NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome / Metatranscriptome Family F083397

Metagenome / Metatranscriptome Family F083397

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F083397
Family Type Metagenome / Metatranscriptome
Number of Sequences 113
Average Sequence Length 89 residues
Representative Sequence MRVLDSLTRLREKAKLKEDLINILETPQGKRFFTVLLRECHVTKPVFHSDEAKLRECEGRRRLAMSFLTLLGQDDPQELINKIEMENK
Number of Associated Samples 86
Number of Associated Scaffolds 113

Quality Assessment
Transcriptomic Evidence Yes
Most common taxonomic group Bacteria
% of genes with valid RBS motifs 5.31 %
% of genes near scaffold ends (potentially truncated) 14.16 %
% of genes from short scaffolds (< 2000 bps) 43.36 %
Associated GOLD sequencing projects 78
AlphaFold2 3D model prediction Yes
3D model pTM-score0.67

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Bacteria (81.416 % of family members)
NCBI Taxonomy ID 2
Taxonomy All Organisms → cellular organisms → Bacteria

Most Common Ecosystem
GOLD Ecosystem Environmental → Aquatic → Marine → Oceanic → Unclassified → Marine
(28.319 % of family members)
Environment Ontology (ENVO) Unclassified
(67.257 % of family members)
Earth Microbiome Project Ontology (EMPO) Free-living → Saline → Water (saline)
(92.920 % of family members)


 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      

 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Globular Signal Peptide: No Secondary Structure distribution: α-helix: 60.34%    β-sheet: 0.00%    Coil/Unstructured: 39.66%
Feature Viewer
Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer
Per-residue confidence (pLDDT):
  0-50   51-70   71-90   91-100  		pTM-score: 0.67
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.

 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 113 Family Scaffolds
PF12236Head-tail_con 65.49
PF00899ThiF 1.77
PF01612DNA_pol_A_exo1 0.88
PF00149Metallophos 0.88
PF10492Nrf1_activ_bdg 0.88
PF03237Terminase_6N 0.88
PF05497Destabilase 0.88
PF08774VRR_NUC 0.88
PF00271Helicase_C 0.88
PF13361UvrD_C 0.88


