031521 | III_Fen_E2 coassembly | Environmental | Open in IMG/M |
3300031682 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.065b5f22 | Environmental | Open in IMG/M |
3300031708 | FICUS49499 Metagenome Czech Republic combined assembly | Environmental | Open in IMG/M |
3300031744 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.00H (v2) | Environmental | Open in IMG/M |
3300031765 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f22 | Environmental | Open in IMG/M |
3300031781 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f20 | Environmental | Open in IMG/M |
3300031805 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.109b1f23 | Environmental | Open in IMG/M |
3300031902 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Fen_T0_2 | Environmental | Open in IMG/M |
3300031918 | III_Fen_N3 coassembly | Environmental | Open in IMG/M |
3300031981 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.053b4f25 | Environmental | Open in IMG/M |
3300032043 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f24 | Environmental | Open in IMG/M |
3300032055 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f23 | Environmental | Open in IMG/M |
3300032160 | Sb_50d combined assembly (MetaSPAdes) | Environmental | Open in IMG/M |
3300032256 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - C3_top | Environmental | Open in IMG/M |
3300032770 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.5 | Environmental | Open in IMG/M |
3300032783 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.3 | Environmental | Open in IMG/M |
3300032805 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.2 | Environmental | Open in IMG/M |
3300032954 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.2 | Environmental | Open in IMG/M |
3300034354 | Sediment microbial communities from East River floodplain, Colorado, United States - 23_s17 | Environmental | Open in IMG/M |
3300034358 | Peat soil microbial communities from wetlands in Alaska, United States - Frozen_pond_01D_16 | Environmental | Open in IMG/M |
Geographical Distribution | |
---|---|
Zoom: | Powered by OpenStreetMap |
⦗Top⦘ |
Protein ID | Sample Taxon ID | Habitat | Sequence |
FD1_08446130 | 2170459024 | Grass Soil | TPARPTGTWTSWAIKMPDTDWEQHDEQSIWQEIHD |
FD1_04336160 | 2170459024 | Grass Soil | MVVRAKVRTAPARPAGTWTSWAVALPGAGWEEHDEQAVWQEIDD |
JGIcombinedJ13530_1091800602 | 3300001213 | Wetland | RVRTVPARPEGTWTSWAIAMPGADWEEHDERSIWEEIDG* |
JGIcombinedJ13530_1098195131 | 3300001213 | Wetland | ARVRTAPALPVGTWTSWAIALPGADWEEHDEQAVWEELDE* |
JGI20183J14883_1013672 | 3300001400 | Arctic Peat Soil | AQPVGTWTSWAIALPGADWEEHDEQAVWEEIDDD* |
