NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome Family F083228

Metagenome Family F083228

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F083228
Family Type Metagenome
Number of Sequences 113
Average Sequence Length 39 residues
Representative Sequence INTHGDYAVANALCLLSLLVAAVGAAFYLRHAVARAERR
Number of Associated Samples 105
Number of Associated Scaffolds 113

Quality Assessment
Transcriptomic Evidence No
Most common taxonomic group Bacteria
% of genes with valid RBS motifs 0.94 %
% of genes near scaffold ends (potentially truncated) 92.92 %
% of genes from short scaffolds (< 2000 bps) 88.50 %
Associated GOLD sequencing projects 100
AlphaFold2 3D model prediction Yes
3D model pTM-score0.47

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Bacteria (61.947 % of family members)
NCBI Taxonomy ID 2
Taxonomy All Organisms → cellular organisms → Bacteria

Most Common Ecosystem
GOLD Ecosystem Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere
(7.080 % of family members)
Environment Ontology (ENVO) Unclassified
(38.938 % of family members)
Earth Microbiome Project Ontology (EMPO) Host-associated → Plant → Plant rhizosphere
(38.053 % of family members)


 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      

 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Transmembrane (alpha-helical) Signal Peptide: No Secondary Structure distribution: α-helix: 53.73%    β-sheet: 0.00%    Coil/Unstructured: 46.27%
Feature Viewer
Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer
Per-residue confidence (pLDDT):
  0-50   51-70   71-90   91-100  		pTM-score: 0.47
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.

 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 113 Family Scaffolds
PF00528BPD_transp_1 56.64
PF00378ECH_1 1.77
PF00582Usp 0.88
PF00011HSP20 0.88
PF07690MFS_1 0.88
PF00270DEAD 0.88
PF00117GATase 0.88
PF00291PALP 0.88
PF02371Transposase_20 0.88
PF02894GFO_IDH_MocA_C 0.88
PF00459Inositol_P 0.88

Neighboring Clusters of Orthologous Genes (COGs)

COG IDNameFunctional Category % Frequency in 113 Family Scaffolds
COG0071Small heat shock protein IbpA, HSP20 familyPosttranslational modification, protein turnover, chaperones [O] 0.88
COG0673Predicted dehydrogenaseGeneral function prediction only [R] 0.88
COG3547TransposaseMobilome: prophages, transposons [X] 0.88