 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms98.23 %
UnclassifiedrootN/A1.77 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
3300000101|DelMOSum2010_c10117344All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sneathiellales → Sneathiellaceae → Sneathiella → unclassified Sneathiella → Sneathiella sp.1057Open in IMG/M
3300000115|DelMOSum2011_c10006450All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sneathiellales → Sneathiellaceae → Sneathiella → unclassified Sneathiella → Sneathiella sp.6680Open in IMG/M
3300000116|DelMOSpr2010_c10011837All Organisms → Viruses → Predicted Viral4487Open in IMG/M
3300000116|DelMOSpr2010_c10039468All Organisms → Viruses → Predicted Viral2139Open in IMG/M
3300000117|DelMOWin2010_c10002562All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sneathiellales → Sneathiellaceae → Sneathiella → unclassified Sneathiella → Sneathiella sp.11491Open in IMG/M
3300000127|SA_S1_NOR05_45mDRAFT_c10097911All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sneathiellales → Sneathiellaceae → Sneathiella → unclassified Sneathiella → Sneathiella sp.665Open in IMG/M
3300000128|SA_S1_NOR08_45mDRAFT_c10144432All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sneathiellales → Sneathiellaceae → Sneathiella → unclassified Sneathiella → Sneathiella sp.695Open in IMG/M
3300001450|JGI24006J15134_10001409All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sneathiellales → Sneathiellaceae → Sneathiella → unclassified Sneathiella → Sneathiella sp.13708Open in IMG/M
3300001460|JGI24003J15210_10046524All Organisms → Viruses → Predicted Viral1470Open in IMG/M
3300001947|GOS2218_1042586All Organisms → Viruses → Predicted Viral2464Open in IMG/M
3300002482|JGI25127J35165_1000091All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sneathiellales → Sneathiellaceae → Sneathiella → unclassified Sneathiella → Sneathiella sp.41667Open in IMG/M
3300002483|JGI25132J35274_1011378All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sneathiellales → Sneathiellaceae → Sneathiella → unclassified Sneathiella → Sneathiella sp.2185Open in IMG/M
3300002483|JGI25132J35274_1012607All Organisms → Viruses → Predicted Viral2068Open in IMG/M
3300002488|JGI25128J35275_1001510All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sneathiellales → Sneathiellaceae → Sneathiella → unclassified Sneathiella → Sneathiella sp.6918Open in IMG/M
3300004097|Ga0055584_100461887Not Available1318Open in IMG/M
3300004448|Ga0065861_1007388All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sneathiellales → Sneathiellaceae → Sneathiella → unclassified Sneathiella → Sneathiella sp.3953Open in IMG/M
3300004448|Ga0065861_1026020All Organisms → cellular organisms → Bacteria6847Open in IMG/M
3300004448|Ga0065861_1179998All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sneathiellales → Sneathiellaceae → Sneathiella → unclassified Sneathiella → Sneathiella sp.620Open in IMG/M
3300004457|Ga0066224_1032380All Organisms → Viruses → Predicted Viral3684Open in IMG/M
3300004457|Ga0066224_1177208All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sneathiellales → Sneathiellaceae → Sneathiella → unclassified Sneathiella → Sneathiella sp.1614Open in IMG/M
3300004461|Ga0066223_1021855All Organisms → Viruses → Predicted Viral1939Open in IMG/M
3300004461|Ga0066223_1225327All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sneathiellales → Sneathiellaceae → Sneathiella → unclassified Sneathiella → Sneathiella sp.624Open in IMG/M
3300005433|Ga0066830_10034271All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sneathiellales → Sneathiellaceae → Sneathiella → unclassified Sneathiella → Sneathiella sp.1021Open in IMG/M
3300005510|Ga0066825_10192369All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sneathiellales → Sneathiellaceae → Sneathiella → unclassified Sneathiella → Sneathiella sp.752Open in IMG/M
3300005941|Ga0070743_10041078All Organisms → Viruses → Predicted Viral1584Open in IMG/M
3300006752|Ga0098048_1016683All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sneathiellales → Sneathiellaceae → Sneathiella → unclassified Sneathiella → Sneathiella sp.2505Open in IMG/M
3300006793|Ga0098055_1052505All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sneathiellales → Sneathiellaceae → Sneathiella → unclassified Sneathiella → Sneathiella sp.1642Open in IMG/M
3300006919|Ga0070746_10185292All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sneathiellales → Sneathiellaceae → Sneathiella → unclassified Sneathiella → Sneathiella sp.998Open in IMG/M
3300007539|Ga0099849_1000708All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sneathiellales → Sneathiellaceae → Sneathiella → unclassified Sneathiella → Sneathiella sp.15428Open in IMG/M
3300007539|Ga0099849_1005273All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sneathiellales → Sneathiellaceae → Sneathiella → unclassified Sneathiella → Sneathiella sp.5916Open in IMG/M
3300007540|Ga0099847_1109316All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sneathiellales → Sneathiellaceae → Sneathiella → unclassified Sneathiella → Sneathiella sp.838Open in IMG/M
3300009003|Ga0102813_1008276All Organisms → Viruses → Predicted Viral4168Open in IMG/M
3300009076|Ga0115550_1008399All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sneathiellales → Sneathiellaceae → Sneathiella → unclassified Sneathiella → Sneathiella sp.5747Open in IMG/M
3300009080|Ga0102815_10010748All Organisms → cellular organisms → Bacteria5204Open in IMG/M
3300009124|Ga0118687_10013974All Organisms → Viruses → Predicted Viral2626Open in IMG/M
3300009544|Ga0115006_11459230All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sneathiellales → Sneathiellaceae → Sneathiella → unclassified Sneathiella → Sneathiella sp.618Open in IMG/M
3300009606|Ga0115102_10102195All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sneathiellales → Sneathiellaceae → Sneathiella → unclassified Sneathiella → Sneathiella sp.1166Open in IMG/M
3300009606|Ga0115102_10613861All Organisms → Viruses → Predicted Viral3558Open in IMG/M
3300009705|Ga0115000_10046790All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sneathiellales → Sneathiellaceae → Sneathiella → unclassified Sneathiella → Sneathiella sp.2974Open in IMG/M
3300010149|Ga0098049_1089200All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sneathiellales → Sneathiellaceae → Sneathiella → unclassified Sneathiella → Sneathiella sp.968Open in IMG/M
3300010149|Ga0098049_1194056All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sneathiellales → Sneathiellaceae → Sneathiella → unclassified Sneathiella → Sneathiella sp.623Open in IMG/M
3300010296|Ga0129348_1027786Not Available2059Open in IMG/M
3300010297|Ga0129345_1187256All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sneathiellales → Sneathiellaceae → Sneathiella → unclassified Sneathiella → Sneathiella sp.738Open in IMG/M
3300011253|Ga0151671_1092009All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sneathiellales → Sneathiellaceae → Sneathiella → unclassified Sneathiella → Sneathiella sp.1650Open in IMG/M
3300017697|Ga0180120_10347843All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sneathiellales → Sneathiellaceae → Sneathiella → unclassified Sneathiella → Sneathiella sp.587Open in IMG/M
3300017706|Ga0181377_1004274All Organisms → Viruses → Predicted Viral3957Open in IMG/M
3300017709|Ga0181387_1005346All Organisms → Viruses → Predicted Viral2525Open in IMG/M
3300017714|Ga0181412_1022453All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sneathiellales → Sneathiellaceae → Sneathiella → unclassified Sneathiella → Sneathiella sp.1753Open in IMG/M
3300017720|Ga0181383_1177229All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sneathiellales → Sneathiellaceae → Sneathiella → unclassified Sneathiella → Sneathiella sp.569Open in IMG/M
3300017724|Ga0181388_1176287All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sneathiellales → Sneathiellaceae → Sneathiella → unclassified Sneathiella → Sneathiella sp.506Open in IMG/M
3300017728|Ga0181419_1006694All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sneathiellales → Sneathiellaceae → Sneathiella → unclassified Sneathiella → Sneathiella sp.3518Open in IMG/M
3300017733|Ga0181426_1092086All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sneathiellales → Sneathiellaceae → Sneathiella → unclassified Sneathiella → Sneathiella sp.608Open in IMG/M
3300017735|Ga0181431_1000294All Organisms → cellular organisms → Bacteria16577Open in IMG/M
3300017738|Ga0181428_1009743All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sneathiellales → Sneathiellaceae → Sneathiella → unclassified Sneathiella → Sneathiella sp.2196Open in IMG/M
3300017740|Ga0181418_1001651All Organisms → cellular organisms → Bacteria7101Open in IMG/M
3300017742|Ga0181399_1149343All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sneathiellales → Sneathiellaceae → Sneathiella → unclassified Sneathiella → Sneathiella sp.562Open in IMG/M
3300017745|Ga0181427_1002010All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sneathiellales → Sneathiellaceae → Sneathiella → unclassified Sneathiella → Sneathiella sp.5096Open in IMG/M