JGI20200J14955_10030341 | 3300001427 | Arctic Peat Soil | MLVRAGVRTTPAQPIGTWTSWAIALPGADWEEHDEQAVWEEIDD* |
JGI20197J15136_10035362 | 3300001453 | Arctic Peat Soil | DLTPGMTVRARVRTSPAQPVGTWTSWAIAMPGADWEEHDEQAVWEEIDDD* |
Ga0055453_100027615 | 3300004006 | Natural And Restored Wetlands | DMVVRARVRTALARPIGTWTSWAIAMPGADWEEHDEQSVWVEIDD* |
Ga0055485_101902662 | 3300004067 | Natural And Restored Wetlands | LVPGMVVRARVRTAPARPVGTWTRWSIAMPGAAWEDHDEQLIWEELDD* |
Ga0062386_1010416451 | 3300004152 | Bog Forest Soil | DLTPGMVVRARVRTAPAQPIGTWTSWAIAMPGADWEEHDEQSVWVEIDD* |
Ga0066388_1053424452 | 3300005332 | Tropical Forest Soil | LTPGMVVRARVRTAPARPAGTWTSWAVALPGADWEEHDEQAVWEEIDD* |
Ga0066905_1017426631 | 3300005713 | Tropical Forest Soil | APARPIGTWTSWAVALPGTDWEEHDEQAVWQEIDDEQYQEP* |
Ga0068851_107634193 | 3300005834 | Corn Rhizosphere | TAPARPVGTWTSWAIALPGADWEEHDEQAVWEEIDD* |
Ga0066790_103460061 | 3300005995 | Soil | RARVRTAPARPVGTWTSWAIAMPGADWQEHDEQSVWEEIND* |
Ga0075017_1012532242 | 3300006059 | Watersheds | LAAGTAVRTRVRNTPAQPAGTWTSWAIALPGAEWEEHDEQMIWIEIDE* |
Ga0075015_1009685061 | 3300006102 | Watersheds | VGARVRTTLARSEGTWTRWAIKLPGADWEEHDEQAVWQEIDG* |
Ga0111538_126171641 | 3300009156 | Populus Rhizosphere | RPGMVVRSRVRTTPAQPVGTWTSWAIALPDAGWEEHDEQAVWVEIDD* |
Ga0105242_113221831 | 3300009176 | Miscanthus Rhizosphere | APARPVGTWTSWAIALPGVDWEEHDEQAVWEEIDG* |
Ga0116214_12275362 | 3300009520 | Peatlands Soil | VVRAKVRTAPARPAGTWTSWAVALPGAGWEEHDEQAVWQEIDD* |
Ga0116218_12539251 | 3300009522 | Peatlands Soil | ARVRTAPARPIGTWTSWAIAMPGADWEEHDEQSVWEQIDD* |
Ga0116218_15587681 | 3300009522 | Peatlands Soil | RARVRTAPARPIGTWTSWAIAMPGADWEEHDEQSVWVEIDD* |
Ga0116221_11170172 | 3300009523 | Peatlands Soil | RTAPARPAGTWTSWAIALPGADWEEHDEQAVWKEIDD* |
Ga0116225_12183252 | 3300009524 | Peatlands Soil | RARVRTAPARPAGTWTSWAIALPGADWEEHDEQAVWEEIDD* |
Ga0116220_100656001 | 3300009525 | Peatlands Soil | LTPGMSVRARVRTAPARPAGTWTSWAIALPGADWEEHDEQAIWQEIDD* |
Ga0116224_104361282 | 3300009683 | Peatlands Soil | LTPGMLVRARVRTAPARPAGTWTSWAIALPGAGWEEHDEQAVWQEIDD* |
Ga0116216_108239331 | 3300009698 | Peatlands Soil | ARVRTAPARPAGTWTSWAIALPGADWEEHDEQAVWEEIDD* |
Ga0116217_102124701 | 3300009700 | Peatlands Soil | PARPAGTWTSWAIALPGAGWEEHDEQAIWQEIDD* |
Ga0116217_103996422 | 3300009700 | Peatlands Soil | SVRARVRTAPAQPAGTWTSWAIALPGAGWEEHDEQAVWEEIDD* |
Ga0105066_10429953 | 3300009822 | Groundwater Sand | RTAPARSIGTWTRWALKVEDGPWEEHDEQSVWIEIDD* |
Ga0116219_101850011 | 3300009824 | Peatlands Soil | VRARVRTAPARPAGTWTSWAIALPGADWEEHDEQAVWEEIDD* |
Ga0116223_103080411 | 3300009839 | Peatlands Soil | VDLTPGLSVRARVRTAPARPAGTWRSWAIALPAADWEKHDEQAVWEEIDD* |
