NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome Family F083403

Metagenome Family F083403

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F083403
Family Type Metagenome
Number of Sequences 113
Average Sequence Length 47 residues
Representative Sequence MQFCRLYTGNDGKSHFEELDQTEGSEHFLAPLAVKALVFKNDENRDDL
Number of Associated Samples 104
Number of Associated Scaffolds 113

Quality Assessment
Transcriptomic Evidence No
Most common taxonomic group Bacteria
% of genes with valid RBS motifs 87.61 %
% of genes near scaffold ends (potentially truncated) 98.23 %
% of genes from short scaffolds (< 2000 bps) 87.61 %
Associated GOLD sequencing projects 102
AlphaFold2 3D model prediction Yes
3D model pTM-score0.31

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Bacteria (85.841 % of family members)
NCBI Taxonomy ID 2
Taxonomy All Organisms → cellular organisms → Bacteria

Most Common Ecosystem
GOLD Ecosystem Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere
(13.274 % of family members)
Environment Ontology (ENVO) Unclassified
(32.743 % of family members)
Earth Microbiome Project Ontology (EMPO) Host-associated → Plant → Plant rhizosphere
(38.053 % of family members)


 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      

 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Globular Signal Peptide: No Secondary Structure distribution: α-helix: 18.42%    β-sheet: 15.79%    Coil/Unstructured: 65.79%
Feature Viewer
Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer
Per-residue confidence (pLDDT):
  0-50   51-70   71-90   91-100  		pTM-score: 0.31
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.

 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 113 Family Scaffolds
PF13649Methyltransf_25 15.93
PF08241Methyltransf_11 11.50
PF05175MTS 7.96
PF00378ECH_1 6.19
PF12847Methyltransf_18 4.42
PF16576HlyD_D23 2.65
PF12704MacB_PCD 2.65
PF13489Methyltransf_23 1.77
PF13533Biotin_lipoyl_2 1.77
PF12700HlyD_2 0.88
PF00202Aminotran_3 0.88
PF03352Adenine_glyco 0.88
PF00005ABC_tran 0.88

Neighboring Clusters of Orthologous Genes (COGs)

COG IDNameFunctional Category % Frequency in 113 Family Scaffolds
COG28183-methyladenine DNA glycosylase TagReplication, recombination and repair [L] 0.88