3300017757|Ga0181420_1053169All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sneathiellales → Sneathiellaceae → Sneathiella → unclassified Sneathiella → Sneathiella sp.1295Open in IMG/M
3300017779|Ga0181395_1019038All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sneathiellales → Sneathiellaceae → Sneathiella → unclassified Sneathiella → Sneathiella sp.2358Open in IMG/M
3300017779|Ga0181395_1092878All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sneathiellales → Sneathiellaceae → Sneathiella → unclassified Sneathiella → Sneathiella sp.969Open in IMG/M
3300017782|Ga0181380_1002424All Organisms → cellular organisms → Bacteria7891Open in IMG/M
3300017782|Ga0181380_1107533All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sneathiellales → Sneathiellaceae → Sneathiella → unclassified Sneathiella → Sneathiella sp.965Open in IMG/M
3300017782|Ga0181380_1250881All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sneathiellales → Sneathiellaceae → Sneathiella → unclassified Sneathiella → Sneathiella sp.587Open in IMG/M
3300018080|Ga0180433_10006951All Organisms → cellular organisms → Bacteria14617Open in IMG/M
3300020175|Ga0206124_10188125All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sneathiellales → Sneathiellaceae → Sneathiella → unclassified Sneathiella → Sneathiella sp.819Open in IMG/M
3300020347|Ga0211504_1000489All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria20247Open in IMG/M
3300020440|Ga0211518_10020108All Organisms → Viruses → Predicted Viral4254Open in IMG/M
3300020469|Ga0211577_10000632All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sneathiellales → Sneathiellaceae → Sneathiella → unclassified Sneathiella → Sneathiella sp.35510Open in IMG/M
3300020469|Ga0211577_10002301All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sneathiellales → Sneathiellaceae → Sneathiella → unclassified Sneathiella → Sneathiella sp.17846Open in IMG/M
3300021335|Ga0213867_1000694All Organisms → cellular organisms → Bacteria15028Open in IMG/M
3300021335|Ga0213867_1154221All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sneathiellales → Sneathiellaceae → Sneathiella → unclassified Sneathiella → Sneathiella sp.786Open in IMG/M
3300021356|Ga0213858_10002480All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sneathiellales → Sneathiellaceae → Sneathiella → unclassified Sneathiella → Sneathiella sp.8720Open in IMG/M
3300021356|Ga0213858_10008086All Organisms → Viruses → Predicted Viral4965Open in IMG/M
3300021373|Ga0213865_10017176All Organisms → Viruses → Predicted Viral4103Open in IMG/M
3300021379|Ga0213864_10023297All Organisms → Viruses → Predicted Viral2833Open in IMG/M
3300021389|Ga0213868_10056849All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sneathiellales → Sneathiellaceae → Sneathiella → unclassified Sneathiella → Sneathiella sp.2682Open in IMG/M
3300021389|Ga0213868_10501597All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sneathiellales → Sneathiellaceae → Sneathiella → unclassified Sneathiella → Sneathiella sp.652Open in IMG/M
3300021425|Ga0213866_10014192All Organisms → Viruses → Predicted Viral4827Open in IMG/M
3300021425|Ga0213866_10061809All Organisms → Viruses → Predicted Viral2101Open in IMG/M
3300021425|Ga0213866_10494207All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sneathiellales → Sneathiellaceae → Sneathiella → unclassified Sneathiella → Sneathiella sp.584Open in IMG/M
3300021957|Ga0222717_10001279All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sneathiellales → Sneathiellaceae → Sneathiella → unclassified Sneathiella → Sneathiella sp.20782Open in IMG/M
3300021957|Ga0222717_10166739All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sneathiellales → Sneathiellaceae → Sneathiella → unclassified Sneathiella → Sneathiella sp.1329Open in IMG/M
3300021959|Ga0222716_10019768All Organisms → cellular organisms → Bacteria5004Open in IMG/M
(restricted) 3300023210|Ga0233412_10294682All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sneathiellales → Sneathiellaceae → Sneathiella → unclassified Sneathiella → Sneathiella sp.716Open in IMG/M
3300024228|Ga0228633_1003992All Organisms → cellular organisms → Bacteria4482Open in IMG/M
3300024417|Ga0228650_1083874All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sneathiellales → Sneathiellaceae → Sneathiella → unclassified Sneathiella → Sneathiella sp.882Open in IMG/M
3300025070|Ga0208667_1033504All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sneathiellales → Sneathiellaceae → Sneathiella → unclassified Sneathiella → Sneathiella sp.903Open in IMG/M
3300025071|Ga0207896_1000025All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria40911Open in IMG/M
3300025079|Ga0207890_1016110All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sneathiellales → Sneathiellaceae → Sneathiella → unclassified Sneathiella → Sneathiella sp.1493Open in IMG/M
3300025120|Ga0209535_1001489All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sneathiellales → Sneathiellaceae → Sneathiella → unclassified Sneathiella → Sneathiella sp.15897Open in IMG/M
3300025120|Ga0209535_1056291All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sneathiellales → Sneathiellaceae → Sneathiella → unclassified Sneathiella → Sneathiella sp.1638Open in IMG/M
3300025127|Ga0209348_1000117All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sneathiellales → Sneathiellaceae → Sneathiella → unclassified Sneathiella → Sneathiella sp.50803Open in IMG/M
3300025127|Ga0209348_1006820All Organisms → cellular organisms → Bacteria4799Open in IMG/M
3300025132|Ga0209232_1000174All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sneathiellales → Sneathiellaceae → Sneathiella → unclassified Sneathiella → Sneathiella sp.40565Open in IMG/M
3300025132|Ga0209232_1002406All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sneathiellales → Sneathiellaceae → Sneathiella → unclassified Sneathiella → Sneathiella sp.9312Open in IMG/M
3300025132|Ga0209232_1190148All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sneathiellales → Sneathiellaceae → Sneathiella → unclassified Sneathiella → Sneathiella sp.632Open in IMG/M
3300025151|Ga0209645_1059250All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sneathiellales → Sneathiellaceae → Sneathiella → unclassified Sneathiella → Sneathiella sp.1320Open in IMG/M
3300025151|Ga0209645_1098386All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sneathiellales → Sneathiellaceae → Sneathiella → unclassified Sneathiella → Sneathiella sp.952Open in IMG/M
3300025168|Ga0209337_1007509All Organisms → cellular organisms → Bacteria7201Open in IMG/M
3300025674|Ga0208162_1000248All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sneathiellales → Sneathiellaceae → Sneathiella → unclassified Sneathiella → Sneathiella sp.31510Open in IMG/M
3300025674|Ga0208162_1007231All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sneathiellales → Sneathiellaceae → Sneathiella → unclassified Sneathiella → Sneathiella sp.4940Open in IMG/M
3300026136|Ga0208763_1042361All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sneathiellales → Sneathiellaceae → Sneathiella → unclassified Sneathiella → Sneathiella sp.673Open in IMG/M
3300027687|Ga0209710_1104556All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sneathiellales → Sneathiellaceae → Sneathiella → unclassified Sneathiella → Sneathiella sp.1110Open in IMG/M
3300027753|Ga0208305_10006539All Organisms → cellular organisms → Bacteria5028Open in IMG/M
3300027791|Ga0209830_10314883All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sneathiellales → Sneathiellaceae → Sneathiella → unclassified Sneathiella → Sneathiella sp.690Open in IMG/M
(restricted) 3300027861|Ga0233415_10002529All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sneathiellales → Sneathiellaceae → Sneathiella → unclassified Sneathiella → Sneathiella sp.7753Open in IMG/M
3300027883|Ga0209713_10060951All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sneathiellales → Sneathiellaceae → Sneathiella → unclassified Sneathiella → Sneathiella sp.2557Open in IMG/M
3300029448|Ga0183755_1004312All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sneathiellales → Sneathiellaceae → Sneathiella → unclassified Sneathiella → Sneathiella sp.6866Open in IMG/M
3300029448|Ga0183755_1006727All Organisms → cellular organisms → Bacteria5062Open in IMG/M
3300029448|Ga0183755_1036591All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sneathiellales → Sneathiellaceae → Sneathiella → unclassified Sneathiella → Sneathiella sp.1375Open in IMG/M
3300029792|Ga0183826_1002987All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sneathiellales → Sneathiellaceae → Sneathiella → unclassified Sneathiella → Sneathiella sp.3182Open in IMG/M
3300032212|Ga0316207_10005901All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sneathiellales → Sneathiellaceae → Sneathiella → unclassified Sneathiella → Sneathiella sp.9938Open in IMG/M
3300032277|Ga0316202_10393601All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sneathiellales → Sneathiellaceae → Sneathiella → unclassified Sneathiella → Sneathiella sp.648Open in IMG/M

Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).


 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
MarineEnvironmental → Aquatic → Marine → Oceanic → Unclassified → Marine28.32%
SeawaterEnvironmental → Aquatic → Marine → Strait → Unclassified → Seawater15.04%
SeawaterEnvironmental → Aquatic → Marine → Coastal → Unclassified → Seawater11.50%
MarineEnvironmental → Aquatic → Marine → Unclassified → Unclassified → Marine8.85%
MarineEnvironmental → Aquatic → Marine → Coastal → Unclassified → Marine6.19%
AqueousEnvironmental → Aquatic → Marine → Coastal → Unclassified → Aqueous5.31%
MarineEnvironmental → Aquatic → Marine → Neritic Zone → Unclassified → Marine4.42%
Freshwater To Marine Saline GradientEnvironmental → Aquatic → Marine → Coastal → Unclassified → Freshwater To Marine Saline Gradient2.65%
EstuarineEnvironmental → Aquatic → Marine → Intertidal Zone → Estuary → Estuarine2.65%
Estuarine WaterEnvironmental → Aquatic → Marine → Unclassified → Unclassified → Estuarine Water2.65%
SeawaterEnvironmental → Aquatic → Marine → Inlet → Unclassified → Seawater1.77%
Microbial MatEnvironmental → Aquatic → Marine → Coastal → Sediment → Microbial Mat1.77%
MarineEnvironmental → Aquatic → Marine → Intertidal Zone → Sediment → Marine1.77%
MarineEnvironmental → Aquatic → Marine → Coastal → Unclassified → Marine0.89%
MarineEnvironmental → Aquatic → Marine → Intertidal Zone → Unclassified → Marine0.89%
EstuarineEnvironmental → Aquatic → Marine → Unclassified → Unclassified → Estuarine0.89%
Pelagic MarineEnvironmental → Aquatic → Marine → Pelagic → Unclassified → Pelagic Marine0.89%
SeawaterEnvironmental → Aquatic → Marine → Pelagic → Unclassified → Seawater0.89%
Pelagic MarineEnvironmental → Aquatic → Marine → Neritic Zone → Unclassified → Pelagic Marine0.89%
Hypersaline Lake SedimentEnvironmental → Aquatic → Non-Marine Saline And Alkaline → Hypersaline → Sediment → Hypersaline Lake Sediment0.89%
SedimentEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Sediment0.89%

Visualization
Powered by ApexCharts



Associated Samples

Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).