Ga0126384_103120231 | 3300010046 | Tropical Forest Soil | VVRARVRTAPARPIGTWTSWAVALPGTDWEEHDEQAVWQEIDDEQYQEP* |
Ga0074045_102692811 | 3300010341 | Bog Forest Soil | TPGMSVRARVRTALARPAGTWTSWAIALPGAGWEEHDEQAIWEEIDD* |
Ga0136449_1004464341 | 3300010379 | Peatlands Soil | TPGMAVRARVRTAPARPAGTWTSWAIALPGAGWEEHDEQAIWQEIDD* |
Ga0136449_1004702373 | 3300010379 | Peatlands Soil | TAPARPAGTWTSWAVALPGAGWEEHDEQAVWQEIDD* |
Ga0136449_1005123084 | 3300010379 | Peatlands Soil | PARPAGTWTSWAIALPGADWEEHDEQAVWQEIDD* |
Ga0136449_1007493602 | 3300010379 | Peatlands Soil | GMSVRARVRTAPARPAGTWTSWAIALPGADWEEHDEQAVWQEIDD* |
Ga0136449_1019271112 | 3300010379 | Peatlands Soil | ARVRTAPARPVGTWTRWAIAMPGADWEEHDEQSVWEEIDD* |
Ga0136449_1020499431 | 3300010379 | Peatlands Soil | LAPGMSVRARVRTVPARPAGTWTSWAIALPGAGWEEHDEQAVWQEIDD* |
Ga0126350_123294591 | 3300010880 | Boreal Forest Soil | VALPAGTWTSWAIALPGAGWEGHVEQAVWEEIDD* |
Ga0151490_16537922 | 3300011107 | Soil | VRARVRTTPARPAGTWTSWAIALPDADWEKHDEQAVWEEIDD* |
Ga0137368_106706921 | 3300012358 | Vadose Zone Soil | MSVRARVRTTLARPAGTWTSWAIALPGADWEEHDEQAVWEEIDD* |
Ga0157330_10279802 | 3300012514 | Soil | MSVRARVRTAPARPAGTWTSWAIALPGAGWEEHDEQAVWEEIDD* |
Ga0126375_104488731 | 3300012948 | Tropical Forest Soil | PIGTWTSWAVALPGTDWEEHDEQAVWQEIDDEQYQEP* |
Ga0181530_102251972 | 3300014159 | Bog | MVVRARVRTAPAQPAGTWTSWAIALPGADWEEHDEQAIWQEIDD* |
Ga0075360_10917421 | 3300014261 | Natural And Restored Wetlands | MTVRARVRTALARPVGTWTSWAIAMPGAGWEEHDEQAIWVEIDGEV* |
Ga0075351_11086912 | 3300014318 | Natural And Restored Wetlands | MDVRTRVRTAPARPIGTWTSWAIAMPGAGWEEHDEQSVWEEIDD* |
Ga0157376_118232842 | 3300014969 | Miscanthus Rhizosphere | VRARVRTAPARPVGTWTSWAIALPGAEWEEHDEQAVWEEIDD* |
Ga0182034_102524712 | 3300016371 | Soil | VELTPGMAVRARVRTTPAQPAGTWTSWAIALPGADWEEHDEQAIWEEIDD |
Ga0182039_104888821 | 3300016422 | Soil | MAVRARVRTAPARSAGTWTSWAIALPGADWEEHDEQAIWEEIDD |
Ga0182038_107851081 | 3300016445 | Soil | GLTPGMAVRAGVRTALARPAGTWTSWAIALPGADWEEHDEQAIWEEIDD |
Ga0181505_110487491 | 3300016750 | Peatland | NLRVKRRRARVRTAPARPVGTWTSWAIAMPGADWEEHDEQSVWEEIDD |
Ga0187814_102036172 | 3300017932 | Freshwater Sediment | ARVRTAPARPAGTWTSRAIALPGADWEEHDEQAIWQEIND |
Ga0187809_100781911 | 3300017937 | Freshwater Sediment | GMSVRARVRTAPARPAGTWTSWAIALPGADWEEHDEQAIWEEIDD |
Ga0187809_101624652 | 3300017937 | Freshwater Sediment | VRTTLARPAGTWTSWAIALPGADWEEHDEQAIWQEIDD |
Ga0187879_104937361 | 3300017946 | Peatland | RARVRTALARPAGTWTSWAIALPGADWEEHDEQAVWQEIDD |
Ga0187817_103336531 | 3300017955 | Freshwater Sediment | PGMSVRARVRTAPARPAGTWTSWAIALPGAGWEEHDEQAVWKEIDG |
