NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome / Metatranscriptome Family F083245

Metagenome / Metatranscriptome Family F083245

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F083245
Family Type Metagenome / Metatranscriptome
Number of Sequences 113
Average Sequence Length 42 residues
Representative Sequence MEMLIKVGFCFFVGVGIGAILIQVSALFWMFWDMFKPKD
Number of Associated Samples 96
Number of Associated Scaffolds 113

Quality Assessment
Transcriptomic Evidence Yes
Most common taxonomic group Unclassified
% of genes with valid RBS motifs 84.07 %
% of genes near scaffold ends (potentially truncated) 26.55 %
% of genes from short scaffolds (< 2000 bps) 69.91 %
Associated GOLD sequencing projects 87
AlphaFold2 3D model prediction Yes
3D model pTM-score0.50

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Unclassified (54.867 % of family members)
NCBI Taxonomy ID N/A
Taxonomy N/A

Most Common Ecosystem
GOLD Ecosystem Environmental → Aquatic → Marine → Oceanic → Unclassified → Marine
(33.628 % of family members)
Environment Ontology (ENVO) Unclassified
(75.221 % of family members)
Earth Microbiome Project Ontology (EMPO) Free-living → Saline → Water (saline)
(89.381 % of family members)


 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      

 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Transmembrane (alpha-helical) Signal Peptide: No Secondary Structure distribution: α-helix: 50.75%    β-sheet: 0.00%    Coil/Unstructured: 49.25%
Feature Viewer
Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer
Per-residue confidence (pLDDT):
  0-50   51-70   71-90   91-100  		pTM-score: 0.50
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.

 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 113 Family Scaffolds
PF02954HTH_8 7.96
PF10614CsgF 5.31
PF06067DUF932 3.54
PF05996Fe_bilin_red 3.54
PF03783CsgG 2.65
PF027395_3_exonuc_N 1.77
PF00565SNase 1.77
PF137592OG-FeII_Oxy_5 1.77
PF00156Pribosyltran 1.77
PF02617ClpS 0.88
PF00709Adenylsucc_synt 0.88
PF13328HD_4 0.88
PF06714Gp5_OB 0.88
PF02518HATPase_c 0.88
PF05226CHASE2 0.88

Neighboring Clusters of Orthologous Genes (COGs)

COG IDNameFunctional Category % Frequency in 113 Family Scaffolds
COG1462Curli biogenesis system outer membrane secretion channel CsgGCell wall/membrane/envelope biogenesis [M] 2.65
COG02585'-3' exonuclease Xni/ExoIX (flap endonuclease)Replication, recombination and repair [L] 1.77
COG0104Adenylosuccinate synthaseNucleotide transport and metabolism [F] 0.88
COG2127ATP-dependent Clp protease adapter protein ClpSPosttranslational modification, protein turnover, chaperones [O] 0.88
COG4252Extracytoplasmic sensor domain CHASE2 (specificity unknown)Signal transduction mechanisms [T] 0.88