 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms86.73 %
UnclassifiedrootN/A13.27 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
3300000559|F14TC_100604253All Organisms → cellular organisms → Bacteria1376Open in IMG/M
3300000559|F14TC_103493182All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium1109Open in IMG/M
3300000955|JGI1027J12803_101896360All Organisms → cellular organisms → Bacteria689Open in IMG/M
3300000955|JGI1027J12803_108018126All Organisms → cellular organisms → Eukaryota → Opisthokonta → Fungi → Dikarya → Basidiomycota644Open in IMG/M
3300001431|F14TB_101999122All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium684Open in IMG/M
3300003994|Ga0055435_10235843All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium535Open in IMG/M
3300003997|Ga0055466_10023726Not Available1355Open in IMG/M
3300003999|Ga0055469_10063023Not Available1000Open in IMG/M
3300005293|Ga0065715_10354828All Organisms → cellular organisms → Bacteria945Open in IMG/M
3300005294|Ga0065705_10181749All Organisms → cellular organisms → Bacteria1573Open in IMG/M
3300005331|Ga0070670_101433397All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium633Open in IMG/M
3300005332|Ga0066388_106005158Not Available613Open in IMG/M
3300005332|Ga0066388_106720168Not Available579Open in IMG/M
3300005337|Ga0070682_101674330All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium552Open in IMG/M
3300005364|Ga0070673_100284435All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium1451Open in IMG/M
3300005450|Ga0066682_10242133All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium1160Open in IMG/M
3300005518|Ga0070699_102217020All Organisms → cellular organisms → Bacteria501Open in IMG/M
3300005546|Ga0070696_101821969All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium526Open in IMG/M
3300005577|Ga0068857_102110173All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium553Open in IMG/M
3300005617|Ga0068859_101902729All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium657Open in IMG/M
3300005718|Ga0068866_11457760All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium502Open in IMG/M
3300006844|Ga0075428_101901275All Organisms → cellular organisms → Bacteria618Open in IMG/M
3300006846|Ga0075430_100918294All Organisms → cellular organisms → Bacteria721Open in IMG/M
3300006847|Ga0075431_100752814All Organisms → cellular organisms → Bacteria949Open in IMG/M
3300006852|Ga0075433_10600964All Organisms → cellular organisms → Bacteria966Open in IMG/M
3300006853|Ga0075420_101661587All Organisms → cellular organisms → Bacteria547Open in IMG/M
3300006894|Ga0079215_11712609All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium503Open in IMG/M
3300006903|Ga0075426_10485600Not Available917Open in IMG/M
3300006904|Ga0075424_102177889All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium584Open in IMG/M
3300006954|Ga0079219_11051441All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium683Open in IMG/M
3300006969|Ga0075419_10114032All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium1746Open in IMG/M
3300007004|Ga0079218_11445288Not Available739Open in IMG/M
3300009078|Ga0105106_10394543All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria998Open in IMG/M
3300009147|Ga0114129_13161556Not Available537Open in IMG/M
3300009156|Ga0111538_11530648All Organisms → cellular organisms → Bacteria841Open in IMG/M
3300009162|Ga0075423_10119392All Organisms → cellular organisms → Bacteria2764Open in IMG/M
3300009162|Ga0075423_12481826Not Available566Open in IMG/M
3300009162|Ga0075423_13037383All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium514Open in IMG/M
3300009168|Ga0105104_10448579Not Available722Open in IMG/M
3300009609|Ga0105347_1169271All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium864Open in IMG/M
3300009610|Ga0105340_1114952All Organisms → cellular organisms → Bacteria1090Open in IMG/M
3300010043|Ga0126380_10474568Not Available953Open in IMG/M
3300010043|Ga0126380_11702979All Organisms → cellular organisms → Bacteria567Open in IMG/M
3300010047|Ga0126382_11272632Not Available663Open in IMG/M
3300010376|Ga0126381_104624397Not Available530Open in IMG/M
3300010399|Ga0134127_10502098All Organisms → cellular organisms → Bacteria1225Open in IMG/M
3300010401|Ga0134121_11616862All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium668Open in IMG/M
3300011427|Ga0137448_1216363All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium531Open in IMG/M
3300011439|Ga0137432_1124766Not Available818Open in IMG/M
3300012200|Ga0137382_10832260All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium665Open in IMG/M
3300012226|Ga0137447_1074351All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium653Open in IMG/M
3300012358|Ga0137368_10095124All Organisms → cellular organisms → Bacteria2329Open in IMG/M
3300012361|Ga0137360_10008926All Organisms → cellular organisms → Bacteria6305Open in IMG/M
3300012485|Ga0157325_1039631All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium507Open in IMG/M
3300012922|Ga0137394_10014569All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria6221Open in IMG/M
3300012929|Ga0137404_10117330All Organisms → cellular organisms → Bacteria2171Open in IMG/M
3300012930|Ga0137407_10058699All Organisms → cellular organisms → Bacteria3156Open in IMG/M
3300012984|Ga0164309_10068215All Organisms → cellular organisms → Bacteria → Proteobacteria2133Open in IMG/M
3300012985|Ga0164308_11129047All Organisms → cellular organisms → Bacteria704Open in IMG/M