Taxon OIDSample NameHabitat TypeIMG/M Link
3300000101Marine microbial communities from Delaware Coast, sample from Delaware MO Early Summer May 2010EnvironmentalOpen in IMG/M
3300000115Marine microbial communities from Delaware Coast, sample from Delaware MO Summer July 2011EnvironmentalOpen in IMG/M
3300000116Marine microbial communities from Delaware Coast, sample from Delaware MO Spring March 2010EnvironmentalOpen in IMG/M
3300000117Marine microbial communities from Delaware Coast, sample from Delaware MO Winter December 2010EnvironmentalOpen in IMG/M
3300000127Marine microbial communities from chronically polluted sediments in Adventfjord, Norway - Svalbard Archipelago station 1 sample NOR 05_45mEnvironmentalOpen in IMG/M
3300000128Marine microbial communities from chronically polluted sediments in Adventfjord, Norway : sample - Svalbard Archipelago station 1 sample NOR 08_45mEnvironmentalOpen in IMG/M
3300001450Marine viral communities from the Pacific Ocean - LP-53EnvironmentalOpen in IMG/M
3300001460Marine viral communities from the Pacific Ocean - LP-28EnvironmentalOpen in IMG/M
3300001947Marine microbial communities from the Gulf of Maine, Canada - GS002EnvironmentalOpen in IMG/M
3300002482Marine viral communities from the Pacific Ocean - ETNP_2_30EnvironmentalOpen in IMG/M
3300002483Marine viral communities from the Pacific Ocean - ETNP_6_30EnvironmentalOpen in IMG/M
3300002488Marine viral communities from the Pacific Ocean - ETNP_2_60EnvironmentalOpen in IMG/M
3300004097Pelagic marine sediment microbial communities from the LTER site Helgoland, North Sea, for post-phytoplankton bloom and carbon turnover studies - OSD3 (Helgoland) metaGEnvironmentalOpen in IMG/M
3300004448Marine viral communities from Newfoundland, Canada BC-1EnvironmentalOpen in IMG/M
3300004457Marine viral communities from Newfoundland, Canada MC-1EnvironmentalOpen in IMG/M
3300004461Marine viral communities from Newfoundland, Canada BC-2EnvironmentalOpen in IMG/M
3300005433Marine microbial and viral communities from oxygen minimum zone, Eastern Pacific Ocean - ETNP201306PF45BEnvironmentalOpen in IMG/M
3300005510Marine microbial and viral communities from oxygen minimum zone, Eastern Pacific Ocean - ETNP201306SV45EnvironmentalOpen in IMG/M
3300005941Estuarine microbial communities from the Columbia River estuary, USA - metaG S.697EnvironmentalOpen in IMG/M
3300006752Marine viral communities from the Subarctic Pacific Ocean - 13_ETSP_OMZ_AT15268 metaGEnvironmentalOpen in IMG/M
3300006793Marine viral communities from the Subarctic Pacific Ocean - 17_ETSP_OMZ_AT15314 metaGEnvironmentalOpen in IMG/M
3300006919Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Mar_21EnvironmentalOpen in IMG/M
3300007539Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1508_1M Viral MetaGEnvironmentalOpen in IMG/M
3300007540Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1504_2 Viral MetaGEnvironmentalOpen in IMG/M
3300009003Estuarine microbial communities from the Columbia River estuary - Flood tide ETM metaG S.725EnvironmentalOpen in IMG/M
3300009076Pelagic marine microbial communities from North Sea - COGITO_mtgs_100511EnvironmentalOpen in IMG/M
3300009080Estuarine microbial communities from the Columbia River estuary - Ebb tide ETM metaG S.759EnvironmentalOpen in IMG/M
3300009124Marine sediment microbial communities from methane seeps within Hudson Canyon, US Atlantic Margin - Hudson Canyon PC-16 72 cmbsfEnvironmentalOpen in IMG/M
3300009544Marine eukaryotic phytoplankton communities from Arctic Ocean - Arctic Ocean- Svalbard ARC20M MetagenomeEnvironmentalOpen in IMG/M
3300009606Marine eukaryotic communities from Pacific Ocean to study complex ecological interactions - MBTS_5May14_M2_3um Metatranscriptome (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300009705Marine microbial communities from western Arctic Ocean - ArcticOcean_MG_CB8_128EnvironmentalOpen in IMG/M
3300010149Marine viral communities from the Subarctic Pacific Ocean - 13B_ETSP_OMZ_AT15268_CsCl metaGEnvironmentalOpen in IMG/M
3300010296Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Sum_27_0.8_DNAEnvironmentalOpen in IMG/M
3300010297Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Sum_20_0.8_DNAEnvironmentalOpen in IMG/M
3300011253Seawater microbial communities from Japan Sea near Toyama Prefecture, Japan - 2014_2, permeateEnvironmentalOpen in IMG/M
3300017697Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Spr_31_0.2_DNA (version 2)EnvironmentalOpen in IMG/M
3300017706Marine viral communities from the Subarctic Pacific Ocean - Lowphox_13 viral metaGEnvironmentalOpen in IMG/M
3300017709Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 10 SPOT_SRF_2010-04-27EnvironmentalOpen in IMG/M
3300017714Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 35 SPOT_SRF_2012-08-15EnvironmentalOpen in IMG/M
3300017720Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 6 SPOT_SRF_2009-12-23EnvironmentalOpen in IMG/M
3300017724Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 11 SPOT_SRF_2010-05-17EnvironmentalOpen in IMG/M
3300017728Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 42 SPOT_SRF_2013-04-24EnvironmentalOpen in IMG/M
3300017733Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 49 SPOT_SRF_2013-12-23EnvironmentalOpen in IMG/M
3300017735Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 54 SPOT_SRF_2014-05-21EnvironmentalOpen in IMG/M
3300017738Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 51 SPOT_SRF_2014-02-12EnvironmentalOpen in IMG/M
3300017740Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 41 SPOT_SRF_2013-03-13EnvironmentalOpen in IMG/M
3300017742Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 22 SPOT_SRF_2011-05-21EnvironmentalOpen in IMG/M
3300017745Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 50 SPOT_SRF_2014-01-15EnvironmentalOpen in IMG/M
3300017757Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 43 SPOT_SRF_2013-05-22EnvironmentalOpen in IMG/M
3300017779Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 18 SPOT_SRF_2010-12-16EnvironmentalOpen in IMG/M
3300017782Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 3 SPOT_SRF_2009-08-19EnvironmentalOpen in IMG/M
3300018080Hypersaline lake sediment archaeal communities from the Salton Sea, California, USA - SS_1_D_1 metaGEnvironmentalOpen in IMG/M
3300020175Pelagic subsurface seawater microbial communities from Kabeltonne, Helgoland, North Sea - Helgoland_Spring_Bloom_20160321_2EnvironmentalOpen in IMG/M
3300020347Marine microbial communities from Tara Oceans - TARA_B100000497 (ERX556109-ERR598994)EnvironmentalOpen in IMG/M
3300020440Marine microbial communities from Tara Oceans - TARA_E500000178 (ERX555952-ERR599043)EnvironmentalOpen in IMG/M
3300020469Marine microbial communities from Tara Oceans - TARA_B100001093 (ERX555967-ERR599052)EnvironmentalOpen in IMG/M
3300021335Coastal seawater microbial communities near Pivers Island, North Carolina, United States - PICO540EnvironmentalOpen in IMG/M
3300021356Coastal seawater microbial communities near Pivers Island, North Carolina, United States - PICO245EnvironmentalOpen in IMG/M
3300021373Coastal seawater microbial communities near Pivers Island, North Carolina, United States - PICO282EnvironmentalOpen in IMG/M
3300021379Coastal seawater microbial communities near Pivers Island, North Carolina, United States - PICO247EnvironmentalOpen in IMG/M
3300021389Coastal seawater microbial communities near Pivers Island, North Carolina, United States - PICO127EnvironmentalOpen in IMG/M
3300021425Coastal seawater microbial communities near Pivers Island, North Carolina, United States - PICO284EnvironmentalOpen in IMG/M
3300021957Estuarine water microbial communities from San Francisco Bay, California, United States - C33_18DEnvironmentalOpen in IMG/M
3300021959Estuarine water microbial communities from San Francisco Bay, California, United States - C33_13DEnvironmentalOpen in IMG/M
3300023210 (restricted)Seawater microbial communities from Saanich Inlet, British Columbia, Canada - Na_anoxic_4_MGEnvironmentalOpen in IMG/M
3300024228Seawater microbial communities from Monterey Bay, California, United States - 41DEnvironmentalOpen in IMG/M
3300024417Seawater microbial communities from Monterey Bay, California, United States - 62DEnvironmentalOpen in IMG/M
3300025070Marine viral communities from the Subarctic Pacific Ocean - 11B_ETSP_OMZ_AT15265_CsCl metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025071Marine viral communities from the Pacific Ocean - LP-36 (SPAdes)EnvironmentalOpen in IMG/M
3300025079Marine viral communities from the Pacific Ocean - LP-48 (SPAdes)EnvironmentalOpen in IMG/M
3300025120Marine viral communities from the Pacific Ocean - LP-28 (SPAdes)EnvironmentalOpen in IMG/M
3300025127Marine viral communities from the Pacific Ocean - ETNP_2_30 (SPAdes)EnvironmentalOpen in IMG/M
3300025132Marine viral communities from the Pacific Ocean - ETNP_2_60 (SPAdes)EnvironmentalOpen in IMG/M
3300025151Marine viral communities from the Pacific Ocean - ETNP_6_30 (SPAdes)EnvironmentalOpen in IMG/M
3300025168Marine viral communities from the Pacific Ocean - LP-53 (SPAdes)EnvironmentalOpen in IMG/M
3300025674Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1508_1M Viral MetaG (SPAdes)EnvironmentalOpen in IMG/M
3300026136Marine microbial and viral communities from oxygen minimum zone, Eastern Pacific Ocean - ETNP201306PF45B (SPAdes)EnvironmentalOpen in IMG/M
3300027687Marine microbial communities from western Arctic Ocean - ArcticOcean_MG_CB4_138 (SPAdes)EnvironmentalOpen in IMG/M
3300027753Estuarine microbial communities from the Columbia River estuary - Flood tide ETM metaG S.741 (SPAdes)EnvironmentalOpen in IMG/M
3300027791Marine microbial communities from western Arctic Ocean - ArcticOcean_MG_CB8_130 (SPAdes)EnvironmentalOpen in IMG/M
3300027861 (restricted)Seawater microbial communities from Saanich Inlet, British Columbia, Canada - Na_anoxic_12_MGEnvironmentalOpen in IMG/M
3300027883Marine eukaryotic phytoplankton communities from Arctic Ocean - Arctic Ocean- Svalbard ARC20M Metagenome (SPAdes)EnvironmentalOpen in IMG/M
3300029448Marine viral communities collected during Tara Oceans survey from station TARA_023 - TARA_E500000082EnvironmentalOpen in IMG/M
3300029792Marine giant viral communities collected during Tara Oceans survey from station TARA_041 - TARA_Y100000052EnvironmentalOpen in IMG/M
3300032212Microbial mat bacterial communities from mineral coupon in-situ incubated in ocean water Damariscotta River, Maine, United States - 6-week pyriteEnvironmentalOpen in IMG/M
3300032277Microbial mat bacterial communities from mineral coupon in-situ incubated in ocean water Damariscotta River, Maine, United States - 3-month pyrrhotiteEnvironmentalOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap


 ⦗Top⦘

Family Sequences

Note: Some of these sequences are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).

Protein ID Sample Taxon ID Habitat Sequence
DelMOSum2010_1011734423300000101MarineMRVLDSLSKLREKAKLKEDLTNIIETPQGKRFFKVLLRECHVTKPVFHSDEAKLRECEGRRRLAMSFLTLLGQDDPQELINKIEMENK*
DelMOSum2011_1000645013300000115MarineMSLLNSLDKLRKKAQLKEDLINILETPHGQRFFKVLLRECHVTKPVFHTEESKLRECEGRRRLAMSFLTLLGQDDPQELINRLEMENK*
DelMOSpr2010_1001183743300000116MarineMLKNIERLRKKAQLRNDLQSILSTPEGTRFFKVLLRECHVTKPVFHSDSTKLRECEGRRRLAMSFLNLLAEDDPQHLINKIELENNE*
DelMOSpr2010_1003946823300000116MarineMKVMDSLGRLREKSQLRNDLINILETPAGQRFFSILLRECHVTKPVFHTDEAKLRECEGRRRLAMSFLTLIGQDDPQQLINKLELENKKNV*
DelMOWin2010_1000256263300000117MarineMSLLNSLDKLRKKAQLKEDLINILETPHGQRFFKVLLRECHVTKPVFHAEESKLRECEGRRRLAMSFLTLLGQDDPQELINRLEMENK*
SA_S1_NOR05_45mDRAFT_1009791113300000127MarineMSLLNSLDKLRKKAQLKEDLIHILETPQGQRFFKVLLRECHVTKPVFHTEESKLRECEGRRRLAMSFLTLLGQDDPQELINRLEMENK*
SA_S1_NOR08_45mDRAFT_1014443223300000128MarineMLDKAVDAFARLRKRGELRDDLSKILETPEGQRFFKVFLRECHVTKPVFHSDENKLRECEGRRRLAMSFLTLLGQDDPHQMINIIEQEKHD*
JGI24006J15134_1000140983300001450MarineMNLNVMNLKRLRKKARLKEDLTQILNTQEGVRFFAVLLRECHVTKPVFHSDEAKLRESEGRRRLAMSFLNLLAEDDPQQLISKIEQENQNDE*
JGI24003J15210_1004652423300001460MarineMKLRNLDQLKDRASLRNDLVAILETKPGQRFFNVLLRECHVTKPVFHSDTNKLREAEGRRRLAMSFLNLIGEDDPQQIINRIELENNE*
GOS2218_104258623300001947MarineMNLNGMNLKRLRKKARLKEDLTQILSTQEGARFFAVLLRECHVTKPVFHSDEAKLRESEGRRRLAMSFLNLLAEDDPQQLISKIEQENQNDE*
JGI25127J35165_1000091413300002482MarineMRVLDSLTKLREKAKLKEDLINILETPHGKRFFTVLLRECHVTKPVFHSDEAKLRECEGRRRLAMSFLTLLGQDDPQELINKIEMENK*
JGI25132J35274_101137823300002483MarineMKLHLMNLKRLRKKAQLREDLIQILETPEGKRFFAVLLKECHVTKPVFHSEESKLRESEGRRRLAMSFLNLLAEDDPQQLISKIEQENQNDE*
JGI25132J35274_101260713300002483MarineYNMNLHLMNLKRLRKKAQLREDLTQILNTPEGKRFFAVLLRECHVTKPVFHSEESKLRESEGRRRLAMSFLNLLAEDDPQQLISKIEQENQNDE*
JGI25128J35275_100151033300002488MarineMLDKAVDAVARLRQRGELRDDLNTILSTPEGKRFFKVLLKECHVTKPVFHSDTNKLRESEGRRRLAMSFLSLLGQDDPHQLINIIEQGNHD*
Ga0055584_10046188723300004097Pelagic MarineMLDKAVDAFARLRQRGELRDDLNKILETPEGQRFFKVFLKECHVTKPVFHSDVNKLRECEGRRRLAMSFLSLLGQDDPHQLINIIEQENHD*
Ga0065861_100738823300004448MarineMAGKNPMQRLITKRQLKEDLTNILETPEGKRFFEVLLRECHVTRPVFHSDDAKLREAEGRRRFAMSLLTLVSQDNPQALIERLEKEAQ*
Ga0065861_102602033300004448MarineMLDKAVDAYARLRQRGELRDDLNTILSTPEGKRFFKVFLKECHVTKPVFHSDNNKLRECEGRRRLAMSFLSLMGQDDPHKLINIIEQENHD*
Ga0065861_117999823300004448MarineMNLDGLNLKRLRKKAQLKNDLTQILTTSAGVRFFDVLLRECHVTKPVFHSDEAKLRESEGRRRLAMSFLNLLAEDDPQRLISKIEQENQNE*
Ga0066224_103238023300004457MarineVVQKVIQSVARLKERGELRDDLLKILDTPEGERFFRILLRECHVTKPVFHSDDAKLRECEGRRRLAMSFLSLLGQDDPQQIINRLGEEHNV*
Ga0066224_117720823300004457MarineMAGKNPMQRLITKRQLKEDLTNILETPEGKRFFEVLLRECQVTRPVFHSDDAKLREAEGRRRFAMSLLTLVSQDNPQALIERLEKEAQ*
Ga0066223_102185533300004461MarineMRVLDSLSRLRGKAQLKEDLINILETPQGTRFFAVLLRECHVTKPVFHSDEAKLRECEGRRRLAMSFLTLLGQDDPQELINKIEMENK*
Ga0066223_122532713300004461MarineMNLDGLNLKRLRKKAQLKNDLTQILTTSAGVRFFDVLLRECHVTKPVFHSDEAKLRESEGRRRLAMSFLNLLAEDDPQRLISKIEQE
Ga0066830_1003427113300005433MarineMNLKRLRKKAQLREDLIQILETPEGKRFFAVLLKECHVTKPVFHSEESKLRESEGRRRLAMSFLNLLAEDDPQQLISKIEQE
Ga0066825_1019236923300005510MarineMNLHLMNLKRLRKKAQLREDLTQILNTPEGKRFFAVLLRECHVTKPVFHSEESKLRESEGRRRLAMSFLNLLAE
Ga0070743_1004107823300005941EstuarineMSKLNSLQKLIEKRKLKEDLTHIIETPEGQRFFKMLLRECHVTKPVFHAEESKLRECEGRRRFAMSLLTLLAQDDPQQLIDRLEAEGKNL*
Ga0098048_101668323300006752MarineMKVMDSLGRLREKSQLRNDIVNILETPAGQRFFKILLRECHVTKPVFHTDEAKLRECEGRRRLAMSFLTLIGQDDPQQLINKLELENKKNV*
Ga0098055_105250523300006793MarineMTNLDSVGRLREKSQLRNDLINILETPEGNRFFKVLLRECHVTKPVFHAEESKLRECEGRRRLAMSFLTLIGQDDPQQLINKLELEKKKNV*
Ga0070746_1018529223300006919AqueousMSLLDSVQRLREKSQLRNDLINILETPQGARFFKVLLRECHVTKPVFHAEESKLRECEGRRRLAMSFLTLIGQDDPQQLINKLELEQKKNV*
Ga0099849_100070893300007539AqueousMNLKRLRKKAQLREDLTQILNTPEGKRFFAVLLRECHVTKPVFHSDESKLRESEGRRRLAMSFLNLLAEDDPQQLISKIEQENQNDE*
Ga0099849_100527333300007539AqueousMKLRNLDQLRERSTLKDDLTTIIATPEGKRFFKVLLRECHVTKPVFHSDNNKLRESEGRRRLAMTFLSLIAEDDPQKLINKIELENNE*
Ga0099847_110931623300007540AqueousMLAKVVDTYARLRKRGELRDDLNKILETPEGQRFFKVFLKECHVTKPVFHVDNNKLRECEGRRRLAMSFLSLLGQDDPHQLINLIEQENHDKTT*
Ga0102813_100827653300009003EstuarineMLDKAVDAFARLRKRGELRSDLIKILETPEGQRFFKVFLRECHVTKPVFHSDESKLRECEGRRRLAMSFLTLLGQDDPHQMINIIEQENHDQTT*
Ga0115550_100839943300009076Pelagic MarineMRVLDSLSRLREKAKLKEDLTHILETPQGKRFFTVLLRECHVTKPVFHADEAKLRECEGRRRLAMSFLTLLGQDDPQELINKIEMENK*
Ga0102815_1001074863300009080EstuarineMSKLNSLQKLIEKRKIKEDLTHIIETPEGQRFFKMLLRECHVTKPVFHAEESKLRECEGRRRFAMSLLTLLAQDDPQQLIDRLEAEGKNL*
Ga0118687_1001397423300009124SedimentMIDLTLKRLREKAKLKEDLHTLLDTPEGERFFRNLLKECHVTKPVFHSDNNKLRECEGRRRLAMSYLDLLSEDDPHKLINRLEEQKDE*
Ga0115006_1145923013300009544MarineMLDKAVDAFARLRKRGELRDDLSKILETPEGQRFFKVFLRECHVTKPVFHSDENKLRECEGRRRLAMSFLTLLGQDDPHQMINIIEQEKHVI
Ga0115102_1010219513300009606MarineQLKEDLIHILETPHGQRFFKVLLRECHVTKPVFHTEESKLRECEGRRRLAMSFLTLLGQDDPQELINRLEMENK*