 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms61.95 %
UnclassifiedrootN/A38.05 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
3300005327|Ga0070658_10211373All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria1639Open in IMG/M
3300005329|Ga0070683_100118112All Organisms → cellular organisms → Bacteria → Proteobacteria2504Open in IMG/M
3300005332|Ga0066388_103400021All Organisms → cellular organisms → Bacteria → Proteobacteria813Open in IMG/M
3300005334|Ga0068869_100910181All Organisms → cellular organisms → Bacteria → Proteobacteria762Open in IMG/M
3300005339|Ga0070660_100597204All Organisms → cellular organisms → Bacteria → Proteobacteria923Open in IMG/M
3300005344|Ga0070661_100791149All Organisms → cellular organisms → Bacteria → Proteobacteria778Open in IMG/M
3300005367|Ga0070667_101997895All Organisms → cellular organisms → Bacteria → Proteobacteria546Open in IMG/M
3300005459|Ga0068867_101306694All Organisms → cellular organisms → Bacteria → Proteobacteria670Open in IMG/M
3300005530|Ga0070679_100660783All Organisms → cellular organisms → Bacteria → Proteobacteria988Open in IMG/M
3300005539|Ga0068853_101135584All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales754Open in IMG/M
3300005539|Ga0068853_102247997All Organisms → cellular organisms → Bacteria → Proteobacteria529Open in IMG/M
3300005540|Ga0066697_10066718All Organisms → cellular organisms → Bacteria2060Open in IMG/M
3300005553|Ga0066695_10864898All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales518Open in IMG/M
3300005563|Ga0068855_100057922All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales4540Open in IMG/M
3300005577|Ga0068857_101430500All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales673Open in IMG/M
3300005578|Ga0068854_100850355All Organisms → cellular organisms → Bacteria → Proteobacteria799Open in IMG/M
3300005615|Ga0070702_101614638All Organisms → cellular organisms → Bacteria → Proteobacteria537Open in IMG/M
3300005833|Ga0074472_11101465Not Available680Open in IMG/M
3300005833|Ga0074472_11243051All Organisms → cellular organisms → Bacteria825Open in IMG/M
3300005841|Ga0068863_100239644Not Available1751Open in IMG/M
3300005893|Ga0075278_1040279All Organisms → cellular organisms → Bacteria → Proteobacteria685Open in IMG/M
3300006041|Ga0075023_100447622All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Rhizobiaceae → Rhizobium/Agrobacterium group → Rhizobium570Open in IMG/M
3300006047|Ga0075024_100707541All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales554Open in IMG/M
3300006169|Ga0082029_1006434All Organisms → cellular organisms → Bacteria → Proteobacteria1476Open in IMG/M
3300006224|Ga0079037_100180286All Organisms → cellular organisms → Bacteria → Proteobacteria1878Open in IMG/M
3300006804|Ga0079221_10627315All Organisms → cellular organisms → Bacteria → Proteobacteria731Open in IMG/M
3300006930|Ga0079303_10094009All Organisms → cellular organisms → Bacteria → Proteobacteria1123Open in IMG/M
3300006954|Ga0079219_12261156All Organisms → cellular organisms → Bacteria → Proteobacteria525Open in IMG/M
3300007076|Ga0075435_101995001All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria509Open in IMG/M
3300009100|Ga0075418_10699749All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium1092Open in IMG/M
3300009166|Ga0105100_10229487Not Available1108Open in IMG/M
3300009167|Ga0113563_12137471Not Available671Open in IMG/M
3300009179|Ga0115028_10595697Not Available825Open in IMG/M
3300009870|Ga0131092_11112009All Organisms → cellular organisms → Bacteria → Proteobacteria629Open in IMG/M
3300010357|Ga0116249_10253079All Organisms → cellular organisms → Bacteria → Proteobacteria1632Open in IMG/M
3300010401|Ga0134121_10820999All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Phyllobacteriaceae → Phyllobacterium895Open in IMG/M
3300010937|Ga0137776_1206043All Organisms → cellular organisms → Bacteria → Proteobacteria640Open in IMG/M
3300012202|Ga0137363_11175368All Organisms → cellular organisms → Bacteria → Proteobacteria653Open in IMG/M
3300012350|Ga0137372_10051168All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium3649Open in IMG/M
3300012351|Ga0137386_10167013All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1577Open in IMG/M
3300012351|Ga0137386_10877173All Organisms → cellular organisms → Bacteria → Proteobacteria644Open in IMG/M
3300012359|Ga0137385_11092674All Organisms → cellular organisms → Bacteria → Proteobacteria657Open in IMG/M
3300012914|Ga0157297_10021147Not Available1458Open in IMG/M
3300012958|Ga0164299_11034430All Organisms → cellular organisms → Bacteria → Proteobacteria608Open in IMG/M
3300013297|Ga0157378_10848820Not Available941Open in IMG/M
3300013307|Ga0157372_10526778All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium1377Open in IMG/M
3300013308|Ga0157375_11602226Not Available770Open in IMG/M
3300013308|Ga0157375_12822797All Organisms → cellular organisms → Bacteria → Proteobacteria581Open in IMG/M