 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
UnclassifiedrootN/A54.87 %
All OrganismsrootAll Organisms45.13 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
2236876004|none_p0423779Not Available553Open in IMG/M
3300000101|DelMOSum2010_c10029117All Organisms → cellular organisms → Bacteria3065Open in IMG/M
3300000116|DelMOSpr2010_c10192214All Organisms → cellular organisms → Bacteria660Open in IMG/M
3300000224|SI34jun09_10mDRAFT_1008992Not Available2092Open in IMG/M
3300000864|OpTDRAFT_1018244Not Available620Open in IMG/M
3300000928|OpTDRAFT_10104022All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Rhodospirillaceae → Candidatus Endolissoclinum → unclassified Candidatus Endolissoclinum → Candidatus Endolissoclinum sp. TMED37881Open in IMG/M
3300000929|NpDRAFT_10084090All Organisms → Viruses → Predicted Viral2018Open in IMG/M
3300001344|JGI20152J14361_10049968All Organisms → Viruses → Predicted Viral1111Open in IMG/M
3300001352|JGI20157J14317_10007551Not Available7602Open in IMG/M
3300001460|JGI24003J15210_10000656Not Available14732Open in IMG/M
3300001472|JGI24004J15324_10018524All Organisms → cellular organisms → Bacteria → Proteobacteria2387Open in IMG/M
3300003216|JGI26079J46598_1019592Not Available1766Open in IMG/M
3300003580|JGI26260J51721_1000979Not Available12516Open in IMG/M
3300003580|JGI26260J51721_1006387All Organisms → Viruses → Predicted Viral3606Open in IMG/M
3300005941|Ga0070743_10065173All Organisms → cellular organisms → Bacteria1235Open in IMG/M
3300006164|Ga0075441_10311894Not Available574Open in IMG/M
3300006164|Ga0075441_10365668Not Available523Open in IMG/M
3300006737|Ga0098037_1063330Not Available1317Open in IMG/M
3300006752|Ga0098048_1008049All Organisms → Viruses → Predicted Viral3871Open in IMG/M
3300006752|Ga0098048_1012542All Organisms → Viruses → Predicted Viral2957Open in IMG/M
3300006789|Ga0098054_1336608Not Available537Open in IMG/M
3300006793|Ga0098055_1164116Not Available852Open in IMG/M
3300006793|Ga0098055_1356363Not Available543Open in IMG/M
3300006922|Ga0098045_1052109All Organisms → cellular organisms → Bacteria → Proteobacteria1012Open in IMG/M
3300006922|Ga0098045_1080512All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Rhodospirillaceae → Candidatus Endolissoclinum → unclassified Candidatus Endolissoclinum → Candidatus Endolissoclinum sp. TMED37779Open in IMG/M
3300006922|Ga0098045_1098132All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium692Open in IMG/M
3300007665|Ga0102908_1082214Not Available640Open in IMG/M
3300008950|Ga0102891_1085980Not Available956Open in IMG/M
3300008961|Ga0102887_1062844All Organisms → Viruses → Predicted Viral1206Open in IMG/M
3300009024|Ga0102811_1230562All Organisms → cellular organisms → Bacteria692Open in IMG/M
3300009409|Ga0114993_10148183Not Available1830Open in IMG/M
3300009420|Ga0114994_10007206Not Available8017Open in IMG/M
3300009420|Ga0114994_10109729Not Available1876Open in IMG/M
3300009420|Ga0114994_11137546Not Available504Open in IMG/M
3300009425|Ga0114997_10292302Not Available904Open in IMG/M
3300009436|Ga0115008_10011561All Organisms → cellular organisms → Bacteria7229Open in IMG/M
3300009441|Ga0115007_10025326All Organisms → cellular organisms → Bacteria3644Open in IMG/M
3300009441|Ga0115007_10838405Not Available624Open in IMG/M
3300009606|Ga0115102_10982874Not Available988Open in IMG/M
3300009705|Ga0115000_10587238Not Available695Open in IMG/M
3300009785|Ga0115001_10587958Not Available681Open in IMG/M
3300010149|Ga0098049_1014706All Organisms → Viruses → Predicted Viral2618Open in IMG/M
3300010883|Ga0133547_10804077All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Rhodospirillaceae → Candidatus Endolissoclinum → unclassified Candidatus Endolissoclinum → Candidatus Endolissoclinum sp. TMED371846Open in IMG/M
3300013010|Ga0129327_10543890All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rickettsiales → unclassified Rickettsiales → Rickettsiales bacterium634Open in IMG/M
3300017709|Ga0181387_1024328All Organisms → cellular organisms → Bacteria → Proteobacteria1181Open in IMG/M
3300017714|Ga0181412_1124015Not Available594Open in IMG/M
3300017719|Ga0181390_1084132Not Available874Open in IMG/M
3300017719|Ga0181390_1130850All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Saprospiria → Saprospirales → unclassified Saprospirales → Saprospirales bacterium647Open in IMG/M
3300017719|Ga0181390_1188944All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Rhodospirillaceae → Candidatus Endolissoclinum → unclassified Candidatus Endolissoclinum → Candidatus Endolissoclinum sp. TMED37500Open in IMG/M
3300017738|Ga0181428_1031631All Organisms → Viruses → Predicted Viral1229Open in IMG/M
3300017739|Ga0181433_1003311All Organisms → cellular organisms → Bacteria4911Open in IMG/M
3300017742|Ga0181399_1067497Not Available912Open in IMG/M
3300017745|Ga0181427_1050430All Organisms → Viruses → Predicted Viral1029Open in IMG/M
3300017750|Ga0181405_1054986All Organisms → cellular organisms → Bacteria → Proteobacteria1044Open in IMG/M