3300012989|Ga0164305_11369202All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium622Open in IMG/M
3300014150|Ga0134081_10325004All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium558Open in IMG/M
3300014254|Ga0075312_1152533All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium513Open in IMG/M
3300014304|Ga0075340_1099046All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium584Open in IMG/M
3300014315|Ga0075350_1188430All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium539Open in IMG/M
3300014326|Ga0157380_13489717All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium504Open in IMG/M
3300014873|Ga0180066_1057504All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium775Open in IMG/M
3300014969|Ga0157376_12696349All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium537Open in IMG/M
3300015357|Ga0134072_10364069All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium559Open in IMG/M
3300015373|Ga0132257_103282832All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium589Open in IMG/M
3300015374|Ga0132255_105790198All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium523Open in IMG/M
3300018054|Ga0184621_10215181All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium688Open in IMG/M
3300018076|Ga0184609_10183172All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium973Open in IMG/M
3300018077|Ga0184633_10136580All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium1270Open in IMG/M
3300018077|Ga0184633_10321939All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium785Open in IMG/M
3300018081|Ga0184625_10559168All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium567Open in IMG/M
3300018422|Ga0190265_10070016All Organisms → cellular organisms → Bacteria → Proteobacteria3161Open in IMG/M
3300018429|Ga0190272_13233143All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium508Open in IMG/M
3300018481|Ga0190271_10947544All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium985Open in IMG/M
3300019377|Ga0190264_10713684All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria743Open in IMG/M
3300019377|Ga0190264_11087256All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium650Open in IMG/M
3300020004|Ga0193755_1117586All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium831Open in IMG/M
3300020016|Ga0193696_1172122All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium522Open in IMG/M
3300020060|Ga0193717_1004135All Organisms → cellular organisms → Bacteria7930Open in IMG/M
3300020084|Ga0194110_10924303All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium517Open in IMG/M
3300020197|Ga0194128_10099198All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Azospirillaceae → Azospirillum → Azospirillum lipoferum1813Open in IMG/M
3300021081|Ga0210379_10193447All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium875Open in IMG/M
3300021081|Ga0210379_10413966All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium596Open in IMG/M
3300025318|Ga0209519_10317424Not Available902Open in IMG/M
3300025551|Ga0210131_1084720All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium544Open in IMG/M
3300025900|Ga0207710_10765232All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium507Open in IMG/M
3300026044|Ga0208287_1001270All Organisms → cellular organisms → Bacteria2764Open in IMG/M
3300026095|Ga0207676_10520968All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium1132Open in IMG/M
3300026315|Ga0209686_1035397All Organisms → cellular organisms → Bacteria → Proteobacteria1896Open in IMG/M
3300026343|Ga0209159_1020115All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria3778Open in IMG/M
3300026538|Ga0209056_10032547All Organisms → cellular organisms → Bacteria → Proteobacteria4896Open in IMG/M
3300027209|Ga0209875_1042850All Organisms → cellular organisms → Bacteria546Open in IMG/M
3300027843|Ga0209798_10445220All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium600Open in IMG/M
3300027880|Ga0209481_10226177All Organisms → cellular organisms → Bacteria938Open in IMG/M
3300027907|Ga0207428_11103011All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium555Open in IMG/M
3300028587|Ga0247828_10544949All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria698Open in IMG/M
3300028884|Ga0307308_10569710All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium543Open in IMG/M
3300030006|Ga0299907_10025394All Organisms → cellular organisms → Bacteria → Proteobacteria4529Open in IMG/M
3300031562|Ga0310886_10949847All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium549Open in IMG/M
3300031720|Ga0307469_10816371All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium857Open in IMG/M
3300031740|Ga0307468_100805567All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium802Open in IMG/M
3300031901|Ga0307406_11067041All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria696Open in IMG/M
3300031947|Ga0310909_10588812All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium930Open in IMG/M
3300031965|Ga0326597_11279926All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium718Open in IMG/M
3300032000|Ga0310903_10440292All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium671Open in IMG/M
3300032002|Ga0307416_100063616All Organisms → cellular organisms → Bacteria → Proteobacteria3022Open in IMG/M
3300032003|Ga0310897_10082380Not Available1241Open in IMG/M
3300033513|Ga0316628_100639346All Organisms → cellular organisms → Bacteria1390Open in IMG/M
3300034147|Ga0364925_0274977All Organisms → cellular organisms → Bacteria628Open in IMG/M