3300014325|Ga0163163_11514814Not Available732Open in IMG/M
3300015075|Ga0167636_1033403All Organisms → cellular organisms → Bacteria → Proteobacteria634Open in IMG/M
3300015372|Ga0132256_101929674All Organisms → cellular organisms → Bacteria → Proteobacteria697Open in IMG/M
3300015372|Ga0132256_103744411All Organisms → cellular organisms → Bacteria → Proteobacteria511Open in IMG/M
3300017936|Ga0187821_10126597Not Available954Open in IMG/M
3300018000|Ga0184604_10090527Not Available931Open in IMG/M
3300018060|Ga0187765_10062043All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium1952Open in IMG/M
3300018076|Ga0184609_10229973Not Available866Open in IMG/M
3300018084|Ga0184629_10507114All Organisms → cellular organisms → Bacteria → Proteobacteria627Open in IMG/M
3300018433|Ga0066667_10875005Not Available771Open in IMG/M
3300018920|Ga0190273_10911108Not Available713Open in IMG/M
3300022694|Ga0222623_10344105All Organisms → cellular organisms → Bacteria → Proteobacteria570Open in IMG/M
3300025906|Ga0207699_10063480Not Available2231Open in IMG/M
3300025909|Ga0207705_10762397Not Available752Open in IMG/M
3300025910|Ga0207684_11627066All Organisms → cellular organisms → Bacteria → Proteobacteria522Open in IMG/M
3300025912|Ga0207707_10949431All Organisms → cellular organisms → Bacteria → Proteobacteria708Open in IMG/M
3300025919|Ga0207657_10513005Not Available939Open in IMG/M
3300025920|Ga0207649_10865335Not Available707Open in IMG/M
3300025921|Ga0207652_10596448Not Available991Open in IMG/M
3300025926|Ga0207659_10676885Not Available883Open in IMG/M
3300025932|Ga0207690_11369493All Organisms → cellular organisms → Bacteria → Proteobacteria591Open in IMG/M
3300025945|Ga0207679_11648401All Organisms → cellular organisms → Bacteria → Proteobacteria587Open in IMG/M
3300025972|Ga0207668_11516863All Organisms → cellular organisms → Bacteria → Proteobacteria605Open in IMG/M
3300025986|Ga0207658_11311765All Organisms → cellular organisms → Bacteria → Proteobacteria662Open in IMG/M
3300026095|Ga0207676_11581647Not Available653Open in IMG/M
3300026547|Ga0209156_10169609All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium1052Open in IMG/M
3300027843|Ga0209798_10221986All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Phyllobacteriaceae → Phyllobacterium926Open in IMG/M
3300027897|Ga0209254_10392757Not Available1031Open in IMG/M
3300027899|Ga0209668_10755485All Organisms → cellular organisms → Bacteria → Proteobacteria654Open in IMG/M
3300027900|Ga0209253_10480101Not Available931Open in IMG/M
3300028792|Ga0307504_10103771Not Available909Open in IMG/M
3300029980|Ga0302298_10092075All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium946Open in IMG/M
3300030002|Ga0311350_11569974All Organisms → cellular organisms → Bacteria → Proteobacteria583Open in IMG/M
3300031547|Ga0310887_10451116Not Available767Open in IMG/M
3300031726|Ga0302321_101280145Not Available841Open in IMG/M
3300031820|Ga0307473_10294258Not Available1018Open in IMG/M
3300031939|Ga0308174_10232737All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium1422Open in IMG/M
3300031939|Ga0308174_11118568All Organisms → cellular organisms → Bacteria → Proteobacteria670Open in IMG/M
3300031952|Ga0315294_10671271Not Available915Open in IMG/M
3300031995|Ga0307409_102722818All Organisms → cellular organisms → Bacteria → Proteobacteria523Open in IMG/M
3300032005|Ga0307411_10705109Not Available879Open in IMG/M
3300032013|Ga0310906_10037313All Organisms → cellular organisms → Bacteria → Proteobacteria2279Open in IMG/M
3300032053|Ga0315284_11192878Not Available837Open in IMG/M
3300032074|Ga0308173_10199680All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium1659Open in IMG/M
3300032180|Ga0307471_103473460All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales558Open in IMG/M
3300032205|Ga0307472_100875553Not Available829Open in IMG/M
3300032205|Ga0307472_101333820Not Available692Open in IMG/M
3300032205|Ga0307472_101606721All Organisms → cellular organisms → Bacteria → Proteobacteria639Open in IMG/M
3300033408|Ga0316605_10573687All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales1050Open in IMG/M
3300033414|Ga0316619_11963115All Organisms → cellular organisms → Bacteria → Proteobacteria532Open in IMG/M
3300033416|Ga0316622_101124174Not Available918Open in IMG/M
3300033419|Ga0316601_100325014All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales1418Open in IMG/M
3300033480|Ga0316620_10894681Not Available858Open in IMG/M
3300033482|Ga0316627_101937030All Organisms → cellular organisms → Bacteria → Proteobacteria610Open in IMG/M
3300033804|Ga0314863_045725Not Available893Open in IMG/M
3300034074|Ga0373894_026969Not Available824Open in IMG/M
3300034149|Ga0364929_0255889All Organisms → cellular organisms → Bacteria → Proteobacteria590Open in IMG/M
3300034690|Ga0364923_0138952All Organisms → cellular organisms → Bacteria → Proteobacteria629Open in IMG/M