Ga0187817_105322361 | 3300017955 | Freshwater Sediment | RTAPAQPIGTWTSWAIAMPGADWEEHDEQSVWEEIND |
Ga0187783_106846652 | 3300017970 | Tropical Peatland | RTALARPAGTWTSWATALPGADWEEHDEQAIWQEIDD |
Ga0187783_113618451 | 3300017970 | Tropical Peatland | TVVRARVRTALARPAGTWTSWATALPDADWEEHDEQAIWQEIDD |
Ga0187777_113783871 | 3300017974 | Tropical Peatland | IAVRARVRTALARPAGTWTSWATALPGADWEEHDEQAIWQEIED |
Ga0187772_101335193 | 3300018085 | Tropical Peatland | VRTALARPAGTWTSWATALPGADWEEHDEQAVWQEIDD |
Ga0187774_112185171 | 3300018089 | Tropical Peatland | VRTVPARPTGTWTKWAVALPDADWEEHDEQAVWEEIDG |
Ga0187770_105525161 | 3300018090 | Tropical Peatland | RVRTALARPAGTWTSWATALPGADWEEHDEQAVWQEIDD |
Ga0187770_110478652 | 3300018090 | Tropical Peatland | VRARVRTAPARPAGTWTSWGIALPGAGWEEHDEQAVWQEIGD |
Ga0190271_130836461 | 3300018481 | Soil | PGMVVRARVRTALARPAGTWTSWAIAASGADWEEHYEQSVWVEIDDN |
Ga0224564_11142201 | 3300024271 | Soil | VQLTAGMVVRAKVRTAPARPAGTWTSWAVALPGAGWEEHDEQAVWQEIDD |
Ga0208851_10372062 | 3300025461 | Arctic Peat Soil | RARVRTAPAQPIGTWTSWAIALPGADWEEHDEQAVWEEIDD |
Ga0208588_10075804 | 3300025479 | Arctic Peat Soil | MLVRAGVRTTPAQPIGTWTSWAIALPGADWEEHDEQAVWEEIDD |
Ga0207931_10626812 | 3300025499 | Arctic Peat Soil | VRARVRTSPAQPVGTWTSWAIALPGADWEEHDEQAVWDEIDD |
Ga0210120_10479411 | 3300025556 | Natural And Restored Wetlands | DMVVRARVRTALARPIGTWTSWAIAMPGADWEEHDEQSVWVEIDD |
Ga0209748_11220893 | 3300025836 | Arctic Peat Soil | MTVRARVRTSPAQPVGTWTSWAIALPGADWEEHDEQAVWEEIDDD |
Ga0209584_102986873 | 3300025878 | Arctic Peat Soil | VRTTPARPIGTWTSWAIALPGADWEEHDEQAVWQEIDD |
Ga0209839_100464491 | 3300026294 | Soil | TPGMVVRARVRTAPARPVGTWTSWAIALPGADWEEHDEQAVWEEIDD |
Ga0208199_11340191 | 3300027497 | Peatlands Soil | VEIKPGMVVSARVRTAPARPIGTWTSWAVAMPGADWEEHDEQSVWEEIDE |
Ga0208890_10026926 | 3300027523 | Soil | APARPMGTWTRWAIALPGADWEEHDEQSVWEEIDD |
Ga0208042_11489401 | 3300027568 | Peatlands Soil | TPARPAGTWTSWAIALPGADWEEHDEQAVWEEIDD |
Ga0208042_11583981 | 3300027568 | Peatlands Soil | PGMSVRARVRTAPARPAGTWTSWAIALPAADWEKHDEQAVWEEIED |
Ga0209874_10428951 | 3300027577 | Groundwater Sand | VRTAPARSIGTWTRWALKVEDGPWEEHDEQSVWIEIDD |
Ga0208324_10091569 | 3300027604 | Peatlands Soil | ELTPDTVVRARVRTALARPVGTWTRWAIAMPGADWEEHDEQSIWAEIDD |
Ga0208324_12141062 | 3300027604 | Peatlands Soil | RARVRTAPARPIGTWTSWAIAMPGADWEEHDEQSVWVEIDD |
Ga0209048_100175784 | 3300027902 | Freshwater Lake Sediment | PDMVVRARVRTAPARPVGTWTSWAIAMPGADWEEHDEQSVWQEIDD |
Ga0302160_100207381 | 3300028665 | Fen | VDLTPGMTVRARVRTSPAQPVGTWTSWAIALPGADWEEHDEQAVWEEIDDD |
Ga0302258_11000301 | 3300028770 | Fen | PGTDVRARVRTSPAQPVGTWTSWAIALPGADWEEHDEQAVWEEIDD |