 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
Populus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere13.27%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil12.39%
SoilEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Soil5.31%
Vadose Zone SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil5.31%
Groundwater SedimentEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment4.42%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Soil4.42%
Natural And Restored WetlandsEnvironmental → Aquatic → Marine → Wetlands → Unclassified → Natural And Restored Wetlands3.54%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil3.54%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural → Soil3.54%
Natural And Restored WetlandsEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Natural And Restored Wetlands3.54%
SoilEnvironmental → Terrestrial → Soil → Loam → Grasslands → Soil3.54%
Agricultural SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil2.65%
Freshwater SedimentEnvironmental → Aquatic → Freshwater → Sediment → Unclassified → Freshwater Sediment1.77%
Groundwater SedimentEnvironmental → Aquatic → Freshwater → Sediment → Unclassified → Groundwater Sediment1.77%
Freshwater LakeEnvironmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake1.77%
Terrestrial SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil1.77%
Grasslands SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil1.77%
Hardwood Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil1.77%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil1.77%
Corn, Switchgrass And Miscanthus RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere1.77%
Arabidopsis RhizosphereHost-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere1.77%
Switchgrass RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere1.77%
RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere1.77%
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere1.77%
Wetland SedimentEnvironmental → Aquatic → Freshwater → Wetlands → Unclassified → Wetland Sediment0.89%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil0.89%
Switchgrass RhizosphereEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Switchgrass Rhizosphere0.89%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil0.89%
SoilEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Soil0.89%
Corn RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere0.89%
Groundwater SandEnvironmental → Terrestrial → Soil → Sand → Unclassified → Groundwater Sand0.89%
SedimentEnvironmental → Terrestrial → Floodplain → Sediment → Unclassified → Sediment0.89%
Miscanthus RhizosphereHost-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Miscanthus Rhizosphere0.89%
Corn RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere0.89%
Miscanthus RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere0.89%
Arabidopsis RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Arabidopsis Rhizosphere0.89%
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere0.89%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere0.89%
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere0.89%