 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
Corn RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere7.08%
Hardwood Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil5.31%
SoilEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Soil5.31%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil4.42%
Vadose Zone SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil4.42%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural → Soil4.42%
Corn RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere4.42%
Corn RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere3.54%
Freshwater Lake SedimentEnvironmental → Aquatic → Freshwater → Lentic → Sediment → Freshwater Lake Sediment2.65%
Groundwater SedimentEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment2.65%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Soil2.65%
Corn, Switchgrass And Miscanthus RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere2.65%
FenEnvironmental → Terrestrial → Peat → Unclassified → Unclassified → Fen2.65%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere2.65%
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere2.65%
SedimentEnvironmental → Aquatic → Freshwater → Lake → Sediment → Sediment1.77%
Freshwater WetlandsEnvironmental → Aquatic → Freshwater → Wetlands → Unclassified → Freshwater Wetlands1.77%
GroundwaterEnvironmental → Aquatic → Freshwater → Groundwater → Unclassified → Groundwater1.77%
Sediment (Intertidal)Environmental → Aquatic → Sediment → Unclassified → Unclassified → Sediment (Intertidal)1.77%
WatershedsEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds1.77%
Agricultural SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil1.77%
SedimentEnvironmental → Terrestrial → Floodplain → Sediment → Unclassified → Sediment1.77%
Switchgrass RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere1.77%
Miscanthus RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere1.77%
Populus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere1.77%
RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere1.77%
Arabidopsis RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Arabidopsis Rhizosphere1.77%
Freshwater SedimentEnvironmental → Aquatic → Freshwater → Sediment → Unclassified → Freshwater Sediment0.89%
WetlandEnvironmental → Aquatic → Freshwater → Sediment → Unclassified → Wetland0.89%
Wetland SedimentEnvironmental → Aquatic → Freshwater → Wetlands → Unclassified → Wetland Sediment0.89%
Freshwater SedimentEnvironmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment0.89%
Polar Desert SandEnvironmental → Aquatic → Freshwater → Ice → Unclassified → Polar Desert Sand0.89%
SedimentEnvironmental → Aquatic → Thermal Springs → Hot (42-90C) → Sediment → Sediment0.89%
SoilEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Soil0.89%
Groundwater SedimentEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment0.89%
Terrestrial SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil0.89%
Glacier Forefield SoilsEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Glacier Forefield Soils0.89%
Termite NestEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Termite Nest0.89%
Grasslands SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil0.89%
Rice Paddy SoilEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Rice Paddy Soil0.89%
PeatlandEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Peatland0.89%
Tropical PeatlandEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland0.89%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil0.89%
Deep SubsurfaceEnvironmental → Terrestrial → Deep Subsurface → Unclassified → Unclassified → Deep Subsurface0.89%
Peat SoilEnvironmental → Terrestrial → Peat → Unclassified → Unclassified → Peat Soil0.89%
Switchgrass RhizosphereHost-Associated → Plants → Roots → Rhizosphere → Soil → Switchgrass Rhizosphere0.89%
Corn RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere0.89%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Miscanthus Rhizosphere0.89%
Activated SludgeEngineered → Wastewater → Activated Sludge → Unclassified → Unclassified → Activated Sludge0.89%
Anaerobic Digestor SludgeEngineered → Wastewater → Anaerobic Digestor → Unclassified → Unclassified → Anaerobic Digestor Sludge0.89%
Sediment SlurryEngineered → Bioremediation → Metal → Unclassified → Unclassified → Sediment Slurry0.89%