Ga0307287_103809811 | 3300028796 | Soil | TAPARPVGTWTSWAIAMPGADWEEHDEQSVWEEIDD |
Ga0302163_100635932 | 3300028868 | Fen | VQARVRTSPAQPIGTWTSWAIALPGADWEEHDEQAVWEEIDDD |
Ga0311337_116611402 | 3300030000 | Fen | GMVARARVRTSPAQPVGTWTSWAIALPGADWEEHDEQAVWEEIDD |
Ga0302287_101636431 | 3300030673 | Fen | GLAPHTVVRARVRTALAHPIGTWTRWAIAMPGADWEEHDEQSVWEEIDD |
Ga0307498_102510762 | 3300031170 | Soil | ARVRTASAQPFGTWTRWAIAMPGADWEEHDEQSVWEEINE |
Ga0307498_103702722 | 3300031170 | Soil | VELTPGTVVRARVRTAPARSAGTWTSWAVALPGADWEEHDEQAVWQEIDD |
Ga0170824_1204677341 | 3300031231 | Forest Soil | KIRTAPAQPIGTWTSWAIALPGAHWEEHDEQAVWQEIDD |
Ga0311364_105122913 | 3300031521 | Fen | MVVRARVRTSPAQPIGTWTNWAIALPGADWEEHDEQAVWEEIDD |
Ga0311364_114363981 | 3300031521 | Fen | ALAHPIGTWTRWAIAMPGADWEEHDEQSVWEEIDD |
Ga0318560_100458373 | 3300031682 | Soil | VRTALARPAGTWTSWATALPGADWEEHDEQAIWQEIDD |
Ga0310686_1088487091 | 3300031708 | Soil | VRAKVRTAPARPAGTWTSWAIALPGADWEEHDEQAVWEEIDD |
Ga0306918_108671072 | 3300031744 | Soil | MAVRAGVRTALARPAGTWTSWAIALPGADWEEHDEQAIWEEIDD |
Ga0318554_104349232 | 3300031765 | Soil | VRTALARPAGTWTSWAIALPGADWEEHDEQAIWEEIDD |
Ga0318547_106653942 | 3300031781 | Soil | MAVRAGVRTALARPAGTWTSWAIALPGADWKEHDEQAIWEEIDD |
Ga0318497_102606373 | 3300031805 | Soil | LTPGMAVRARVRTAPARSAGTWTSWAIALPGADWEEHDEQAIWEEIDD |
Ga0302322_1016579101 | 3300031902 | Fen | RARVRTSPAQPVGTWTSWAIALPGADWEEHDEQAVWEEIDD |
Ga0311367_108674241 | 3300031918 | Fen | VRARVRTSPAQPIGTWTSWAIALPGADWEQHDEQAVWEEIDD |
Ga0318531_103140212 | 3300031981 | Soil | LTPGMVVRARVRTAPARPIGTWTSWAVALPGAGWEEHDEQAVWEEIND |
Ga0318556_102959801 | 3300032043 | Soil | AALAGRTHPGMAVRARVRTALARPAGTWTSWAIALPGADWEEHDEQAIWEEIDD |
Ga0318575_105992793 | 3300032055 | Soil | GMAVRARVRTAPARSAGTWTSWAIALPGADWEEHDEQAIWEEIDD |
Ga0311301_103963992 | 3300032160 | Peatlands Soil | ARVRTAPARPAGTWTSWAIALPGAGWEEHDEQAIWQEIDD |
Ga0311301_124953171 | 3300032160 | Peatlands Soil | GMSVRARVRTAPARPAGTWTSWAIALPGAGWEEHDEQAVWQEIDD |
Ga0315271_104846622 | 3300032256 | Sediment | APARPEGTWTRWAVSMPGADWEEHDEQSVWEEIDDGAGLDA |
Ga0335085_119026501 | 3300032770 | Soil | VPARPMGTWTSWAVSMPGGGWEEHDERSVWEEIED |
Ga0335079_109548972 | 3300032783 | Soil | VRTAPARPVGTWTSWAIAMPGADWEEHDEQSVWEEIDD |
Ga0335078_127125131 | 3300032805 | Soil | VRAKVRTAPARPAGTWTSWAIALPGTDWEEHDEQAVWEEIDD |
Ga0335083_111363742 | 3300032954 | Soil | LTPGMVVRARVRTTPAQPAGTWTSWAIALPDADWEKHDEQAVWEEIDD |
Ga0364943_0454432_1_132 | 3300034354 | Sediment | VVRARVRTAPARPVGTWTSWAIAMPDADWEEHDEQSVWEEIDD |
Ga0370485_0175689_349_483 | 3300034358 | Untreated Peat Soil | MVVQARVRTSPAQPIGTWTSWAIALPGADWEEHDEQAVWEEIDD |
⦗Top⦘ |