3300017759|Ga0181414_1068538Not Available942Open in IMG/M
3300017760|Ga0181408_1088422Not Available810Open in IMG/M
3300017762|Ga0181422_1154081Not Available704Open in IMG/M
3300017770|Ga0187217_1076539Not Available1150Open in IMG/M
3300020165|Ga0206125_10381986Not Available515Open in IMG/M
3300020166|Ga0206128_1352848Not Available508Open in IMG/M
3300020382|Ga0211686_10056181Not Available1592Open in IMG/M
3300020431|Ga0211554_10363638Not Available673Open in IMG/M
3300020463|Ga0211676_10096959All Organisms → Viruses → Predicted Viral1950Open in IMG/M
3300021185|Ga0206682_10000085Not Available87240Open in IMG/M
3300021185|Ga0206682_10010075All Organisms → cellular organisms → Bacteria6755Open in IMG/M
3300021335|Ga0213867_1124741All Organisms → cellular organisms → Bacteria902Open in IMG/M
3300021957|Ga0222717_10022264Not Available4244Open in IMG/M
3300022074|Ga0224906_1027313All Organisms → cellular organisms → Bacteria → Proteobacteria1984Open in IMG/M
(restricted) 3300023109|Ga0233432_10003056Not Available15331Open in IMG/M
(restricted) 3300023109|Ga0233432_10020611All Organisms → cellular organisms → Bacteria → Proteobacteria4815Open in IMG/M
3300024247|Ga0228675_1008605All Organisms → cellular organisms → Bacteria2729Open in IMG/M
(restricted) 3300024255|Ga0233438_10012635Not Available5754Open in IMG/M
(restricted) 3300024264|Ga0233444_10016093Not Available5558Open in IMG/M
3300024266|Ga0228661_1108202Not Available522Open in IMG/M
3300024326|Ga0228652_1067073All Organisms → cellular organisms → Bacteria887Open in IMG/M
3300024328|Ga0228635_1048877Not Available1140Open in IMG/M
3300024343|Ga0244777_10157443All Organisms → Viruses → Predicted Viral1466Open in IMG/M
3300024346|Ga0244775_10051011Not Available3601Open in IMG/M
3300024346|Ga0244775_10560427All Organisms → cellular organisms → Bacteria930Open in IMG/M
3300024348|Ga0244776_10349490All Organisms → cellular organisms → Bacteria995Open in IMG/M
3300025083|Ga0208791_1069122Not Available586Open in IMG/M
3300025084|Ga0208298_1001041Not Available10632Open in IMG/M
3300025098|Ga0208434_1010150Not Available2626Open in IMG/M
3300025108|Ga0208793_1001240Not Available15172Open in IMG/M
3300025108|Ga0208793_1110652All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Rhodospirillaceae → Candidatus Endolissoclinum → unclassified Candidatus Endolissoclinum → Candidatus Endolissoclinum sp. TMED37760Open in IMG/M
3300025120|Ga0209535_1022954All Organisms → cellular organisms → Bacteria → Proteobacteria3112Open in IMG/M
3300025137|Ga0209336_10006031All Organisms → cellular organisms → Bacteria → Proteobacteria5270Open in IMG/M
3300025626|Ga0209716_1162178All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Rhodospirillaceae → Candidatus Endolissoclinum → unclassified Candidatus Endolissoclinum → Candidatus Endolissoclinum sp. TMED37568Open in IMG/M
3300025832|Ga0209307_1231219Not Available525Open in IMG/M
3300025849|Ga0209603_1134754All Organisms → cellular organisms → Bacteria → Proteobacteria1031Open in IMG/M
3300025886|Ga0209632_10480523All Organisms → cellular organisms → Bacteria → Proteobacteria572Open in IMG/M
3300025886|Ga0209632_10506617Not Available550Open in IMG/M
3300025890|Ga0209631_10280699Not Available815Open in IMG/M
3300027506|Ga0208973_1011176All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Myoviridae → unclassified Myoviridae → Pelagibacter phage HTVC008M2994Open in IMG/M
3300027752|Ga0209192_10142807Not Available951Open in IMG/M
3300027780|Ga0209502_10428436Not Available535Open in IMG/M
3300027788|Ga0209711_10067570Not Available1900Open in IMG/M
3300027810|Ga0209302_10074216Not Available1757Open in IMG/M
3300027813|Ga0209090_10014007All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Myoviridae → unclassified Myoviridae → Pelagibacter phage HTVC008M4774Open in IMG/M
3300027833|Ga0209092_10084553All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Rhodospirillaceae → Candidatus Endolissoclinum → unclassified Candidatus Endolissoclinum → Candidatus Endolissoclinum sp. TMED371904Open in IMG/M
3300027833|Ga0209092_10132712All Organisms → Viruses → Predicted Viral1450Open in IMG/M
3300028008|Ga0228674_1209726Not Available622Open in IMG/M
3300028124|Ga0228621_1048629Not Available611Open in IMG/M
3300028132|Ga0228649_1020896All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Legionellales → unclassified Legionellales → Legionellales bacterium1882Open in IMG/M
3300028136|Ga0228608_1013145All Organisms → Viruses → Predicted Viral2444Open in IMG/M
3300031140|Ga0308024_1004202Not Available4718Open in IMG/M
3300031519|Ga0307488_10001654Not Available18642Open in IMG/M
3300031569|Ga0307489_11010381Not Available594Open in IMG/M
3300031589|Ga0307996_1016261All Organisms → Viruses → Predicted Viral1945Open in IMG/M
3300031622|Ga0302126_10050137Not Available1753Open in IMG/M
3300031766|Ga0315322_10191927All Organisms → cellular organisms → Bacteria1437Open in IMG/M
3300031774|Ga0315331_10199403Not Available1488Open in IMG/M
3300032047|Ga0315330_10303929Not Available1005Open in IMG/M

Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).


 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
MarineEnvironmental → Aquatic → Marine → Oceanic → Unclassified → Marine33.63%
SeawaterEnvironmental → Aquatic → Marine → Strait → Unclassified → Seawater13.27%
SeawaterEnvironmental → Aquatic → Marine → Coastal → Unclassified → Seawater7.96%
EstuarineEnvironmental → Aquatic → Marine → Intertidal Zone → Estuary → Estuarine5.31%
MarineEnvironmental → Aquatic → Marine → Unclassified → Unclassified → Marine5.31%
MarineEnvironmental → Aquatic → Marine → Intertidal Zone → Unclassified → Marine4.42%
SeawaterEnvironmental → Aquatic → Marine → Intertidal Zone → Unclassified → Seawater4.42%
Pelagic MarineEnvironmental → Aquatic → Marine → Neritic Zone → Unclassified → Pelagic Marine4.42%
SeawaterEnvironmental → Aquatic → Marine → Inlet → Unclassified → Seawater3.54%
EstuarineEnvironmental → Aquatic → Marine → Unclassified → Unclassified → Estuarine2.65%
Pelagic MarineEnvironmental → Aquatic → Marine → Pelagic → Unclassified → Pelagic Marine2.65%
Freshwater And MarineEnvironmental → Aquatic → Marine → Neritic Zone → Unclassified → Freshwater And Marine2.65%
Sackhole BrineEnvironmental → Aquatic → Marine → Coastal → Unclassified → Sackhole Brine1.77%
MarineEnvironmental → Aquatic → Marine → Unclassified → Unclassified → Marine1.77%
SeawaterEnvironmental → Aquatic → Marine → Pelagic → Unclassified → Seawater1.77%
MarineEnvironmental → Aquatic → Marine → Neritic Zone → Unclassified → Marine1.77%
Freshwater To Marine Saline GradientEnvironmental → Aquatic → Marine → Coastal → Unclassified → Freshwater To Marine Saline Gradient0.89%
Marine EstuarineEnvironmental → Aquatic → Marine → Intertidal Zone → Estuary → Marine Estuarine0.89%
Estuarine WaterEnvironmental → Aquatic → Marine → Unclassified → Unclassified → Estuarine Water0.89%

Visualization
Powered by ApexCharts



Associated Samples

Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).