Visualization
Powered by ApexCharts



Associated Samples

Taxon OIDSample NameHabitat TypeIMG/M Link
3300005327Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaGHost-AssociatedOpen in IMG/M
3300005329Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaGEnvironmentalOpen in IMG/M
3300005332Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly)EnvironmentalOpen in IMG/M
3300005334Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2Host-AssociatedOpen in IMG/M
3300005339Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaGHost-AssociatedOpen in IMG/M
3300005344Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaGHost-AssociatedOpen in IMG/M
3300005367Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaGHost-AssociatedOpen in IMG/M
3300005459Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2Host-AssociatedOpen in IMG/M
3300005530Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaGEnvironmentalOpen in IMG/M
3300005539Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2Host-AssociatedOpen in IMG/M
3300005540Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_146EnvironmentalOpen in IMG/M
3300005553Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_144EnvironmentalOpen in IMG/M
3300005563Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2Host-AssociatedOpen in IMG/M
3300005577Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2Host-AssociatedOpen in IMG/M
3300005578Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2Host-AssociatedOpen in IMG/M
3300005615Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaGEnvironmentalOpen in IMG/M
3300005833Microbial communities from Cathlamet Bay sediment, Columbia River estuary, Oregon - S.174_CBKEnvironmentalOpen in IMG/M
3300005841Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2Host-AssociatedOpen in IMG/M
3300005893Rice paddy soil microbial communities from Twitchell Island, California, USA - SF_Rice_10C_0N_202EnvironmentalOpen in IMG/M
3300006041Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Straight Creek_MetaG_SC_2014EnvironmentalOpen in IMG/M
3300006047Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Straight Creek_MetaG_SC_2013EnvironmentalOpen in IMG/M
3300006169Termite nest microbial communities from Madurai, IndiaEnvironmentalOpen in IMG/M
3300006224Freshwater wetland microbial communities from Ohio, USA, analyzing the effect of biotic and abiotic controls - Mud 3 Core 4 Depth 4 metaGEnvironmentalOpen in IMG/M
3300006804Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS200EnvironmentalOpen in IMG/M
3300006930Deep subsurface shale carbon reservoir microbial communities from Ohio, USA - Methanogen_OWCEnvironmentalOpen in IMG/M
3300006954Agricultural soil microbial communities from Georgia to study Nitrogen management - GA ControlEnvironmentalOpen in IMG/M
3300007076Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4Host-AssociatedOpen in IMG/M
3300009100Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD2Host-AssociatedOpen in IMG/M
3300009166Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P8 Core (1) Depth 10-12cm May2015EnvironmentalOpen in IMG/M
3300009167Freshwater wetland microbial communities from Ohio, USA, analyzing the effect of biotic and abiotic controls - Mud 3 Core 4 Depth 3 metaG - Illumina Assembly (version 2)EnvironmentalOpen in IMG/M
3300009179Wetland microbial communities from Old Woman Creek Reserve in Ohio, USA - Plant_0915_D1EnvironmentalOpen in IMG/M
3300009527Groundwater microbial communities from Cold Creek, Nevada to study Microbial Dark Matter (Phase II) - Lower Cold CreekEnvironmentalOpen in IMG/M
3300009870Activated sludge microbial diversity in wastewater treatment plant from Taiwan - Linkou plantEngineeredOpen in IMG/M
3300010357AD_USSTcaEngineeredOpen in IMG/M
3300010401Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-1EnvironmentalOpen in IMG/M
3300010937Fumarole sediment microbial communities, Furnas, Sao Miguel, Azores. Combined Assembly of Gp0156138, Gp0156139EnvironmentalOpen in IMG/M
3300011442Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMGT138_2EnvironmentalOpen in IMG/M
3300012186Polar desert sand microbial communities from Dry Valleys, Antarctica - metaG UQ416 (21.06)EnvironmentalOpen in IMG/M
3300012202Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_115_16 metaGEnvironmentalOpen in IMG/M
3300012350Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_60_16 metaGEnvironmentalOpen in IMG/M
3300012351Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_100_16 metaGEnvironmentalOpen in IMG/M
3300012359Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_80_16 metaGEnvironmentalOpen in IMG/M
3300012914Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S028-104C-2EnvironmentalOpen in IMG/M
3300012958Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_221_MGEnvironmentalOpen in IMG/M
3300013297Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaGHost-AssociatedOpen in IMG/M
3300013307Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaGHost-AssociatedOpen in IMG/M
3300013308Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaGHost-AssociatedOpen in IMG/M
3300014325Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaGHost-AssociatedOpen in IMG/M
3300015075Arctic soil microbial communities from a glacier forefield, Russell Glacier, Kangerlussuaq, Greenland (Sample G5C, Northern proglacial tributary margin, adjacent to top of river)EnvironmentalOpen in IMG/M
3300015372Soil combined assemblyHost-AssociatedOpen in IMG/M
3300017936Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SourceSoil_1EnvironmentalOpen in IMG/M
3300018000Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM0_5_coexEnvironmentalOpen in IMG/M
3300018060Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_QUI02_MP05_10_MGEnvironmentalOpen in IMG/M
3300018076Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_60_coexEnvironmentalOpen in IMG/M
3300018084Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM4_32_b1EnvironmentalOpen in IMG/M
3300018433Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_116EnvironmentalOpen in IMG/M
3300018920Populus adjacent soil microbial communities from riparian zone of Shoshone River, Wyoming, USA - 504 ISEnvironmentalOpen in IMG/M
3300022549Cold Creek_combined assemblyEnvironmentalOpen in IMG/M
3300022694Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM2_30_coexEnvironmentalOpen in IMG/M
3300025906Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025909Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025910Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025912Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025919Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025920Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025921Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025926Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025932Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025945Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025972Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025986Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300026095Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300026547Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_124 (SPAdes)EnvironmentalOpen in IMG/M
3300027843Wetland sediment microbial communities from St. Louis River estuary, USA, under dissolved organic matter induced mercury methylation - T4Bare3Fresh (SPAdes)EnvironmentalOpen in IMG/M
3300027897Freshwater lake sediment microbial communities from the University of Notre Dame, USA, for methane emissions studies - DIP11 DI (SPAdes)EnvironmentalOpen in IMG/M
3300027899Freshwater lake sediment microbial communities from the University of Notre Dame, USA, for methane emissions studies - PLP11 PL (SPAdes)EnvironmentalOpen in IMG/M
3300027900Freshwater lake sediment microbial communities from the University of Notre Dame, USA, for methane emissions studies - BRP12 BR (SPAdes)EnvironmentalOpen in IMG/M
3300028792Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 19_SEnvironmentalOpen in IMG/M
3300028802Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 17_SEnvironmentalOpen in IMG/M
3300029980Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - III_Fen_N3_3EnvironmentalOpen in IMG/M
3300030002II_Fen_N1 coassemblyEnvironmentalOpen in IMG/M
3300031547Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T60D4EnvironmentalOpen in IMG/M
3300031726Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Fen_T0_1EnvironmentalOpen in IMG/M
3300031820Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_515EnvironmentalOpen in IMG/M
3300031939Soil microbial communities from UC Gill Tract Community Farm, Albany, California, United States - DLSLS.P.R2EnvironmentalOpen in IMG/M
3300031952Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G13_40EnvironmentalOpen in IMG/M
3300031995Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2Host-AssociatedOpen in IMG/M
3300032005Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1Host-AssociatedOpen in IMG/M
3300032013Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C48D3EnvironmentalOpen in IMG/M
3300032053Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G09_16EnvironmentalOpen in IMG/M
3300032074Soil microbial communities from UC Gill Tract Community Farm, Albany, California, United States - DLSLS.P.R1EnvironmentalOpen in IMG/M
3300032174Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_05EnvironmentalOpen in IMG/M
3300032180Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_515EnvironmentalOpen in IMG/M
3300032205Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_05EnvironmentalOpen in IMG/M
3300033408Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_soil_day20_noCTEnvironmentalOpen in IMG/M
3300033414Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_Aug_M1_C1_D4_BEnvironmentalOpen in IMG/M
3300033416Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_Aug_OW2_C1_D5_CEnvironmentalOpen in IMG/M
3300033419Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_soil_day5_noCTEnvironmentalOpen in IMG/M
3300033433Lab enriched peat soil microbial communities from Michigan Hollow, Ithaca, NY, United States - MHF15MNEnvironmentalOpen in IMG/M
3300033480Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_Aug_M1_C1_D5_BEnvironmentalOpen in IMG/M
3300033482Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_Aug_M2_C1_D1_CEnvironmentalOpen in IMG/M
3300033804Tropical peat soil microbial communities from peatlands in Loreto, Peru - MAQ_0_20EnvironmentalOpen in IMG/M
3300034074Uranium-contaminated sediment microbial communities from bioreactor in Oak Ridge, Tennessee, United States - A4A4.1EngineeredOpen in IMG/M
3300034149Sediment microbial communities from East River floodplain, Colorado, United States - 20_j17EnvironmentalOpen in IMG/M
3300034690Sediment microbial communities from East River floodplain, Colorado, United States - 60_j17EnvironmentalOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap


 ⦗Top⦘

Family Sequences

Protein ID Sample Taxon ID Habitat Sequence
Ga0070658_1021137313300005327Corn RhizosphereINTHGDYAVANALCLMSLVVAAIGAWFYLRQSTRALARQR*
Ga0070683_10011811213300005329Corn RhizosphereAYRINTFSDYAVANALCLLSLLLAAFGAAFYLRHAVRSAAS*
Ga0066388_10340002123300005332Tropical Forest SoilTHGDYAVANALCLLSLLLAAVGAVFYLRHAGGRTDAQAGR*
Ga0068869_10091018113300005334Miscanthus RhizosphereNTHSDYAVANALCLLSLLVAAGGAAFYLRHAVKGAETKS*
Ga0070660_10059720413300005339Corn RhizosphereINTHGDYAVANALCLVSLLLAAVGAAFYLKHSVGQAERRA*
Ga0070661_10079114913300005344Corn RhizosphereYRINTFSDYAVANALCLLSLLLAAFGAAFYLRHAVRSAAS*
Ga0070667_10199789513300005367Switchgrass RhizosphereINTHGDYAVANALCLLSLLVAAVGAAFYLRHAVARAERR*
Ga0068867_10130669413300005459Miscanthus RhizosphereYRINTHGDYAVANALCLVSLLLAAVGAAFYLKHSVGQAERRA*
Ga0070679_10066078323300005530Corn RhizosphereYRINTFADYAVANALCLLSLLVAAFGAAFYLRHAVRRAESGA*
Ga0068853_10113558413300005539Corn RhizosphereYRINTFADYAVANALCLLSLLLAAAGAALYLRHAVKRAA*
Ga0068853_10224799713300005539Corn RhizosphereRINTHSDYAVANALCLLSLLVAAGGAAFYLRHAVKGAETKS*
Ga0066697_1006671843300005540SoilYPVANALCLLSLALAAIGAVFYLRHAAGQVEEHRR*
Ga0066695_1086489813300005553SoilDVAYRISTHADYPVANALCLLSLALAAIGAVFYLRHAAAQVERT*
Ga0068855_10005792213300005563Corn RhizosphereDYGVANALCLMSLVIAAVGAWFYLRHSLRNAEAVT*
Ga0068857_10143050023300005577Corn RhizosphereVDVAYRINTFADYAVANALCLLSLLLAAAGAALYLRHAVKRAA*
Ga0068854_10085035523300005578Corn RhizosphereDYAVANALCLLSLLLAAFGAAFYLRHAVHRAENT*
Ga0070702_10161463813300005615Corn, Switchgrass And Miscanthus RhizosphereVAYRINTHADYAVANALCLLSLLVAAGGAAFYLRHAVKGAEAAS*
Ga0074472_1110146523300005833Sediment (Intertidal)THGDYAVANALCLVSLLFASLGAWVYLRHAVAKAEQGS*
Ga0074472_1124305113300005833Sediment (Intertidal)HGDYAVANALCLVSLLFASLGAWIYLRHAVAKAEQGA*
Ga0068863_10023964443300005841Switchgrass RhizosphereSTLSDYAVANALCLLSLIVAAGGAWFYLRHASESVK*
Ga0075278_104027913300005893Rice Paddy SoilTFADYAVANALCLLSLLLAAVGAAFYLRHAVHRAEGPQ*
Ga0075023_10044762213300006041WatershedsHGDYAVANALCLVSLAFASLGAWVYLRHAVQQVART*
Ga0075024_10070754123300006047WatershedsHGDYAVANALCLISLLFASLGAWVYLRHAVKRVGGA*
Ga0082029_100643433300006169Termite NestYRISTLSDYAVANALCLMSLVVAAGGAWFYLRHAVARAEGT*
Ga0079037_10018028613300006224Freshwater WetlandsVAYRISTHGDYAVANALCLVSLVFASLGAWVYLHHAVKRVGVA*
Ga0079221_1062731523300006804Agricultural SoilTFADYPVANALCLMSLVLAGGGAWFYLRHAAQKVEAAA*
Ga0079303_1009400913300006930Deep SubsurfaceAYRISTLSDYAVANALCLMSLAVAAVGAWFYLQHAKRQTLSA*
Ga0079219_1226115613300006954Agricultural SoilSTHADYPVANALCLLSLALAAIGAVFYLRHAVAKAEGA*
Ga0075435_10199500123300007076Populus RhizosphereRINTHADYAVANALCLMSLVIAAFGAWFYLRHAARRVT*
Ga0075418_1069974933300009100Populus RhizosphereTFADYAVANALCLLTLLLAAFGAAFYLRHAVRRAESTS*
Ga0105100_1022948713300009166Freshwater SedimentNTHGDYGVANALCLASLLLAAGGAWFYLRHAVVRAEAAA*
Ga0113563_1213747123300009167Freshwater WetlandsAEYAVANALCLLSLLVAAGGAAFYLRHAVKSAGEAA*
Ga0115028_1059569713300009179WetlandRISTHGDYAVANALCLVSLVFASLGAWVYLHHAVKRVGVA*
Ga0114942_131657423300009527GroundwaterINDHGDYAVANALCLMSLLIAAAAAWIYLRHATARHTAAS*
Ga0131092_1111200913300009870Activated SludgeYRISTMGDYAVANALCLMSLVVAAGAAWFYLQHSAKAMRQ*
Ga0116249_1025307913300010357Anaerobic Digestor SludgeHGDYAVANALCLVSLLFGAAGAWVYLRHAVRRAEQVS*