Visualization
Powered by ApexCharts



Associated Samples

Taxon OIDSample NameHabitat TypeIMG/M Link
3300000559Amended soil microbial communities from Kansas Great Prairies, USA - control no BrdU total DNA F1.4 TC clc assemlyEnvironmentalOpen in IMG/M
3300000955Soil microbial communities from Great Prairies - Iowa, Native Prairie soilEnvironmentalOpen in IMG/M
3300001431Amended soil microbial communities from Kansas Great Prairies, USA - BrdU F1.4TB clc assemlyEnvironmentalOpen in IMG/M
3300003994Wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - Browns_ThreeSqA_D2EnvironmentalOpen in IMG/M
3300003997Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - MayberryNW_CattailC_D1EnvironmentalOpen in IMG/M
3300003999Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - MayberryNW_TuleA_D2EnvironmentalOpen in IMG/M
3300005293Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1Host-AssociatedOpen in IMG/M
3300005294Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 Bulk SoilEnvironmentalOpen in IMG/M
3300005331Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaGHost-AssociatedOpen in IMG/M
3300005332Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly)EnvironmentalOpen in IMG/M
3300005337Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaGEnvironmentalOpen in IMG/M
3300005364Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaGHost-AssociatedOpen in IMG/M
3300005450Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_131EnvironmentalOpen in IMG/M
3300005518Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaGEnvironmentalOpen in IMG/M
3300005546Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaGEnvironmentalOpen in IMG/M
3300005577Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2Host-AssociatedOpen in IMG/M
3300005617Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2Host-AssociatedOpen in IMG/M
3300005718Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2Host-AssociatedOpen in IMG/M
3300006844Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2Host-AssociatedOpen in IMG/M
3300006846Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4Host-AssociatedOpen in IMG/M
3300006847Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5Host-AssociatedOpen in IMG/M
3300006852Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2Host-AssociatedOpen in IMG/M
3300006853Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD4Host-AssociatedOpen in IMG/M
3300006894Agricultural soil microbial communities from Utah to study Nitrogen management - NC ControlEnvironmentalOpen in IMG/M
3300006903Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD5Host-AssociatedOpen in IMG/M
3300006904Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD3Host-AssociatedOpen in IMG/M
3300006954Agricultural soil microbial communities from Georgia to study Nitrogen management - GA ControlEnvironmentalOpen in IMG/M
3300006969Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD3Host-AssociatedOpen in IMG/M
3300007004Agricultural soil microbial communities from Utah to study Nitrogen management - NC CompostEnvironmentalOpen in IMG/M
3300009078Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P8 Core (1) Depth 10-12cm September2015EnvironmentalOpen in IMG/M
3300009147Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2)Host-AssociatedOpen in IMG/M
3300009156Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD1 (version 2)Host-AssociatedOpen in IMG/M
3300009162Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD2Host-AssociatedOpen in IMG/M
3300009168Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (6) Depth 19-21cm September2015EnvironmentalOpen in IMG/M
3300009609Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMLT890EnvironmentalOpen in IMG/M
3300009610Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMLT700EnvironmentalOpen in IMG/M
3300010043Tropical forest soil microbial communities from Panama - MetaG Plot_26EnvironmentalOpen in IMG/M
3300010047Tropical forest soil microbial communities from Panama - MetaG Plot_30EnvironmentalOpen in IMG/M
3300010376Tropical forest soil microbial communities from Panama - MetaG Plot_28EnvironmentalOpen in IMG/M
3300010399Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-3EnvironmentalOpen in IMG/M
3300010401Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-1EnvironmentalOpen in IMG/M
3300011427Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMGT418_2EnvironmentalOpen in IMG/M
3300011439Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMZT820_2EnvironmentalOpen in IMG/M
3300012200Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_20_16 metaGEnvironmentalOpen in IMG/M
3300012226Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMGT400_2EnvironmentalOpen in IMG/M
3300012358Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_100_16 metaGEnvironmentalOpen in IMG/M
3300012361Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_60_16 metaGEnvironmentalOpen in IMG/M
3300012485Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.7.old.040610Host-AssociatedOpen in IMG/M
3300012922Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czobulk1.16 metaGEnvironmentalOpen in IMG/M
3300012929Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_16fungal (Illumina Assembly)EnvironmentalOpen in IMG/M
3300012930Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_2_16fungal (Illumina Assembly)EnvironmentalOpen in IMG/M
3300012984Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_247_MGEnvironmentalOpen in IMG/M
3300012985Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_246_MGEnvironmentalOpen in IMG/M
3300012989Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_237_MGEnvironmentalOpen in IMG/M
3300014150Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Met_20cm_5_24_1 metaGEnvironmentalOpen in IMG/M
3300014254Natural and restored wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - MayberryNE_CattailB_D2EnvironmentalOpen in IMG/M
3300014304Natural and restored wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - RushMan_ThreeSqA_D1EnvironmentalOpen in IMG/M
3300014315Natural and restored wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - RushSE_TuleC_D1EnvironmentalOpen in IMG/M
3300014326Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaGHost-AssociatedOpen in IMG/M
3300014873Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River metaG ERMLT200B_16_10DEnvironmentalOpen in IMG/M
3300014969Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaGHost-AssociatedOpen in IMG/M
3300015357Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_20cm_5_0_1 metaGEnvironmentalOpen in IMG/M
3300015373Combined assembly of cpr5 rhizosphereHost-AssociatedOpen in IMG/M
3300015374Col-0 rhizosphere combined assemblyHost-AssociatedOpen in IMG/M
3300018054Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_30_b1EnvironmentalOpen in IMG/M
3300018076Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_60_coexEnvironmentalOpen in IMG/M
3300018077Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3-1_170_b1EnvironmentalOpen in IMG/M
3300018081Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3_30_b1EnvironmentalOpen in IMG/M
3300018422Populus adjacent soil microbial communities from riparian zone of Indian Creek, Utah, USA - 124 TEnvironmentalOpen in IMG/M
3300018429Populus adjacent soil microbial communities from riparian zone of Shoshone River, Wyoming, USA - 504 TEnvironmentalOpen in IMG/M
3300018481Populus adjacent soil microbial communities from riparian zone of Weber River, Utah, USA - 356 TEnvironmentalOpen in IMG/M
3300019377Populus adjacent soil microbial communities from riparian zone of Indian Creek, Utah, USA - 112 TEnvironmentalOpen in IMG/M
3300020004Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? H1a2EnvironmentalOpen in IMG/M
3300020016Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? L3m1EnvironmentalOpen in IMG/M
3300020060Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U2c2EnvironmentalOpen in IMG/M
3300020084Freshwater microbial communities from Lake Tanganyika, Tanzania - TA2015032 Kigoma Deep Cast 1200mEnvironmentalOpen in IMG/M
3300020197Freshwater microbial communities from Lake Tanganyika, Tanzania - TA2015037 Kigoma Deep Cast 65mEnvironmentalOpen in IMG/M
3300021081Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM4_32_coex redoEnvironmentalOpen in IMG/M
3300025318Soil microbial communities from Rifle, Colorado, USA - sediment 13ft 1EnvironmentalOpen in IMG/M
3300025551Wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - Browns_ThreeSqA_D2 (SPAdes)EnvironmentalOpen in IMG/M
3300025900Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300026044Natural and restored wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - MayberryNE_CattailB_D1 (SPAdes)EnvironmentalOpen in IMG/M
3300026095Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300026315Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_126 (SPAdes)EnvironmentalOpen in IMG/M
3300026343Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_144 (SPAdes)EnvironmentalOpen in IMG/M
3300026538Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_114 (SPAdes)EnvironmentalOpen in IMG/M
3300027209Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW S3_0_10 (SPAdes)EnvironmentalOpen in IMG/M
3300027843Wetland sediment microbial communities from St. Louis River estuary, USA, under dissolved organic matter induced mercury methylation - T4Bare3Fresh (SPAdes)EnvironmentalOpen in IMG/M
3300027880Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD3 (SPAdes)Host-AssociatedOpen in IMG/M
3300027907Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes)Host-AssociatedOpen in IMG/M
3300028587Soil microbial communities from agricultural site in Penn Yan, New York, United States - 12C_Control_Day3EnvironmentalOpen in IMG/M
3300028884Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_195EnvironmentalOpen in IMG/M
3300030006Soil microbial communities from uranium-contaminated site in the Upper Colorado River Basin, Wyoming, United States - RVT152D67EnvironmentalOpen in IMG/M
3300031562Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T60D3EnvironmentalOpen in IMG/M
3300031720Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM2C_515EnvironmentalOpen in IMG/M
3300031740Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gases AM2C_05EnvironmentalOpen in IMG/M
3300031901Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2Host-AssociatedOpen in IMG/M
3300031947Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.T000HEnvironmentalOpen in IMG/M
3300031965Soil microbial communities from uranium-contaminated site in the Upper Colorado River Basin, Wyoming, United States - RVT100D185EnvironmentalOpen in IMG/M
3300032000Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C0D3EnvironmentalOpen in IMG/M
3300032002Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3Host-AssociatedOpen in IMG/M
3300032003Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C0D1EnvironmentalOpen in IMG/M
3300033513Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_Aug_M2_C1_D5_CEnvironmentalOpen in IMG/M
3300034147Sediment microbial communities from East River floodplain, Colorado, United States - 44_j17EnvironmentalOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap


 ⦗Top⦘

Family Sequences

Protein ID Sample Taxon ID Habitat Sequence
F14TC_10060425333300000559SoilMQLCRLYTGPDGKSHFEDLDQNQGSQHFLNTLPAKALVFKNDMNRDDLHGWHPAP
F14TC_10349318213300000559SoilMQFCRIYTGADGKSHFEDFDQTQGARHFLTALDVKTLVFKNDMNREDLHGWHNAPRRQ
JGI1027J12803_10189636023300000955SoilMQFCRLYTGNDGKSHFEELDQTEGSEHFLAPLAVKALVFKND
JGI1027J12803_10801812613300000955SoilMQMYRLYMGNDGKSHFEELDQAEGSNHFLAPLAVKALVFKND
F14TB_10199912213300001431SoilMQFCRIYTGEDGKSHFEDLDQSQGSKHFLENLPVKTLVFKNDMNRD
Ga0055435_1023584323300003994Natural And Restored WetlandsMQFCRLYTGADGKSHFEELDQKEGSKFFLTAITPKSLVFKN
Ga0055466_1002372613300003997Natural And Restored WetlandsMKFCRIYTGADGQSHFEDLPQTAGSKHFLTDLSVKTLVFKNDTHRDDLRGWH
Ga0055469_1006302313300003999Natural And Restored WetlandsMQFCRLYTGADGKSHFEELNQNEGAREFMKEHPAGALVFKNDKLRDD
Ga0065715_1035482813300005293Miscanthus RhizosphereMQFCRMYTGADGKSHFEELDQQEGSKFFLTAITSKALVFKNDLNRDDLHG
Ga0065705_1018174913300005294Switchgrass RhizosphereMQFCRLYTGNDGKSHFEELDQADGSKHFLAPLVVKALVFKNDKNRDDLLGWHTAP
Ga0070670_10143339723300005331Switchgrass RhizosphereMQFCRMYTGDDGKSHFQELDQTQGSEFFLSTIAAKALVFKNDDNR
Ga0066388_10600515813300005332Tropical Forest SoilMQFCRLYTGKDGKSHFEELDQAEGSPHFLKPFTVKNLVFKNDKNREDLLGWH
Ga0066388_10672016813300005332Tropical Forest SoilMHFCRLYTGNDGKSHFEELDQADGSSHFLAPLTVKTLVFKND
Ga0070682_10167433013300005337Corn RhizosphereMQFCRLYTGDDRRSHFEDLDQTEGSKHFLATLPAKALVFKNDSNRDDLHGWHTAPRRQWC
Ga0070673_10028443513300005364Switchgrass RhizosphereLQFCRLYTGDDGRSHFEDLDQTAGSKHFLATLPVKALVFKNDT
Ga0066682_1024213313300005450SoilMQFCRIYTGGDGKSHFEELDQREGSKFFLTSLAVKALVFKNDMN
Ga0070699_10221702013300005518Corn, Switchgrass And Miscanthus RhizosphereLQIVYGNDGKSHFEELDQTEGSEHFLAPLAVKALVFKNDENRDDL
Ga0070696_10182196923300005546Corn, Switchgrass And Miscanthus RhizosphereMQFCRIYTGADGKSHFEDLDQTQGAKHFLTGLDVKTLVFKNDMNR
Ga0068857_10211017323300005577Corn RhizosphereLQFCRLYTGDDGRSHFEDLDQSAGSKHFLATLPVKTLVFKN
Ga0068859_10190272913300005617Switchgrass RhizosphereMQFCRMYTGEDGKSHFEELEQQQGAKSFDSRIDAKTLV
Ga0068866_1145776023300005718Miscanthus RhizosphereMQFCRMYTGDDGESHFEELDQNEGSKFFLTIITPKALVFKNDMNRDDLHGWHNAPR
Ga0075428_10190127513300006844Populus RhizosphereMQFCRLYTGDDDKSHFEELDQQESSKHFAAAVTAKALAFKNDQNRDDLLGWHTAPRRQW
Ga0075430_10091829413300006846Populus RhizosphereMQFCRLYTGNDGQSHFEELDQAEGSKHFLAPLVVKTLVFKNDKNREDLLGWHTA
Ga0075431_10075281413300006847Populus RhizosphereMQFCRMYTGEDGKSHFEELDQQQGSKFFLTTITPKALVFKNDMNRDDLHGWHNAPRRQWC
Ga0075433_1060096423300006852Populus RhizosphereMQFCRMYTGADGKSHFEELDQQEGSKYFLTTITPKALVFKNDMNRDDLHGWHNAPRRQWC
Ga0075420_10166158723300006853Populus RhizosphereMQFCRLYTGDDGKSHFEELDQAESSKYFSTPLMVKALVFKNDK
Ga0079215_1171260913300006894Agricultural SoilMQFCRMYSGADGKSHFEELDQDAGSKLFSNSLPVKALVFKNDDNRDILG
Ga0075426_1048560013300006903Populus RhizosphereMQFCRIYSGADGKSHFEDFDQDQGSKYFLSALDVKTLVFKNDMNR
Ga0075424_10217788913300006904Populus RhizosphereMQFCRLYTGDDGQSYFEDFDQGEGSKHFLTNLSVKALVFKND
Ga0079219_1105144113300006954Agricultural SoilLQFCRLYTGHDGRSHFEDLDQSAGSKHFLATLPVKALVFKNDTNRD
Ga0075419_1011403223300006969Populus RhizosphereMQFCRLYTGDDGKSHFEELDQAESSKYFSTPLMVKALVFKNDKTVTIS*
Ga0079218_1144528813300007004Agricultural SoilMQFCRLYTGNDGKSHFEDLEQQEGSLHFLADQQATALVFKNDVLRSDLHAYHNAPRRQ
Ga0105106_1039454313300009078Freshwater SedimentMYTGDDGRSHFEELDQTEGSRFFLGAIAAKALVFK
Ga0114129_1316155613300009147Populus RhizosphereMQFCRLYTGNDGRSHFEQLDQAEGSKHFLAPLVVKALVFKNDKNREDLLG
Ga0111538_1153064813300009156Populus RhizosphereMEFCRLYTGNDGQSHFEELDQAEGSKHFLAPLVVKALVFKNDKNREDLLGWHTAPRRQ