Taxon OIDSample NameHabitat TypeIMG/M Link
2236876004Estuarine microbial communities from Columbia River, sample from South Channel ETM site, GS313-0p1-ETM-15mEnvironmentalOpen in IMG/M
3300000101Marine microbial communities from Delaware Coast, sample from Delaware MO Early Summer May 2010EnvironmentalOpen in IMG/M
3300000116Marine microbial communities from Delaware Coast, sample from Delaware MO Spring March 2010EnvironmentalOpen in IMG/M
3300000224Marine microbial communities from expanding oxygen minimum zones in the Saanich Inlet - 34 06/16/09 10mEnvironmentalOpen in IMG/M
3300000864Marine plume microbial communities from the Columbia River - Metatranscriptome 25 PSUEnvironmentalOpen in IMG/M
3300000928Marine plume microbial communities from the Columbia River - 25 PSUEnvironmentalOpen in IMG/M
3300000929Marine plume microbial communities from the Columbia River - 15 PSUEnvironmentalOpen in IMG/M
3300001344Pelagic Microbial community sample from North Sea - COGITO 998_met_02EnvironmentalOpen in IMG/M
3300001352Pelagic Microbial community sample from North Sea - COGITO 998_met_07EnvironmentalOpen in IMG/M
3300001460Marine viral communities from the Pacific Ocean - LP-28EnvironmentalOpen in IMG/M
3300001472Marine viral communities from the Pacific Ocean - LP-32EnvironmentalOpen in IMG/M
3300003216Marine microbial communities from expanding oxygen minimum zones in the Saanich Inlet - ESP_59LU_5_DNAEnvironmentalOpen in IMG/M
3300003580Marine microbial communities from expanding oxygen minimum zones in the Saanich Inlet - Saanich Inlet SI074_LV_120m_DNAEnvironmentalOpen in IMG/M
3300005941Estuarine microbial communities from the Columbia River estuary, USA - metaG S.697EnvironmentalOpen in IMG/M
3300006164Marine microbial communities from the West Antarctic Peninsula - Coastal water metaG002-DNAEnvironmentalOpen in IMG/M
3300006737Marine viral communities from the Subarctic Pacific Ocean - 5_ETSP_OMZ_AT15132 metaGEnvironmentalOpen in IMG/M
3300006752Marine viral communities from the Subarctic Pacific Ocean - 13_ETSP_OMZ_AT15268 metaGEnvironmentalOpen in IMG/M
3300006789Marine viral communities from the Subarctic Pacific Ocean - 16_ETSP_OMZ_AT15313 metaGEnvironmentalOpen in IMG/M
3300006793Marine viral communities from the Subarctic Pacific Ocean - 17_ETSP_OMZ_AT15314 metaGEnvironmentalOpen in IMG/M
3300006922Marine viral communities from the Subarctic Pacific Ocean - 11_ETSP_OMZ_AT15265 metaGEnvironmentalOpen in IMG/M
3300007665Estuarine microbial communities from the Columbia River estuary - metaG 1557A-3EnvironmentalOpen in IMG/M
3300008950Estuarine microbial communities from the Columbia River estuary - metaG 1552A-02EnvironmentalOpen in IMG/M
3300008961Estuarine microbial communities from the Columbia River estuary - metaG 1550B-02EnvironmentalOpen in IMG/M
3300009024Estuarine microbial communities from the Columbia River estuary - Flood tide ETM metaG S.705EnvironmentalOpen in IMG/M
3300009409Marine microbial communities from western Arctic Ocean - ArcticOcean_MG_CB2_150EnvironmentalOpen in IMG/M
3300009420Marine microbial communities from western Arctic Ocean - ArcticOcean_MG_CB2_152EnvironmentalOpen in IMG/M
3300009425Marine microbial communities from western Arctic Ocean - ArcticOcean_MG_CB4_136EnvironmentalOpen in IMG/M
3300009436Marine eukaryotic phytoplankton communities from Arctic Ocean - Fram Strait ARC3M MetagenomeEnvironmentalOpen in IMG/M
3300009441Marine eukaryotic phytoplankton communities from Arctic Ocean - Arctic Ocean ARC135M MetagenomeEnvironmentalOpen in IMG/M
3300009606Marine eukaryotic communities from Pacific Ocean to study complex ecological interactions - MBTS_5May14_M2_3um Metatranscriptome (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300009705Marine microbial communities from western Arctic Ocean - ArcticOcean_MG_CB8_128EnvironmentalOpen in IMG/M
3300009785Marine microbial communities from western Arctic Ocean - ArcticOcean_MG_CB8_130EnvironmentalOpen in IMG/M
3300010149Marine viral communities from the Subarctic Pacific Ocean - 13B_ETSP_OMZ_AT15268_CsCl metaGEnvironmentalOpen in IMG/M
3300010883western Arctic Ocean co-assemblyEnvironmentalOpen in IMG/M
3300013010Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Spr_31_0.8_DNAEnvironmentalOpen in IMG/M
3300017709Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 10 SPOT_SRF_2010-04-27EnvironmentalOpen in IMG/M
3300017714Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 35 SPOT_SRF_2012-08-15EnvironmentalOpen in IMG/M
3300017719Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 13 SPOT_SRF_2010-07-21EnvironmentalOpen in IMG/M
3300017738Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 51 SPOT_SRF_2014-02-12EnvironmentalOpen in IMG/M
3300017739Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 56 SPOT_SRF_2014-09-10EnvironmentalOpen in IMG/M
3300017742Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 22 SPOT_SRF_2011-05-21EnvironmentalOpen in IMG/M
3300017745Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 50 SPOT_SRF_2014-01-15EnvironmentalOpen in IMG/M
3300017750Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 28 SPOT_SRF_2011-11-29EnvironmentalOpen in IMG/M
3300017759Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 37 SPOT_SRF_2012-11-28EnvironmentalOpen in IMG/M
3300017760Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 31 SPOT_SRF_2012-02-16EnvironmentalOpen in IMG/M
3300017762Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 45 SPOT_SRF_2013-07-18EnvironmentalOpen in IMG/M
3300017770Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 15 SPOT_SRF_2010-09-15 (version 2)EnvironmentalOpen in IMG/M
3300020165Pelagic subsurface seawater microbial communities from Kabeltonne, Helgoland, North Sea - Helgoland_Spring_Bloom_20160331_1EnvironmentalOpen in IMG/M
3300020166Pelagic subsurface seawater microbial communities from Kabeltonne, Helgoland, North Sea - Helgoland_Spring_Bloom_20160426_1EnvironmentalOpen in IMG/M