Ga0134121_1082099923300010401Terrestrial SoilYRINTHSDYAVANALCLLSLLVAAGGAAFYLRHAVKGAETKS*
Ga0137776_120604323300010937SedimentAYRIATFGDYPVANALCLLTLGRAAIGAVFYLRHAGAGAAKT*
Ga0137437_114483113300011442SoilSDYAVANALCLLSLLVAATAAWLYLRHAVGQVARQ*
Ga0136620_1018716623300012186Polar Desert SandGDYAVANALCLMSLLVAAAGAWFYLRQVSGQVRQR*
Ga0137363_1117536823300012202Vadose Zone SoilDYPVANALCLLSLGLAAIGAVFYLRHATARAVGS*
Ga0137372_1005116843300012350Vadose Zone SoilVAYRINTHADYAVANALCLMSLLVAAIGAAFYLRHATRQSSA*
Ga0137386_1016701313300012351Vadose Zone SoilINTHADYAVANALCLLSLLVAAIGAAFYLRHASAKVSQT*
Ga0137386_1087717323300012351Vadose Zone SoilVAYRISTHGDYPVANALCLLSLALAAIGAVFYLRHAAAQVEGK*
Ga0137385_1109267413300012359Vadose Zone SoilYRINTFADYAVANALCLLSLILAAGGAWFYLQHAVGKVEKT*
Ga0157297_1002114713300012914SoilDYAVANALCLLTLLFAAFGAAFYLRHAVRRAEATS*
Ga0164299_1103443023300012958SoilAYWINTHSDYAVANALCLLSLIVAAGGAAFYLRHAVKSAEGKA*
Ga0157378_1084882013300013297Miscanthus RhizosphereDYAVANALCLMSLVVAAIGAWFYLRQSTRALARQR*
Ga0157372_1052677833300013307Corn RhizosphereAYRINTHADYAVANALCLLSLLLAAVGAAFYLRHAVKRVESGG*
Ga0157375_1160222623300013308Miscanthus RhizosphereSTLSDYGVANALCLISLVVAAGAAWFYLQHAADKVRR*
Ga0157375_1282279713300013308Miscanthus RhizosphereINTFADYAVANALCLLSLLLAAVGAAFYLRHAVKRVETGS*
Ga0163163_1151481423300014325Switchgrass RhizosphereDYAVANALCLLSLLVAAGGAWFYLRHAVKGAEDKT*
Ga0167636_103340323300015075Glacier Forefield SoilsNTFGDYAVANALCLLSLVLAAGGAWFYLHHAVEKVTRA*
Ga0132256_10192967413300015372Arabidopsis RhizosphereAYRISTLSDYAVANALCLMCLIVAAAAAWFYLKHAAAERSRA*
Ga0132256_10374441113300015372Arabidopsis RhizosphereDVAYRISTHGDYPVANALCLLTLGLSAIGAAFYLRHASRSSRAATS*
Ga0187821_1012659723300017936Freshwater SedimentYRIATHGDYPVANALCLLSLALAAIGAVFYLRHAVAKAEGA
Ga0184604_1009052723300018000Groundwater SedimentHADYAVANALCLLSLLVAALGAAFYLRHAVRRSDA
Ga0187765_1006204313300018060Tropical PeatlandSTHADYPVANALCLLTLVLAAIGAVFYLRHAGVRAEGEASR
Ga0184609_1022997323300018076Groundwater SedimentISTHADYPVANALCLLSLALAAIGAVFYLRHAAAQVRGT
Ga0184629_1050711423300018084Groundwater SedimentDIAYRISTLGDYSVANALCLMSLIVAAGAAWFYLQHTAKKI
Ga0066667_1087500523300018433Grasslands SoilVAYRIKTFSDSAVAYAICLMSLALAAGGTWFYLRHAAARVDAR
Ga0190273_1091110813300018920SoilHGDYAVANALCLMSLVLASAGAWFYLREAARKAERA
Ga0212091_1038330413300022549GroundwaterSDYAVANALCLMSLLIAAAAAWIYLRHATARHTAAS
Ga0222623_1034410513300022694Groundwater SedimentYRISTHADYPVANALCLLSLALAAIGAVFYLRHAAAQVRGT
Ga0207699_1006348043300025906Corn, Switchgrass And Miscanthus RhizosphereAYRISTFADYAVANALCLLSLLLAAFGAAFYLRHAVQRVEVKG
Ga0207705_1076239723300025909Corn RhizosphereYRINTFADYAVANALCLLSLLLAAVGAAFYLRHAVKRVETGS
Ga0207684_1162706623300025910Corn, Switchgrass And Miscanthus RhizosphereFADYPVANALCLLSLVLAAGGAWFYLRHASKKIEVVA
Ga0207707_1094943113300025912Corn RhizosphereISTFADYAVANALCLLSLLLAAFGAAFYLRHAVRKVEGA
Ga0207657_1051300523300025919Corn RhizosphereGDYGVANALCLMSLVIAAVGAWFYLRHSLRNAEAVT
Ga0207649_1086533513300025920Corn RhizosphereGDYAVANALCLVSLLLAAVGAAFYLKHSVGQAERRA
Ga0207652_1059644823300025921Corn RhizosphereYRINTFADYAVANALCLLSLLVAAFGAAFYLRHAVRRAESGA
Ga0207659_1067688523300025926Miscanthus RhizosphereINTHSDYAVANALCLLSLLVAAGGAWFYLRHAVKGAEDKT
Ga0207690_1136949323300025932Corn RhizosphereINTFADYAVANALCLLTLLFAAFGAAFYLRHAVRRAEATS
Ga0207679_1164840113300025945Corn RhizosphereTFADYAVANTLCLLTLLFAAFGAAFYLRHAVRRAEATS
