NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome / Metatranscriptome Family F083185

Metagenome / Metatranscriptome Family F083185

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F083185
Family Type Metagenome / Metatranscriptome
Number of Sequences 113
Average Sequence Length 43 residues
Representative Sequence SIFDAEHGKITGVSLTLFRRDDRVVVDGDSSSPAVTQTRVVR
Number of Associated Samples 108
Number of Associated Scaffolds 113

Quality Assessment
Transcriptomic Evidence Yes
Most common taxonomic group Bacteria
% of genes with valid RBS motifs 0.00 %
% of genes near scaffold ends (potentially truncated) 98.23 %
% of genes from short scaffolds (< 2000 bps) 89.38 %
Associated GOLD sequencing projects 101
AlphaFold2 3D model prediction Yes
3D model pTM-score0.20

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Bacteria (80.531 % of family members)
NCBI Taxonomy ID 2
Taxonomy All Organisms → cellular organisms → Bacteria

Most Common Ecosystem
GOLD Ecosystem Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere
(10.620 % of family members)
Environment Ontology (ENVO) Unclassified
(21.239 % of family members)
Earth Microbiome Project Ontology (EMPO) Free-living → Non-saline → Soil (non-saline)
(43.363 % of family members)


 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      

 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Globular Signal Peptide: No Secondary Structure distribution: α-helix: 0.00%    β-sheet: 17.14%    Coil/Unstructured: 82.86%
Feature Viewer
Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer
Per-residue confidence (pLDDT):
  0-50   51-70   71-90   91-100  		pTM-score: 0.20
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.

 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 113 Family Scaffolds
PF00005ABC_tran 81.42
PF04963Sigma54_CBD 7.96
PF12399BCA_ABC_TP_C 5.31
PF00309Sigma54_AID 2.65
PF01040UbiA 0.88
PF03968LptD_N 0.88
PF02482Ribosomal_S30AE 0.88

Neighboring Clusters of Orthologous Genes (COGs)

COG IDNameFunctional Category % Frequency in 113 Family Scaffolds
COG1508DNA-directed RNA polymerase specialized sigma subunit, sigma54 homologTranscription [K] 10.62
COG1544Ribosome-associated translation inhibitor RaiATranslation, ribosomal structure and biogenesis [J] 0.88