3300020382Marine microbial communities from Tara Oceans - TARA_B100000780 (ERX556058-ERR599059)EnvironmentalOpen in IMG/M
3300020431Marine microbial communities from Tara Oceans - TARA_B100001142 (ERX556101-ERR598983)EnvironmentalOpen in IMG/M
3300020463Marine microbial communities from Tara Oceans - TARA_B100001057 (ERX555988-ERR599050)EnvironmentalOpen in IMG/M
3300021185Ammonia-oxidizing marine archaeal communities from Monterey Bay, California, United States - M2 40m 12015EnvironmentalOpen in IMG/M
3300021335Coastal seawater microbial communities near Pivers Island, North Carolina, United States - PICO540EnvironmentalOpen in IMG/M
3300021957Estuarine water microbial communities from San Francisco Bay, California, United States - C33_18DEnvironmentalOpen in IMG/M
3300022074Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 56 SPOT_SRF_2014-09-10 (v2)EnvironmentalOpen in IMG/M
3300023109 (restricted)Seawater microbial communities from Saanich Inlet, British Columbia, Canada - SI_122_August2016_10_MGEnvironmentalOpen in IMG/M
3300024247Seawater microbial communities from Monterey Bay, California, United States - 36D_rEnvironmentalOpen in IMG/M
3300024255 (restricted)Seawater microbial communities from Saanich Inlet, British Columbia, Canada - SI_123_September2016_10_MGEnvironmentalOpen in IMG/M
3300024264 (restricted)Seawater microbial communities from Saanich Inlet, British Columbia, Canada - SI_124_October2016_10_MGEnvironmentalOpen in IMG/M
3300024266Seawater microbial communities from Monterey Bay, California, United States - 75DEnvironmentalOpen in IMG/M
3300024326Seawater microbial communities from Monterey Bay, California, United States - 64DEnvironmentalOpen in IMG/M
3300024328Seawater microbial communities from Monterey Bay, California, United States - 44DEnvironmentalOpen in IMG/M
3300024343Combined assembly of estuarine microbial communities from Columbia River, Washington, USA >3um size fractionEnvironmentalOpen in IMG/M
3300024346Whole water sample coassemblyEnvironmentalOpen in IMG/M
33000243480.2um to 3um size fraction coassemblyEnvironmentalOpen in IMG/M
3300025083Marine viral communities from the Subarctic Pacific Ocean - 11_ETSP_OMZ_AT15265 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025084Marine viral communities from the Subarctic Pacific Ocean - 14B_ETSP_OMZ_AT15311_CsCl metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025098Marine viral communities from the Subarctic Pacific Ocean - 13_ETSP_OMZ_AT15268 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025108Marine viral communities from the Subarctic Pacific Ocean - 17_ETSP_OMZ_AT15314 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025120Marine viral communities from the Pacific Ocean - LP-28 (SPAdes)EnvironmentalOpen in IMG/M
3300025137Marine viral communities from the Pacific Ocean - LP-32 (SPAdes)EnvironmentalOpen in IMG/M
3300025626Pelagic marine microbial communities from North Sea - COGITO_mtgs_120531 (SPAdes)EnvironmentalOpen in IMG/M
3300025832Pelagic marine microbial communities from North Sea - COGITO_mtgs_110530 (SPAdes)EnvironmentalOpen in IMG/M
3300025849Pelagic marine microbial communities from North Sea - COGITO_mtgs_120607 (SPAdes)EnvironmentalOpen in IMG/M
3300025886Pelagic Microbial community sample from North Sea - COGITO 998_met_10 (SPAdes)EnvironmentalOpen in IMG/M
3300025890Pelagic Microbial community sample from North Sea - COGITO 998_met_08 (SPAdes)EnvironmentalOpen in IMG/M
3300027506Ammonia-oxidizing marine microbial communities from Monterey Bay, California, USA - CAN11_66_BLW_10 (SPAdes)EnvironmentalOpen in IMG/M
3300027752Marine microbial communities from western Arctic Ocean - ArcticOcean_MG_CB2_154 (SPAdes)EnvironmentalOpen in IMG/M
3300027780Marine microbial communities from western Arctic Ocean - ArcticOcean_MG_CB11_90 (SPAdes)EnvironmentalOpen in IMG/M
3300027788Marine microbial communities from western Arctic Ocean - ArcticOcean_MG_CB11_88 (SPAdes)EnvironmentalOpen in IMG/M
3300027810Marine eukaryotic phytoplankton communities from Arctic Ocean - Arctic Ocean ARC135M Metagenome (SPAdes)EnvironmentalOpen in IMG/M
3300027813Marine microbial communities from western Arctic Ocean - ArcticOcean_MG_CB2_152 (SPAdes)EnvironmentalOpen in IMG/M
3300027833Marine eukaryotic phytoplankton communities from Arctic Ocean - Fram Strait ARC3M Metagenome (SPAdes)EnvironmentalOpen in IMG/M
3300028008Seawater microbial communities from Monterey Bay, California, United States - 1D_rEnvironmentalOpen in IMG/M
3300028124Seawater microbial communities from Monterey Bay, California, United States - 25DEnvironmentalOpen in IMG/M
3300028132Seawater microbial communities from Monterey Bay, California, United States - 61DEnvironmentalOpen in IMG/M
3300028136Seawater microbial communities from Monterey Bay, California, United States - 9DEnvironmentalOpen in IMG/M
3300031140Marine microbial communities from water near the shore, Antarctic Ocean - #420EnvironmentalOpen in IMG/M
3300031519Sea-ice brine microbial communities from Beaufort Sea near Barrow, Alaska, United States - SB 0.2EnvironmentalOpen in IMG/M
3300031569Sea-ice brine microbial communities from Beaufort Sea near Barrow, Alaska, United States - SB 1.2EnvironmentalOpen in IMG/M
3300031589Marine microbial communities from David Island wharf, Antarctic Ocean - #35EnvironmentalOpen in IMG/M
3300031622Marine microbial communities from Western Arctic Ocean, Canada - CB4_20mEnvironmentalOpen in IMG/M
3300031766Ammonia-oxidizing marine archaeal communities from Monterey Bay, California, United States - M1 100m 21515EnvironmentalOpen in IMG/M
3300031774Ammonia-oxidizing marine archaeal communities from Monterey Bay, California, United States - M1 60m 34915EnvironmentalOpen in IMG/M
3300032047Ammonia-oxidizing marine archaeal communities from Monterey Bay, California, United States - M1 40m 34915EnvironmentalOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap


 ⦗Top⦘

Family Sequences

Note: Some of these sequences are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).

Protein ID Sample Taxon ID Habitat Sequence
none_042377922236876004Marine EstuarineMEMLIKVGFCFFVGVGIGAILIQVSALFWMFWDMFKEKKLKRFTTLLLF
DelMOSum2010_1002911743300000101MarineMEMLIKVGFSFFVGVGIAAILIQVSALFWMFWDMFKPKD*
DelMOSpr2010_1019221423300000116MarineMEMLIKVGFCFFVGVGIGAILIQVSALFWMFWDMFFGNGKD*
SI34jun09_10mDRAFT_100899243300000224MarineMELLIKISFSFFLGVGIGVMLMQVSALVWMFWDMFKSKQK*
OpTDRAFT_101824423300000864Freshwater And MarineMELFIHVAFCFFVGVGIGAILIQLSALFWMFWDMFKPKD*
OpTDRAFT_1010402223300000928Freshwater And MarineMELLINVVFSLLLGVGIAAMLMQVSALFWMFWDMFRSKRND*
NpDRAFT_1008409053300000929Freshwater And MarineFCFFVGVGIGAILIQLSALFWMFWDMFFNKRKDLLDK*
JGI20152J14361_1004996823300001344Pelagic MarineMQGIELLIYVGFCFFVGVGIGAILIQLSALLWMFWDMFKPKPTKQTRE*
JGI20157J14317_1000755123300001352Pelagic MarineMELFIYVAFCFFVGVGIGAILIQLSALFWMFWDMFFGKKDKKRLDSMTSWH*
JGI24003J15210_1000065613300001460MarineMIDQLIFVGFCFFVGVGIGAMLIQVSALFWMFWDMFRSKKD
JGI24004J15324_1001852423300001472MarineMQGIELLIYVGFCFFVGVGIGAILIQISALFWMFWDMFFGKKDKEKT*
JGI26079J46598_101959233300003216MarineMEMLINVVFSLLLGVGIAAMLMQVSALFWMFWDMFRSKRND*
JGI26260J51721_100097993300003580MarineMEMLIKVGFCFFVGVGIGAILIQVSALFWMFWDMFKKKN*
JGI26260J51721_100638723300003580MarineMEMLIKVGFSFFVGVGIAAILIQVSALFWMFWDMFRSKHND*
Ga0070743_1006517333300005941EstuarineMIDLLIFAGFCFFVGVGIGAILIQVSALFWMFWDMFFGKKN*
Ga0075441_1031189433300006164MarineMELLINVVFGLLLVIGIGAMLSMMSALIWMFWDMFFGKGNT*
Ga0075441_1036566813300006164MarineMELLIKVGFSFFLGVGIGVILMQVSALCWMFWDMFRSKRND*
Ga0098037_106333033300006737MarineMIDQLIFVGFCFFVGVGIGAMLIQISALFWMFWDMFRSKKDGS*
Ga0098048_100804993300006752MarineMQGIELLIYVGFCFFVGVGIGAILIQVSALFWMFWDMFFGKKDKKNT*
Ga0098048_101254233300006752MarineMELFIYVAFCFFVGVGIGAMLIQVSALFWMFWDMFKKK*
Ga0098054_133660813300006789MarineMIDQLIFVGFCFFVGVGIGAMLIQISALFWMFWDMFFGKKDKKNT*
Ga0098055_116411613300006793MarineMQGIELLIYVGFCFFVGVGIGAILIQISALFWMFWDMFFGKKDKKNT*
Ga0098055_135636323300006793MarineMELFIYVAFCFFVGVGIGAMLIQMSALFWMFWDMFKPKD*
Ga0098045_105210913300006922MarineMQGIELLIYVGFCFFVGVGIGAILIQISALFWMFWDMFF
Ga0098045_108051213300006922MarineQGIELLIYVGFCFFVGVGIGAILIQISALFWMFWDMFFGKKDKKNT*
Ga0098045_109813233300006922MarineLIYVGFCFFVGVGIGAILIQISALFWMFWDMFFVKKD*
Ga0102908_108221413300007665EstuarineMQGIELLIYVGFCFFVGVGIGAILIQISALLWMFWDMFKPKPTKQTRE*
Ga0102891_108598033300008950EstuarineMELLINVVFAFFFGVGIAAILIQVSALFWMFWDMFKPKD*
Ga0102887_106284423300008961EstuarineMQGIELLIYVGFCFFVGVGIGAILIQISALFWMFWDMFKPKPTKQTRE*
Ga0102811_123056213300009024EstuarineMQGIELLIYVGFCFFVGVGIGAILIQVSALFWMFWDMF
Ga0114993_1014818343300009409MarineMELLINVVFSLLLGVGIGAILMQVSALIWMFWDMFKRG*
Ga0114994_1000720683300009420MarineMEMLIKVGFCFFVGVGIGAILIQVSALFWMFWDMFKPKD*
Ga0114994_1010972923300009420MarineMEQGIEMLIKVGFCFFVGVGIGAILIQVSALIWMFWDMFRNKRS*
Ga0114994_1113754623300009420MarineMEMLIKVGFCFFVGVGIGAILIQVSALFWMFWDMFKPKQK*
Ga0114997_1029230223300009425MarineMEQGIEMLIKVGFCFFVGVGIGAILIQVSALFWMFWDMFRNKRS*
Ga0115008_10011561153300009436MarineMELFIYVAFCFFVGVGIGAILIQLSALFWMFWDMFKPTKQTRD*
Ga0115007_1002532643300009441MarineMELLINVVFAFFFGAGIAAILIQVSALFWMFWDMFRSKRND*
Ga0115007_1083840523300009441MarineMELLIKVGFCFFLGVGIGAILMQVSALFWMFWDMFRSKRND*
Ga0115102_1098287423300009606MarineMQGIELLIYVGFCFFVGVGIGAILIQISALFWMFWDMFKKN*
Ga0115000_1058723833300009705MarineMEQGIEMLIKVGFCFFVGVGIGAILIQVSALFWMFWDMFRSKRND*
Ga0115001_1058795833300009785MarineMEQGIEMLIKVGFCFFVGVGIGAILIQVSALFWMFWDMFKRG*
Ga0098049_101470653300010149MarineMKMIDQLIFVGFCFFVGVGIGAMLIQISALFWMFWDMFRSKKDGS*
Ga0133547_1080407753300010883MarineMELLINVVFSLLLGVGIAAMLIQVIALFWMYWDMFRSKRND*
Ga0129327_1054389023300013010Freshwater To Marine Saline GradientMELLINVVFSLLLGAAIAAMLVQATALVWMFWDMFKPKKR*
Ga0181387_102432813300017709SeawaterMQGIELLIYVGFCFFVGVGIGAILIQVSALFWMFWDMFFGKKDKKNT
Ga0181412_112401533300017714SeawaterMIDQLIFVGFCFFVGVGIGAMLIQVSALFWMFWDMFRSKKDD
Ga0181390_108413213300017719SeawaterMEMLIYVGFCFFVGVGIGAILLQLSALFWMFWDMFTK
Ga0181390_113085033300017719SeawaterMQGIELLIYVGFCFFVGIGIGAILIQVSALFWMFWDMFFGKKDKKNT
Ga0181390_118894413300017719SeawaterMQGIELLIYVGFCFFVGVGIGAILMQVSALCWMFWDMFFGKKD
Ga0181428_103163123300017738SeawaterMKMIDQLIFVGFCFFVGVGIGAMLIQVSALFWMFWDMFRSKKDD
Ga0181433_100331153300017739SeawaterMIDQLIFVGFCFFVGVGIGAMLIQVSALLWMFWDMFRSKKDD
Ga0181399_106749733300017742SeawaterMQGIELLIYVGFCFFVGVGIGAILIQISALLWMFWDMFKPKPTKQTRE
Ga0181427_105043053300017745SeawaterMQGIELLIYVGFCFFVGVGIGAILIQVSALFWMFWDMFRSKKDD
Ga0181405_105498643300017750SeawaterMIDQLIFVGFCFFVGVGIGAMLIQVSALFWMFWDMFFGKKDKKNT
Ga0181414_106853833300017759SeawaterMIDQLIFVGFCFFVGVGIGAMLIQVSALFWMFWDMFRSKKDGS
Ga0181408_108842233300017760SeawaterLIYVGFCFFVGVGIGAILIQVSALFWMFWDMFFGKKDKKNT