Ga0115102_1061386133300009606MarineMRVLDSLTKLREKAKLKEDLTNIIETPQGKRFFKVLLRECHVTKPVFHSDEAKLRECEGRRRLAMSFLTLLGQDDPQELINKIEMENK*
Ga0115000_1004679033300009705MarineMNLDGLNLKRLRKKAQLKNDLTQILTTSAGVRFFAVLLRECHVTKPVFHSDEAKLRESEGRRRLAMSFLNLLAEDDPQRLISKIEQENQNE*
Ga0098049_108920023300010149MarineMTKLPLLNVQRLRQKSRLREDLNLILQTKEGQRFFKVLLRECHVTKPVFHSDTNKLRGSEGRRRLAMSFLSLLSADDPQKLINIMEVEEDE*
Ga0098049_119405613300010149MarineLRNDIVNILETPAGQRFFKILLRECHVTKPVFHTDEAKLRECEGRRRLAMSFLTLIGQDDPQQLINKLELENKKNV*
Ga0129348_102778613300010296Freshwater To Marine Saline GradientMNLKRLRKKAQLREDLTQILNTPEGKRFFAVLLRECHVTKPVFHSDESKLRESEGRRRLAMSFLNLLAEDDPQQ
Ga0129345_118725613300010297Freshwater To Marine Saline GradientMKLHLMNLKRLRKKAQLREDLIQILETPEGKRFFAVLLKECHVTKPVFHSDESKLRESEGRRRLAMSFLSLLAEDDPQQLISKIEQENQND
Ga0151671_109200923300011253MarineMRVLDSVWRLREKSQLRNDLINILETPAGQRFFSILFRECHVTKPIFHSDEAKLRECEGRRRLAMSFLTLIGQDDPLQLINKLELEKKKNV*
Ga0180120_1034784323300017697Freshwater To Marine Saline GradientMSLLDSVQRLREKSQLRNDLINILETPQGARFFKVLLRECHVTKPVFHAEESKLRECEGRRRLAMSFLTLIGQDDPQQLINKLELEQK
Ga0181377_100427423300017706MarineMSKLNSLQKLIEKRKLKEDLTHIIETPEGQRFFKVLLRECHVTKPVFHAEESKLRECEGRRRFAMSLLTLLAQDDPQQLIDRLEAEGKNL
Ga0181387_100534633300017709SeawaterMRVLDSLTRLREKAKLKEDLINILETPQGKRFFTVLLRECHVTKPVFHSDEAKLRECEGRRRLAMSFLTLLGQDDPQELINKIEMENK
Ga0181412_102245323300017714SeawaterMNLDSLNLKRLRRKRQLKNDLEQILSTSAGMRFFDVLLRECHVTKPVFHSDEAKLRESEGRRRLAMSFLNLLAEDDPQQLINKIEQENQNE
Ga0181383_117722923300017720SeawaterMSVLSTLERLREKSKLKEDLINILETPSGQRFFKVLLRECHVTKPVFHSDDVKMRECEGRRRLAMSFLTLLGQDDPQELINKIEMENKNI
Ga0181388_117628713300017724SeawaterSLTRLREKAKLKEDLINILETPQGKRFFTVLLRECHVTKPVFHSDEAKLRECEGRRRLAMSFLTLLGQDDPQELINKIEMENK
Ga0181419_100669443300017728SeawaterMRELDSVGRLREKSQLRNDLINILETPAGDRFFKVLLRECHVTKPVFHSDEAKLRECEGRRRLAMSFLTLIGQDDPQQLINKLELEKKQNV
Ga0181426_109208623300017733SeawaterMKLRNLDQLKERVKLRDDLLSILETEEGKRFFKVFLRECHVTKPVFHEDDRRLREAEGRRRLAMTFLTLIAEDDPQKLINKLELENSNE
Ga0181431_100029443300017735SeawaterMRELDSVWRLREKSQLRNDLINILETPAGSRFFKVFLRECHVTKPVFHGDEAKLRECEGRRRLAMSFLTLIGQDDPQQLINKLELEKKQNV
Ga0181428_100974323300017738SeawaterMAGKNPMQRLITKRQLKEDLTNILETPEGKRFFEVLLRECHVTRPVFHSDDAKLREAEGRRRFAMSLLTLVSQDNPQALIERLEKESQ
Ga0181418_100165183300017740SeawaterMRVLDSLTRLREKAQLKEDLINILETPQGKRFFTVLLRECHVTKPVFHSDEAKLRECEGRRRLAMSFLTLLGQDDPQTLINKIEMENK
Ga0181399_114934323300017742SeawaterELRKKAQLKNDLEQILTTSAGVRFFDVLLRECHVTKPVFHSDEAKLRESEGRRRLAMSFLNLLAEDDPQQLINKIEQENQNNE
Ga0181427_100201023300017745SeawaterMAGKNPMQRLITKRQLKEDLTNILETPEGKRFFEVLLRECHVTRPVFHSDDSKLREAEGRRRFAMSLLTLVSQDNPQALIERLEKEAQ
Ga0181420_105316923300017757SeawaterMKLRNVDQLKQRVKLKDDLTTIIATPEGKRFFKVLLRECHVTKPVFHSDNNKLRESEGRRRLAMTFLSLIAEDDPQKLINKIELENNE
Ga0181395_101903833300017779SeawaterMKLREKKKLRDDLLSILETDPGKRFFKILLRECHVTKPVFHSDVDKLRECEGRRRLAMSFLSLLGQDDPQYLIRKIEEENV
Ga0181395_109287823300017779SeawaterMSVLNSIQKLREKSKLKSDLITILETPAGKRFFEVLLRECHVTKPVFHADTNKLRECEGRRRLAMSFLTLLGQDDPQQLITKLELENRNV
Ga0181380_100242433300017782SeawaterMKLRNLDQLRERSTLKDDLTTIIGTPEGKRFFKVLLRECHVTKPVFHSDNNKLRESEGRRRLAMTFLSLIAEDDPQKLINKIELENNE
Ga0181380_110753323300017782SeawaterLRDDLLSILETEEGKRFFKVFLRECHVTKPVFHEDDRRLREAEGRRRLAMTFLTLIAEDDPQKLINKLELENSNE
Ga0181380_125088113300017782SeawaterLDSVGRLREKSQLRNDLINILETPAGDRFFKVLLRECHVTKPVFHSDEAKLRECEGRRRLAMSFLTLIGQDDPQQLINKLELEKKQNV
Ga0180433_1000695173300018080Hypersaline Lake SedimentMRVLDSLSRLREKAKLKEDLTHILETPQGKRFFTVLLRECHVTKPVFHADEAKLRECEGRRRLAMSFLTLLGQDDPQELINKIEMENK
Ga0206124_1018812523300020175SeawaterMLDKAVDAFARLRKRGELRSDLIKILETPEGQRFFKVFLRECHVTKPVFHSDESKLRECEGRRRLAMSFLTLLGQDDPHQMINIIEQENHDQTT
Ga0211504_100048983300020347MarineVVQKVIQSVARLKERGELRDDLLKILDTPEGERFFRILLRECHVTKPVFHSDDAKLRECEGRRRLAMSFLSLLGQDDPQQIINRLGEEHNV
Ga0211518_1002010833300020440MarineMSVVQTIERLRQKAKLKEDLVTILETPAGKRFFEVLLRECHVTKPVFHSDTNKLRECEGRRRLAMSFLSLLGQDDPQQLINKLELENKNV
Ga0211577_10000632293300020469MarineMDKVRSVLKLREKAQLRDDLLSLLKTDPGKRFFKILLKECHVTKPVFHSDVDKLRECEGRRRLAMSFLSLMGQDDPQILINKIEEENV
Ga0211577_10002301183300020469MarineMSVLSTLERLREKSKLKEDLINILETPHGQRFFKVLLRECHVTKPVFHSDDVKMRECEGRRRLAMSFLTLLGQDDPQELINKIEMENKNI
Ga0213867_100069483300021335SeawaterMSLLDSVQRLREKSQLRNDLINILETPQGARFFKVLLRECHVTKPVFHAEESKLRECEGRRRLAMSFLTLIGQDDPQQLINKLELEQKKNV
Ga0213867_115422123300021335SeawaterMRVLDSLTKLREKAKLKEDLINILETPQGKRFFTVLLRECHVTKPVFHSDEAKLRECEGRRRLAMSFLTLLGQDDPQELINKIEMENK
Ga0213858_1000248053300021356SeawaterMSVLNSLQRLRQKAKLKDDLVTILNTPAGKRFFEVLLRECHVTKPVFHSDTNKLRECEGRRRFAMSLLSLLGQDDPQQLITKLELENNNDV
Ga0213858_1000808673300021356SeawaterMSVLRTLERLKEKSRLKSDLIRILETPEGQRFFRVLLRECHVTKPVFHSDTHKLRECEGRRRLAMSFLTLLGEEDPDALINKIELENKENV
Ga0213865_1001717653300021373SeawaterMKLRNLDQLRERAKLKDDLTTIIETPAGKRFFKVLLRECHVTKPVFHSDNNKLRESEGRRRLAMTFLSLIAEDDPQKLINKLELENNE
Ga0213864_1002329733300021379SeawaterMNLHLMNLKRLRKKAQLREDLTQILNTPEGKRFFAVLLRECHVTKPVFHSEESKLRESEGRRRLAMSFLNLLAEDDPQQLISKIEQENQNDE