Ga0207668_1151686313300025972Switchgrass RhizosphereYRISTLSDYAVANALCLISLVVAAGAAWFYLQHAAREQARA
Ga0207658_1131176523300025986Switchgrass RhizosphereAYRINTHSDYAVANALCLLSLIVAAGGAAFYLRHAVKSAAATT
Ga0207676_1158164713300026095Switchgrass RhizosphereMSLLRTGAIYGVANALCLLSLLVAAGGAAFYLRHAVKGAEAAS
Ga0209156_1016960923300026547SoilVAYRISTLSDYAVANALCLLTLIVAAGGAWFYLRHAAAEGGRA
Ga0209798_1022198613300027843Wetland SedimentVAYRINTHADYAVANALCLLSLLVAAGGAAFYLRHAVKSAGAAS
Ga0209254_1039275713300027897Freshwater Lake SedimentAYRISTLSDYAVANALCLMSLVVAAAGAWFYLQHAKARQL
Ga0209668_1075548513300027899Freshwater Lake SedimentGDYAVANALCLVSLVFASLGAWVYLHHAVKRVGVA
Ga0209253_1048010113300027900Freshwater Lake SedimentSDYAVANALCLLSLLVAGGGAAFYLRHAVRSAGGTQ
Ga0307504_1010377113300028792SoilYRISTHGDYPVANALCLLSLALAAIGAVFYLRHAAAQVEGK
Ga0307503_1037752023300028802SoilSDYAVANALCLMSLLVAAAAAWMYLRHAVAQVART
Ga0302298_1009207523300029980FenHGDYPVANALCILSLALSGIGAAFYLRHASRTSTAAT
Ga0311350_1156997413300030002FenISTHGDYPVANALCLLTLGLSAIGAAFYLRHASRSSRAATS
Ga0310887_1045111623300031547SoilHGDYAVANALCLMSLVVAAFGAWFYLRQSSRALAK
Ga0302321_10128014523300031726FenYRINTHGDYPVANALCILSLALSAIGAAFYLRHASRTSTAAT
Ga0307473_1029425823300031820Hardwood Forest SoilSTHGDYPVANALCLLTLVLAAIGAVFYLRHAGASAEKR
Ga0308174_1023273723300031939SoilDVAYRINTFADYAVANALCLLSLLLAAVGAAFYLSHAVKRVEAG
Ga0308174_1111856823300031939SoilISTFADYAVANALCLLSLLLAAFGAAFYLRHAVRKVESA
Ga0315294_1067127113300031952SedimentYRINTHADYAVANALCLLSLLVAAGGAAFYLRHAVRSAGATS
Ga0307409_10272281823300031995RhizosphereHGDYAVANALCLVSLLFASLGAAIYLRHAVRRAELAP
Ga0307411_1070510923300032005RhizosphereDVAYRINTFADYAVANALCLLTLLLAAFGAAFYLRHAVRRAESTS
Ga0310906_1003731313300032013SoilVAYRISTLSDYAVANALCLMSLVVAAGGAWFYLQHSAKTIK
Ga0315284_1119287823300032053SedimentDYAVANALCLLSLLVAAGGAAFYLRHAVRSAGATS
Ga0308173_1019968033300032074SoilADYAVANALCLLSLLLAAFGAAFYLRHAVRRVEAP
Ga0307470_1179283213300032174Hardwood Forest SoilTLSDYAVANALCLMCLVVAAGAAWFYLQHAAAERSRT
Ga0307471_10347346023300032180Hardwood Forest SoilTVDVAYRINTHGDYAVANALCLMSLLLAAVGAAFYLRQAGRKADS
Ga0307472_10087555323300032205Hardwood Forest SoilYRISTHGDYPVANALCLLSLLLAAIGAVFYLRHAAAGAERS
Ga0307472_10133382013300032205Hardwood Forest SoilDYAVANALCLISLVVAAGGAAFYLRHAVKSAEGTG
Ga0307472_10160672123300032205Hardwood Forest SoilFGDYAVANALCLLSLILAAGGAWFYLHHAVEKVERA
Ga0316605_1057368713300033408SoilAYRISTLSDYAVANALCLMSLAVAAVGAWFYLQHAKRQTLSA
Ga0316619_1196311513300033414SoilRISTHGDYAVANALCLVSLVFASLGAWVYLHHAVKRVGVA
Ga0316622_10112417423300033416SoilINTHSDYGVANALCLASLALAAAGAWFYLRHAVARVEVAS
Ga0316601_10032501413300033419SoilTLSDYAVANALCLMSLAVAAVGAWFYLQHAKRQTLSA
Ga0326726_1105832013300033433Peat SoilGDYAVANALCLMSLVLASFGAWFYLREAAAKKADRT
Ga0316620_1089468123300033480SoilVAYRISTHGDYAVANALCLVSLVFASLGAWVYLHHAVKRVGVA
Ga0316627_10193703013300033482SoilSDYAVANALCLLSLLVAAGGAWFYLRHAARGARGEAVQ
Ga0314863_045725_1_1173300033804PeatlandSTHGDYAVANALCLLSLALAAIGAVFYLRHASARAEGG
Ga0373894_026969_710_8233300034074Sediment SlurryHADYGVANALCLASLVLAAAGAWFYLRHAVERAEDSG
Ga0364929_0255889_479_5893300034149SedimentHSDYAVANALCLMSLLVAAAAAWLYLRHAVRQHARQ
Ga0364923_0138952_515_6283300034690SedimentHSDYGVANALCLASLALAAAGAWFYLHHAVAKAESST

 ⦗Top⦘


Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.