Ga0075423_1011939213300009162Populus RhizosphereMQFCRIYTGEDGKSHFEDLDQSEGSKHFLENLPVKTLVFKNDMN
Ga0075423_1248182613300009162Populus RhizosphereMQFCRLYTGDDRRSHFEDLDQTEGSKHLLATLPAKALVLKDDSKRHDLNGWKSAP
Ga0075423_1303738313300009162Populus RhizosphereMQFCRLYTGDDGKSHFEELDQAESSAHFSTPLMVKALIFKNDKNRDDLL
Ga0105104_1044857923300009168Freshwater SedimentMQFCRLYTGNDGKSHFEELDQADGSKHFLAPLTVKTLVFK
Ga0105347_116927113300009609SoilMYTGDDGKSHFEELDQTQGSKFFLSTIASKALVFKNDDNRDILGW
Ga0105340_111495213300009610SoilMYTGADGKSHFEELDQQGGSKFFLTTITPKALVFK
Ga0126380_1047456813300010043Tropical Forest SoilMHFCRLYTGNDGQSHFEELDQAEGSPHFLKPFTVKNLVFKNDKNREDLLGWHT
Ga0126380_1170297913300010043Tropical Forest SoilMQFCRLYTGKDGKSHFEELDQAEGSPHFLKPFTVKNLVFKNDKNREDLLGWHT
Ga0126382_1127263213300010047Tropical Forest SoilLYTGNDGQSHFEELDQAEGSPHFLKPFTVKNLVFKNDKNREDLLGWHTA
Ga0126381_10462439723300010376Tropical Forest SoilMQFCRLYTGKDGKSHFEELDQAEGSPHFLKPFTVKNLVFKNDKNREDLLGWHTA
Ga0134127_1050209813300010399Terrestrial SoilMYTGADGKSHFEELDQQEGSKFFLTAITSKALVFK
Ga0134121_1161686213300010401Terrestrial SoilMQFCRIYTGADGKSHFEDFDQNQGAKHFLTGLDVKTLVFKNDMNREDLHGWHNAPRRQ
Ga0137448_121636313300011427SoilMYTGDDGKSHFEELDQSEGAKLFQSALAVKALMFKNDQN
Ga0137432_112476613300011439SoilMQFCRLYTGDDDRSHFEELDQQEGSKHFAAPFAVKALAFKNDKNRGDLLGWHTAPR
Ga0137382_1083226013300012200Vadose Zone SoilMKLCRLYTGEDGKSHFEDLDQSEGSKYFLATLACKALVFKNDTN
Ga0137447_107435113300012226SoilMQFCRLYTGADGKSHFEELDQKQGSKFFLTTITPKALVFKNDFNRDDLHGWHNA
Ga0137368_1009512433300012358Vadose Zone SoilMQFCRIYTGEDGKSHFEDLDQSEGSKHFLRSLPVKALVF
Ga0137360_1000892613300012361Vadose Zone SoilMQFCRLYTGNDGKSHFEELDQTEGSEHFLAPLAVKALVFKNDENRDDL
Ga0157325_103963123300012485Arabidopsis RhizosphereMQFCRIYTGADGKSHFEDFDQNQGAKHFLTGLDVKTLVFKNDMNREDLH
Ga0137394_1001456983300012922Vadose Zone SoilMQFCRLYTGNDGKSHFAELDQAESSEHFLAPLAVRTLVFKNDKNRDD
Ga0137404_1011733013300012929Vadose Zone SoilMQFCRIYTGADGKSHFEDFDQNQGAKHFLTGLDVKTLVFKNDMNREDLHGWHNAPRRQWCIT
Ga0137407_1005869913300012930Vadose Zone SoilMQFCRIYTGKDDKSHFEDFDQSEGSKHFLTNLSVKTLVFKNDTNRD
Ga0164309_1006821513300012984SoilMQFCRLYTGDDRRSHFEDLDQTEGSKHFLATLPAKALVFKNDSNRDDLHGW
Ga0164308_1112904713300012985SoilMQFCRLYTGDDRRSHFEDLDQTEGSKHFLATLPAKALVFKN
Ga0164305_1136920213300012989SoilMQFCRIYSGADGKSHFEDFDQNQGAKHFLTGLDVKT
Ga0134081_1032500423300014150Grasslands SoilMQFCRIYTGGDGKSHFEELDQREGSKFFLTSLAVKALVFK
Ga0075312_115253313300014254Natural And Restored WetlandsMAELNLGDHMKFCRIYTGADGQSHFEDLPQTAGSKHFLTDLSVKTLVFKNDTHRDDLRGWHNAPRRQWCIT
Ga0075340_109904623300014304Natural And Restored WetlandsMYTGDDGKSHFEQLDQTQGSQFFLSTIAAKALVFKNDDNRDI
Ga0075350_118843023300014315Natural And Restored WetlandsMYTGDDGKSHFEQLDQTQGSQFFLSTIAAKALVFKNDDNRDILGWHNAP
Ga0157380_1348971713300014326Switchgrass RhizosphereMYTGDDGKSHFEELDQAQGSQFFLSTIGAKALVFKN
Ga0180066_105750423300014873SoilMYTGDDGKSHFEELDQSEGAKLFQSALAVKALMFKNDQNRDDLHGW
Ga0157376_1269634923300014969Miscanthus RhizosphereMQFCRLYTGPDGKSHFEDLDQSQGSKYFLNAIQSKAAMFKNDTNRDDLHGWHN
Ga0134072_1036406923300015357Grasslands SoilMQFCRIYTGGDGKSHFEELDQREGSKFFLTSLAVKAL
Ga0132257_10328283223300015373Arabidopsis RhizosphereMQFCRLYTGPDGKSHFEDLDQSQGSKYFLNAIQSKAAMFKNDTNRDDLHGW
Ga0132255_10579019813300015374Arabidopsis RhizosphereMYTGDDGKSHFEELDQNEGSKFFLTIITPKALVFKNDMHRDDLHGWHNAPRRQWCI
Ga0184621_1021518113300018054Groundwater SedimentMQFCRLYTGDDGKSHFEDLAQTDGSKYFLKNLSAKTLVFKNDMNRDDLHGW
Ga0184609_1018317213300018076Groundwater SedimentMQFCRLFTGADGKSHFEDLDQSQGSKHFLTALAVKALVFKNDTNRDDL
Ga0184633_1013658023300018077Groundwater SedimentMQFCRLYTGADGKSHFEDLDQSQGSKYFLTALAVKALVFKNDTNRDDLHGWHTAPRRQWC