Ga0213868_1005684933300021389SeawaterMRVLDSLSRLREKAKLKEDLINILETPQGKRFFTVLLRECHVTKPVFHADEAKLRECEGRRRLAMSFLTLLGQDDPQELINKIEMENK
Ga0213868_1050159723300021389SeawaterMSLLNSLDKLRKKAQLKEDLINILETPHGQRFFKVLLRECHVTKPVFHAEESKLRECEGRRRLAMSFLTLLGQDDPQELINRLEMENK
Ga0213866_1001419243300021425SeawaterMRIIQRLERLREKAQLREDLINILETPHGERFFKVLLRECHVTKPVFHTDEAKLRECEGRRRLAMSFLTLLGQDSPQEIINRIELEEKNNERT
Ga0213866_1006180933300021425SeawaterMKLRNLDQLKERVKLKDDLTTIIETPEGKRFFRVLLRECHVTKPVFHSDNNKLRESEGRRRFAMTLLALIAEDDPQKLINKIESENNE
Ga0213866_1049420723300021425SeawaterMIDLTLKRLREKAKLKEDLHTLLDTPEGERFFRNLLKECHVTKPVFHSDNNKLRECEGRRRLAMSYLDLLSEDDPHKLINRLEEQKDE
Ga0222717_10001279253300021957Estuarine WaterMRVLDSLSKLREKAKLKEDLTNIIETPQGKRFFKVLLRECHVTKPVFHSDEAKLRECEGRRRLAMSFLTLLGQDDPQELINKIEMENK
Ga0222717_1016673923300021957Estuarine WaterMLDKAVDAFARLRQRGELRDDLNKILETPEGQRFFKVFLKECHVTKPVFHSDVNKLRECEGRRRLAMSFLSLLGQDDPHQLINIIEQENHD
Ga0222716_1001976853300021959Estuarine WaterMRVLDSLTKLREKAKLKEDLTNIIETPQGKRFFKVLLRECHVTKPVFHSDEAKLRECEGRRRLAMSFLTLLGQDDPQELINKIEMENK
(restricted) Ga0233412_1029468223300023210SeawaterMSLLNSLDKLRKKAQLKEDLIHILETPHGQRFFKVLLRECHVTKPVFHTEESKLRECEGRRRLAMSFLTLLGQDDPQELINRLEMENK
Ga0228633_100399223300024228SeawaterMRVLDSLSRLREKAKLKEDLTHILETPQGKRFFTVLLRECHVTKPVFHADEAKLRECEGRRRLAMSFLTLLGQDDPQELINKIELENK
Ga0228650_108387423300024417SeawaterMLDKAVNAVARLRQRGELRDDLNTILSTPEGKRFFKVLLKECHVTKPVFHSDNNKLRESEGRRRLAMSFLSLMGQDDPHQLINIIEQENHD
Ga0208667_103350423300025070MarineMKVMDSLGRLREKSQLRNDIVNILETPAGQRFFKILLRECHVTKPVFHTDEAKLRECEGRRRLAMSFLTLIGQDDPQQLINKLELENKKNV
Ga0207896_1000025203300025071MarineMNLKRLRKKARLKEDLTQILNTQEGVRFFAVLLRECHVTKPVFHSDEAKLRESEGRRRLAMSFLNLLAEDDPQQLISKIEQENQNDE
Ga0207890_101611023300025079MarineMLDKAVDAYARLRQRGELRDDLNTILSTPEGKRFFKVFLKECHVTKPVFHSDNNKLRECEGRRRLAMSFLSLMGQDDPHKLINIIEQENHD
Ga0209535_100148983300025120MarineMKLRNLDQLKDRASLRNDLVAILETKPGQRFFNVLLRECHVTKPVFHSDTNKLREAEGRRRLAMSFLNLIGEDDPQQIINRIELENNE
Ga0209535_105629123300025120MarineMAGKNPMQRLITKRQLKEDLTNILETPEGKRFFEVLLRECHVTRPVFHSDDAKLREAEGRRRFAMSLLTLVSQDNPQALIERLEKEAQ
Ga0209348_100011793300025127MarineMRVLDSLTKLREKAKLKEDLINILETPHGKRFFTVLLRECHVTKPVFHSDEAKLRECEGRRRLAMSFLTLLGQDDPQELINKIEMENK
Ga0209348_100682023300025127MarineMPILNSLEKLREKAKLKEDLINILETPHGQRFFKVLLRECHVTKPVFHSDDAKMRECEGRRRLAMSFLTLLGQDDPQELINKIEMENK
Ga0209232_1000174343300025132MarineMLDKAVDAVARLRQRGELRDDLNTILSTPEGKRFFKVLLKECHVTKPVFHSDTNKLRESEGRRRLAMSFLSLLGQDDPHQLINIIEQGNHD
Ga0209232_100240653300025132MarineMTKLPLLNVQRLRQKSRLREDLNLILQTKEGQRFFKVLLRECHVTKPVFHSDTNKLRESEGRRRLAMSFLSLLSADDPQKLINIMEVEEDE
Ga0209232_119014823300025132MarineMSKLTNLSKLKERARLREDLSLIIKSPHGKRFFKILLRECHVTKPVFHEDDRRLRECEGRRRLAMSFLNLLAEDDPQKLINKIELENKDG
Ga0209645_105925013300025151MarineYNMNLHLMNLKRLRKKAQLREDLTQILNTPEGKRFFAVLLRECHVTKPVFHSEESKLRESEGRRRLAMSFLNLLAEDDPQQLISKIEQENQNDE
Ga0209645_109838623300025151MarineMKLHLMNLKRLRKKAQLREDLIQILETPEGKRFFAVLLKECHVTKPVFHSEESKLRESEGRRRLAMSFLNLLAEDDPQQLISKIEQENQNDE
Ga0209337_100750923300025168MarineMNLNVMNLKRLRKKARLKEDLTQILNTQEGVRFFAVLLRECHVTKPVFHSDEAKLRESEGRRRLAMSFLNLLAEDDPQQLISKIEQENQNDE
Ga0208162_100024883300025674AqueousMNLHLMNLKRLRKKAQLREDLTQILNTPEGKRFFAVLLRECHVTKPVFHSDESKLRESEGRRRLAMSFLNLLAEDDPQQLISKIEQENQNDE
Ga0208162_100723143300025674AqueousMKLRNLDQLRERSTLKDDLTTIIATPEGKRFFKVLLRECHVTKPVFHSDNNKLRESEGRRRLAMTFLSLIAEDDPQKLINKIELENNE
Ga0208763_104236113300026136MarineMKLHLMNLKRLRKKAQLREDLIQILETPEGKRFFAVLLKECHVTKPVFHSEESKLRESEGRRRLAMSFLNLLAEDDPQQLISKIEQE
Ga0209710_110455623300027687MarineMNLDGLNLKRLRKKAQLKNDLTQILTTSAGVRFFDVLLRECHVTKPVFHSDEAKLRESEGRRRLAMSFLNLLAEDDPQRLISKIEQENQNE
Ga0208305_1000653923300027753EstuarineMSKLNSLQKLIEKRKLKEDLTHIIETPEGQRFFKMLLRECHVTKPVFHAEESKLRECEGRRRFAMSLLTLLAQDDPQQLIDRLEAEGKNL
Ga0209830_1031488323300027791MarineMNLDGLNLKRLRKKAQLKNDLTQILTTSAGVRFFAVLLRECHVTKPVFHSDEAKLRESEGRRRLAMSFLNLLAEDDPQRLISKIEQENQNE
(restricted) Ga0233415_1000252953300027861SeawaterMRELDSVWRLREKSQLRNDIINILETPAGSRFFKVLLRECHVTKPVFHSDEAKLRECEGRRRLAMSFLTLIGQDDPQQLINKLELEKKKNV
Ga0209713_1006095133300027883MarineMSLLNSLDKLRKKAQLKEDLIHILETPQGQRFFKVLLRECHVTKPVFHTEESKLRECEGRRRLAMSFLTLLGQDDPQELINRLEMENK
Ga0183755_100431273300029448MarineMLKNIERLRKKAQLRNDLQSILSTPEGTRFFKVLLRECHVTKPVFHSDSTKLRECEGRRRLAMSFLNLLAEDDPQHLINKIELENNE
Ga0183755_100672723300029448MarineMDKINTISKLREKRKLREDLLAILETEPGRRFFKILLRECHVTKPVFHSDVDKLRECEGRRRLAMSFLSLLGQDDPQYIINKIEEENNV
Ga0183755_103659123300029448MarineMNLKRLRKKARLKEDLTQILSTQEGARFFAVLLRECHVTKPVFHSDEAKLRESEGRRRLAMSFLNLLAEDDPQQLISKIEQENQNDE
Ga0183826_100298723300029792MarineMSVLSTLERLREKSKLKEDLINILETPQGQRFFRVLLRECHVTKPVFHSDTAKMRECEGRRRLAMSFLTLLGQDDPQELINKIEMENKNI
Ga0316207_10005901123300032212Microbial MatMSVLSTLERLREKSKLKEDLINILETPQGQRFFKVLLRECHVTKPVFHSDDVKMRECEGRRRLAMSFLTLLGQDDPQELINKIEMENKNI
Ga0316202_1039360123300032277Microbial MatMSKLNSLQKLIEKRKLKEDLTHIIETPEGQRFFKVLLRECHVTKPVFHAEESKLRECEGRRRFAMSLLTLLAQDDPQQLIDRL

 ⦗Top⦘


Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.