 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms80.53 %
UnclassifiedrootN/A19.47 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
3300000156|NODE_c0586269All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter1494Open in IMG/M
3300001356|JGI12269J14319_10055638All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis2305Open in IMG/M
3300001471|JGI12712J15308_10052454All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter1035Open in IMG/M
3300002568|C688J35102_119910463All Organisms → cellular organisms → Bacteria → Acidobacteria811Open in IMG/M
3300004114|Ga0062593_100984571Not Available863Open in IMG/M
3300004156|Ga0062589_100133063All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter1667Open in IMG/M
3300004479|Ga0062595_100049222All Organisms → cellular organisms → Bacteria → Acidobacteria1914Open in IMG/M
3300004479|Ga0062595_100319610All Organisms → cellular organisms → Bacteria → Acidobacteria1060Open in IMG/M
3300004480|Ga0062592_100002530All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter5602Open in IMG/M
3300004643|Ga0062591_102711085All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter524Open in IMG/M
3300004803|Ga0058862_12540684All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter560Open in IMG/M
3300005166|Ga0066674_10327296All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter720Open in IMG/M
3300005335|Ga0070666_10880457All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium661Open in IMG/M
3300005365|Ga0070688_100953347Not Available679Open in IMG/M
3300005434|Ga0070709_10047733All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter2668Open in IMG/M
3300005436|Ga0070713_100727305All Organisms → cellular organisms → Bacteria → Acidobacteria948Open in IMG/M
3300005437|Ga0070710_10734796All Organisms → cellular organisms → Bacteria → Acidobacteria699Open in IMG/M
3300005438|Ga0070701_10980917All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae588Open in IMG/M
3300005467|Ga0070706_101731224All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium569Open in IMG/M
3300005533|Ga0070734_10051112All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter2508Open in IMG/M
3300005535|Ga0070684_101921327All Organisms → cellular organisms → Bacteria → Acidobacteria559Open in IMG/M
3300005536|Ga0070697_101357071All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium635Open in IMG/M
3300005545|Ga0070695_100474569All Organisms → cellular organisms → Bacteria → Acidobacteria963Open in IMG/M
3300005555|Ga0066692_10524768All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae752Open in IMG/M
3300005557|Ga0066704_10348694All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae993Open in IMG/M
3300005560|Ga0066670_10494371All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter752Open in IMG/M
3300005561|Ga0066699_11110359All Organisms → cellular organisms → Bacteria545Open in IMG/M
3300005576|Ga0066708_10266842All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter1091Open in IMG/M
3300005617|Ga0068859_102172509All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium613Open in IMG/M
3300005712|Ga0070764_11103437All Organisms → cellular organisms → Bacteria503Open in IMG/M
3300005841|Ga0068863_100065442All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter3439Open in IMG/M
3300005921|Ga0070766_10055477All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter2240Open in IMG/M
3300005993|Ga0080027_10320224Not Available619Open in IMG/M
3300005995|Ga0066790_10449795All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter551Open in IMG/M
3300006162|Ga0075030_100320762All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae1237Open in IMG/M
3300006172|Ga0075018_10609049All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium582Open in IMG/M
3300006173|Ga0070716_100608745All Organisms → cellular organisms → Bacteria → Acidobacteria823Open in IMG/M
3300006173|Ga0070716_101135773Not Available625Open in IMG/M
3300006794|Ga0066658_10503943All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae659Open in IMG/M
3300006914|Ga0075436_101179055All Organisms → cellular organisms → Bacteria → Acidobacteria578Open in IMG/M
3300009101|Ga0105247_10770876All Organisms → cellular organisms → Bacteria → Acidobacteria731Open in IMG/M
3300009174|Ga0105241_10476208All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae1109Open in IMG/M
3300009177|Ga0105248_12013266Not Available656Open in IMG/M
3300009545|Ga0105237_12315466All Organisms → cellular organisms → Bacteria547Open in IMG/M
3300009700|Ga0116217_10762337Not Available597Open in IMG/M
3300010049|Ga0123356_11181469Not Available932Open in IMG/M
3300010358|Ga0126370_11607459Not Available622Open in IMG/M
3300010371|Ga0134125_10823547Not Available1021Open in IMG/M
3300010376|Ga0126381_103685314Not Available600Open in IMG/M
3300010400|Ga0134122_10583219Not Available1029Open in IMG/M
3300011110|Ga0138578_1039035Not Available1451Open in IMG/M
3300012212|Ga0150985_101397896All Organisms → cellular organisms → Bacteria → Acidobacteria566Open in IMG/M
3300012351|Ga0137386_10786387All Organisms → cellular organisms → Bacteria → Acidobacteria683Open in IMG/M
3300012353|Ga0137367_10149827All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter1703Open in IMG/M
3300012362|Ga0137361_11083012All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium722Open in IMG/M
3300012469|Ga0150984_114267079Not Available623Open in IMG/M
3300012923|Ga0137359_11213329All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium642Open in IMG/M
3300012951|Ga0164300_10462481All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium715Open in IMG/M
3300012975|Ga0134110_10488804All Organisms → cellular organisms → Bacteria558Open in IMG/M
3300013105|Ga0157369_10000481All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae52974Open in IMG/M
3300013296|Ga0157374_12228416All Organisms → cellular organisms → Bacteria → Acidobacteria575Open in IMG/M
3300013296|Ga0157374_12340353All Organisms → cellular organisms → Bacteria → Acidobacteria561Open in IMG/M
3300013306|Ga0163162_10404531All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis1498Open in IMG/M
3300015242|Ga0137412_11269348All Organisms → cellular organisms → Bacteria515Open in IMG/M
3300015371|Ga0132258_10153004All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis5536Open in IMG/M
3300015374|Ga0132255_100147541All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis3275Open in IMG/M
3300016387|Ga0182040_11524003All Organisms → cellular organisms → Bacteria → Acidobacteria568Open in IMG/M
3300016698|Ga0181503_1109009All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1242Open in IMG/M
3300017656|Ga0134112_10322082All Organisms → cellular organisms → Bacteria → Acidobacteria625Open in IMG/M
3300017657|Ga0134074_1110458All Organisms → cellular organisms → Bacteria → Acidobacteria948Open in IMG/M
3300017928|Ga0187806_1233620Not Available632Open in IMG/M
3300017930|Ga0187825_10168951All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium778Open in IMG/M
3300017943|Ga0187819_10656682Not Available593Open in IMG/M
3300017995|Ga0187816_10047491All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis1787Open in IMG/M
3300017998|Ga0187870_1176209All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium765Open in IMG/M
3300018007|Ga0187805_10641129All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis503Open in IMG/M
3300019786|Ga0182025_1108527All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium690Open in IMG/M
3300020070|Ga0206356_11159533All Organisms → cellular organisms → Bacteria → Acidobacteria923Open in IMG/M
3300021088|Ga0210404_10812332All Organisms → cellular organisms → Bacteria534Open in IMG/M
3300021432|Ga0210384_11369631Not Available612Open in IMG/M
3300021475|Ga0210392_10590807All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium823Open in IMG/M
3300021560|Ga0126371_13641447All Organisms → cellular organisms → Bacteria520Open in IMG/M
3300023259|Ga0224551_1073082Not Available601Open in IMG/M
3300025505|Ga0207929_1098469All Organisms → cellular organisms → Bacteria547Open in IMG/M
3300025625|Ga0208219_1129634Not Available559Open in IMG/M
3300025864|Ga0209429_10205532All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium798Open in IMG/M
3300025905|Ga0207685_10109161All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis1196Open in IMG/M
3300025911|Ga0207654_11243294All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium543Open in IMG/M
3300025916|Ga0207663_10165233All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis1567Open in IMG/M
3300025928|Ga0207700_10257500All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis1493Open in IMG/M
3300026088|Ga0207641_11442845All Organisms → cellular organisms → Bacteria → Acidobacteria689Open in IMG/M
3300026330|Ga0209473_1237161Not Available643Open in IMG/M
3300027432|Ga0209421_1116062All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium550Open in IMG/M
3300027812|Ga0209656_10193654All Organisms → cellular organisms → Bacteria → Acidobacteria990Open in IMG/M
3300027846|Ga0209180_10523183All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium662Open in IMG/M
3300028381|Ga0268264_11900271All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium605Open in IMG/M
3300028906|Ga0308309_11176856All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium661Open in IMG/M
3300029910|Ga0311369_11193491All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium588Open in IMG/M
3300030057|Ga0302176_10366329All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium580Open in IMG/M
3300030531|Ga0210274_1428828Not Available504Open in IMG/M
3300030815|Ga0265746_1025368All Organisms → cellular organisms → Bacteria → Acidobacteria741Open in IMG/M
3300031057|Ga0170834_109411819All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium565Open in IMG/M
3300031122|Ga0170822_16301287All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae565Open in IMG/M
3300031231|Ga0170824_100642345All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium571Open in IMG/M
3300031231|Ga0170824_128425580All Organisms → cellular organisms → Bacteria → Acidobacteria731Open in IMG/M
3300031469|Ga0170819_10845377All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis1236Open in IMG/M
3300031474|Ga0170818_110146353All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae1110Open in IMG/M
3300031890|Ga0306925_10901855All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis909Open in IMG/M
3300032828|Ga0335080_11228642All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium752Open in IMG/M
3300033412|Ga0310810_10226016All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter2086Open in IMG/M
3300033412|Ga0310810_10650648All Organisms → cellular organisms → Bacteria → Acidobacteria996Open in IMG/M