Ga0181422_115408113300017762SeawaterRRQVMELLINVAFCFFVGVGIGAILIQLSALFWMFWDMFFGKKDKKNT
Ga0187217_107653963300017770SeawaterMQGIELLIYVGFCFFVGVGIGAILIQVSALFWMFWDMFF
Ga0206125_1038198623300020165SeawaterMQGIELLIYVGFCFFVGVGIGAMLIQISALFWMFWDMFKPKD
Ga0206128_135284823300020166SeawaterMQGIELLIYVGFCFFVGVGIGAILIQLSALLWMFWDMFKPKPTKQTRE
Ga0211686_1005618123300020382MarineMELLINVVFGLLLVIGIGAMLSMMSALIWMFWDMFFGKGNT
Ga0211554_1036363823300020431MarineMKMIDQLIFVGFCFFVGVGIGAMLIQVSALFWMFWDMFRSKKDGS
Ga0211676_1009695913300020463MarineMQGIELLIYVGFCFFVGVGIGAILIQINALFWMFWGMFFGKKDKEKT
Ga0206682_1000008583300021185SeawaterMIDLLIFVGFCFFVGVGIGAILIQVSALFWMFWDMFFGKKS
Ga0206682_1001007563300021185SeawaterMEMLIKVGFSFFVGVGIAAILIQVSALFWMFWDMFKPKD
Ga0213867_112474123300021335SeawaterMQGIELLIYVGFCFFVGVGIGAILIQLSALLWMFWDMFFNKRKDWLDK
Ga0222717_1002226423300021957Estuarine WaterMEMLIKVGFCFFVGVGIGAILIQVSALFWMFWDMFKKN
Ga0224906_102731323300022074SeawaterMIDQLIFVGFCFFVGVGIGAMLIQVSALVWMFWDMFRSKKDD
(restricted) Ga0233432_1000305663300023109SeawaterMEMLINVVFSLLLGVGIAAMLMQVSALFWMFWDMFRSKRND
(restricted) Ga0233432_1002061113300023109SeawaterMIDLLIFAGFCFFVGVGIGAILIQVSALFWMFWDMFFGKK
Ga0228675_100860533300024247SeawaterMEMLIYVGFCFFVGVGIGAILLQLSALFWMFWDMFTKKR
(restricted) Ga0233438_1001263533300024255SeawaterMEMLIKVGFCFFVGVGIGAILIQVSALFWMFWDMFKKKN
(restricted) Ga0233444_10016093123300024264SeawaterMEMLIKVGFSFFVGVGIAAILIQVSALFWMFWDMFRSKHND
Ga0228661_110820223300024266SeawaterMEMLIKVGFCFFVGVGIGAILIQVSALFWMFWDMF
Ga0228652_106707333300024326SeawaterCFFVGVGIGAILIQLSALFWMFWDMFFNKRKDLLDK
Ga0228635_104887743300024328SeawaterMEMLIKVGFCFFVGVGIGAILIQLSALFWMFWDMFKKN
Ga0244777_1015744353300024343EstuarineMQGIELLIYVGFCFFVGVGIGAILIQISALFWMFWDMFKPKPTKQTRE
Ga0244775_1005101173300024346EstuarineMIDLLIFAGFCFFVGVGIGAILIQVSALFWMFWDMFFGKKN
Ga0244775_1056042733300024346EstuarineMELLINVVFAFFFGVGIAAILIQVSALFWMFWDMFKPKD
Ga0244776_1034949033300024348EstuarineMLIKVGFSFFVGVGIAAILIQVSALFWMFWDMFKPKD
Ga0208791_106912233300025083MarineQGIELLIYVGFCFFVGVGIGAILIQISALFWMFWDMFFGKKDKKNT
Ga0208298_1001041233300025084MarineQRKQVMELFIYVAFCFFVGVGIGAMLIQVSALFWMFWDMFKKK
Ga0208434_101015033300025098MarineMQGIELLIYVGFCFFVGVGIGAILIQISALFWMFWDMFRSKKDGS
Ga0208793_100124013300025108MarineVMELFIYVAFCFFVGVGIGAMLIQVSALFWMFWDMFKKK
Ga0208793_111065213300025108MarineIQMMKRTMKMIDQLIFVGFCFFVGVGIGAMLIQISALFWMFWDMFFGKKDKKNT
Ga0209535_102295493300025120MarineMQGIELLIHVGFCFFVGVGIGAILIQISALFWMFWDMFFGKKDKEKT
Ga0209336_1000603153300025137MarineMQGIELLIYVGFCFFVGVGIGAILIQISALFWMFWDMFFGKKDKEKT
Ga0209716_116217823300025626Pelagic MarineMELFIYVAFCFFVGVGIGAILIQLSALFWMFWDMFFGKKDKKRLDSMTSWH
Ga0209307_123121913300025832Pelagic MarineMQGIELLIYVGFCFFVGVGIGAILIQLSALLWMFWDMFKPKPT
Ga0209603_113475443300025849Pelagic MarineMELFIYVAFCFFVGVGIGAILIQLSALFWMFWDMFFGKK
Ga0209632_1048052313300025886Pelagic MarineMELFIYVAFCFFVGVGIGAILIQLSALFWMFWDMFFGKKDKKRLDSMTS
Ga0209632_1050661713300025886Pelagic MarineRQVMELFIYVAFCFFVGVGIGAILIQLSALFWMFWDMFFGKKRQKET
Ga0209631_1028069933300025890Pelagic MarineMQGIELLIYVGFCFFVGVGIGAILIQLSALLWMFWDMFK
Ga0208973_101117653300027506MarineMQGIELLIYVGFCFFVGVGIGAILIQISALFWMFWDMFTKQR
Ga0209192_1014280733300027752MarineMELLINVVFSLLLGVGIGAILMQVSALIWMFWDMFKRG
Ga0209502_1042843623300027780MarineMEMLIKVGFCFFVGVGIGAILIQVSALFWMFWDMFKPKQK
Ga0209711_1006757013300027788MarineMEQGIEMLIKVGFCFFVGVGIGAILIQVSALFWMFWDMFRNKRS
Ga0209302_1007421633300027810MarineMELLIKVGFCFFLGVGIGAILMQVSALIWMFWDMFKRG
Ga0209090_1001400733300027813MarineMEMLIKVGFCFFVGVGIGAILIQVSALFWMFWDMFKPKD
Ga0209092_1008455343300027833MarineMELLINVVFSLLLGVGIAAMLMQVSALFWMFWDMFRSKRND
Ga0209092_1013271233300027833MarineMELFIYVAFCFFVGVGIGAILIQLSALFWMFWDMFKPTKQTRD
Ga0228674_120972633300028008SeawaterMQGIELLIYVGFCFFVGVGIGAILIQISALFWMFWDMFFGKKDKKNT
Ga0228621_104862923300028124SeawaterMIDQLIFVGFCFFVGVGIGAMLIQVSALVWIFWDMFRSKKDD
Ga0228649_102089643300028132SeawaterMELFIHVAFCFFVGVGIGAILIQLSALFWMFWDMFFNKRKDLL
Ga0228608_101314553300028136SeawaterFCFFVGVGIGAILIQLSALFWMFWDMFFNKRKDLLDK
Ga0308024_1004202103300031140MarineMELLIKVGFSFFLGVGIGVILMQVSALCWMFWDMFRSKRND
Ga0307488_10001654243300031519Sackhole BrineMELLINVLFAFFFGAGIAAILIQVTALFWMFWDMFFGRNK
Ga0307489_1101038133300031569Sackhole BrineMELLINVVFAFFFGAGIAAILIQVSALFWMFWDMFRSKRND
Ga0307996_101626113300031589MarineRGLLMELLIKVGFSFFLGVGIGVILMQVSALCWMFWDMFRSKRND
Ga0302126_1005013713300031622MarineMEQGIEMLIKVGFCFFVGVGIGAILIQVSALFWMFWDM
Ga0315322_1019192733300031766SeawaterMELFIHVAFCFFVGVGIGAILIQLSALFWMFWDMFFNKRKDLLDK
Ga0315331_1019940333300031774SeawaterMKMIDQLIFVGFCFFVGVGIGAMLIQVSALLWMFWDMFRSKKDD
Ga0315330_1030392943300032047SeawaterTLIQMMKRTMKMIDQLIFVGFCFFVGVGIGAMLIQVSALVWMFWDMFRSKKDD

 ⦗Top⦘


Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.