Ga0184633_1032193923300018077Groundwater SedimentMQFCRLYTGADGKSHFEELDQTEGSKFFLTAITPKA
Ga0184625_1055916813300018081Groundwater SedimentMQFCRIYTGADLKSHFEELDQKEGGQFFLTNITAKTLVFKNDLNRDDLHGWHNAPRRQWCITLS
Ga0190265_1007001613300018422SoilMQFCRMYTGDDGKSHFEELEQDAGSKLFSNSLPVKALVFKNDENPDIL
Ga0190272_1323314323300018429SoilMQFCRMYTGVDRKSHFEELDQTQGGKFFLSTLAAKALVFKN
Ga0190271_1094754443300018481SoilMQFCRMYTGSDGKSHFEELDQTPGGKSFLSTLAAKALVFKNDQ
Ga0190264_1071368413300019377SoilMQFCRMYTGDDGKSRFEELEQNVGSQFFLNSLPVKALV
Ga0190264_1108725613300019377SoilMQFCRMYTGNDGKSHFEELDQQLGSSFFLSRINTKALVF
Ga0193755_111758613300020004SoilMQFCRIYTGADGKSYFEDFDQNQGAKHFLTGLDVKTLVFKNDMNREDLHGWHNAPR
Ga0193696_117212223300020016SoilMQFCRIYTGADGKSHFEDFDQNQGAKHFLTGLDVKTLVFKNDMNREDL
Ga0193717_100413513300020060SoilMQFCRMYTGEDGKSHFEELEQQQGAKSFDSRIAAKTLVFKND
Ga0194110_1092430323300020084Freshwater LakeMQFCRMYTGADGKSHFEDLDQSLASEFFLKAINAKA
Ga0194128_1009919813300020197Freshwater LakeMHFCRLYTGNDGQSHFEELDQQEGAEFFLSTIPAKALKFKNDKNRDDLHGWHNAPRR
Ga0210379_1019344713300021081Groundwater SedimentMQFCRLYTGDDGKSHFEELDQKEGSKFFLTTITPKALVFKNDFNRDD
Ga0210379_1041396613300021081Groundwater SedimentMQFCRLYTGDDGKSHFEDLDQSQGSKHFLTALSVKALVFKNDVNRDDLHGWYNAPRPQWCITLS
Ga0209519_1031742423300025318SoilMQFCRIYTGDDGQSHFEDLPQTEESKHFLTHLSVKTLVFKNDTHRDDLHGWHNAPRRQWC
Ga0210131_108472013300025551Natural And Restored WetlandsMQFCRLYTGADGKSHFEELDQKEGSKFFLTAITPKSLVFKNDMN
Ga0207710_1076523223300025900Switchgrass RhizosphereMQFCRLYTGPDGKSHFEDLDQSQGSKYFLNAIQSKAAMFKNDTNRDDLHGWHTAPR
Ga0208287_100127043300026044Natural And Restored WetlandsMAELNLGDHMKFCRIYTGADGQSHFEDLPQTAGSKHFLTDLSVKTLVFKND
Ga0207676_1052096833300026095Switchgrass RhizosphereMQFCRMYTGEDGKSHFEELEQQQGAKSFDSRIDVKTLVFKNDDNRDILGWH
Ga0209686_103539733300026315SoilMQFCRIYTGGDGKSHFEELDQREGSKFFLTSLAVK
Ga0209159_102011553300026343SoilMQFCRIYTGGDGKSHFEELDQREGSKFFLTSLAVKALVFKNDMNREDLHGWHTAPRRQ
Ga0209056_1003254713300026538SoilMQFCRIYTGGDGKSYFEELDQREGSKFFLTSLAVK
Ga0209875_104285013300027209Groundwater SandMQFCRLYTGNDGKSHFEALDQAEGSKHFLAPLTVKTLVFKNDQNREDLLGWHTAPRRQWCIT
Ga0209798_1044522013300027843Wetland SedimentMQFCRMYTGDDGKSHFEELDQNQGAKFFLTTINAKGLVFKNDDNKD
Ga0209481_1022617723300027880Populus RhizosphereMQFCRLYTGDDGKSHFEELDQAESSKYFSTPLMVKALVFKNDKTVTIS
Ga0207428_1110301113300027907Populus RhizosphereMEFCRLYTGNDGQSHFEELDQAEGSKHFLAPLVVKALVFKNDKNREDLLGWHTAPRRQW
Ga0247828_1054494913300028587SoilMQFCRMYSGADGKSHFEELDQDAASKLFSNSLPVKALVFKN
Ga0307308_1056971023300028884SoilMQFCRLYTGDDGQSYFEDFDQGEGSKHFLTNLSVKALVFKNDMNRDDLHGWHPAPRR
Ga0299907_1002539413300030006SoilMQFCRIYTGDDGQSHFEDLPQSEGSKHFLTNLPVKALVFKNDTARDDLS
Ga0310886_1094984713300031562SoilMQFCRMYSGADGKSHFEELDQDAGSKLFSNSLPVKA
Ga0307469_1081637123300031720Hardwood Forest SoilMQFCRLYTGDDGQSYFEDFDQGEGSKHFLTNLSVKALVFKN
Ga0307468_10080556723300031740Hardwood Forest SoilMQFCRIYTGADGKSHFEDFDQTQGAKHFLTGLDVK
Ga0307406_1106704123300031901RhizosphereMQFCRMYTGDDGKSHFEELEQTAASKFFFTSLPAKALVFKNDENRDILGWHN
Ga0310909_1058881213300031947SoilMQFCRLYTGADGRSHFEDLDQTEGSRHFLATLPAK
Ga0326597_1127992613300031965SoilMHFCRLYTGDDGQSHFEELDQKEGSKFFLTTITPKALV
Ga0310903_1044029223300032000SoilMQFCRMYTGDDGKSHFEELDQTQGSQFFLSTIAAKALVFKNDDNRDILGW
Ga0307416_10006361653300032002RhizosphereMQFCRMYTGDDGKSHFEELEQTAASKFFFTSLPAKALV
Ga0310897_1008238013300032003SoilMQFCRLYTGDDRRSHFEDLDQTEGSKHFLATLPAKALVFKNDSNRDDLHGWHT
Ga0316628_10063934633300033513SoilMLFCRLFTGDDDKSHFEDLDQSPSSTYFLSALPSKALVFKNDMNRDDLHGFHNA
Ga0364925_0274977_3_1343300034147SedimentMQFCRMYTGADGKSHFEELDQQEGSKFFLTTITPKALVFKNDLN

 ⦗Top⦘


Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.