 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
Corn, Switchgrass And Miscanthus RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere10.62%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Soil7.08%
Vadose Zone SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil5.31%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil5.31%
Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil5.31%
Freshwater SedimentEnvironmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment4.42%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil3.54%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil3.54%
Switchgrass RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere3.54%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil2.65%
Grasslands SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil2.65%
Surface SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil2.65%
Peatlands SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil2.65%
Arctic Peat SoilEnvironmental → Terrestrial → Soil → Unclassified → Permafrost → Arctic Peat Soil2.65%
SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Soil2.65%
Corn RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere2.65%
PeatlandEnvironmental → Aquatic → Freshwater → Wetlands → Bog → Peatland1.77%
WatershedsEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds1.77%
Terrestrial SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil1.77%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil1.77%
Forest SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil1.77%
PalsaEnvironmental → Terrestrial → Peat → Unclassified → Unclassified → Palsa1.77%
Arabidopsis RhizosphereHost-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere1.77%
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere1.77%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere1.77%
Bog Forest SoilEnvironmental → Aquatic → Freshwater → Wetlands → Bog → Bog Forest Soil0.89%
Corn, Switchgrass And Miscanthus RhizosphereEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Corn, Switchgrass And Miscanthus Rhizosphere0.89%
SoilEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Soil0.89%
SoilEnvironmental → Terrestrial → Soil → Wetlands → Permafrost → Soil0.89%
Prmafrost SoilEnvironmental → Terrestrial → Soil → Wetlands → Permafrost → Prmafrost Soil0.89%
PermafrostEnvironmental → Terrestrial → Soil → Wetlands → Permafrost → Permafrost0.89%
SoilEnvironmental → Terrestrial → Soil → Loam → Grasslands → Soil0.89%
Corn RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere0.89%
Switchgrass RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Switchgrass Rhizosphere0.89%
SoilEnvironmental → Terrestrial → Peat → Unclassified → Unclassified → Soil0.89%
Host-AssociatedHost-Associated → Human → Digestive System → Large Intestine → Fecal → Host-Associated0.89%
Termite GutHost-Associated → Arthropoda → Digestive System → Gut → Unclassified → Termite Gut0.89%
Avena Fatua RhizosphereHost-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Avena Fatua Rhizosphere0.89%
Switchgrass RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere0.89%
Populus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere0.89%
Corn RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere0.89%
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere0.89%
Avena Fatua RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Avena Fatua Rhizosphere0.89%
Sugar Cane Bagasse Incubating BioreactorEngineered → Solid Waste → Grass → Composting → Bioreactor → Sugar Cane Bagasse Incubating Bioreactor0.89%

Visualization
Powered by ApexCharts



Associated Samples

Taxon OIDSample NameHabitat TypeIMG/M Link
3300000156Sugar cane bagasse incubating bioreactor microbial communities from Sao Carlos, Brazil, that are aerobic and semianaerobicEngineeredOpen in IMG/M
3300001356Peat soil microbial communities from Weissenstadt, Germany - SII-SIP-2007EnvironmentalOpen in IMG/M
3300001471Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_Ref_O2EnvironmentalOpen in IMG/M
3300002568Grasslands soil microbial communities from Hopland, California, USA - 2EnvironmentalOpen in IMG/M
3300004114Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of AARS Block 5EnvironmentalOpen in IMG/M
3300004156Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Combined assembly of AARS Block 1EnvironmentalOpen in IMG/M
3300004479Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of All WPAsEnvironmentalOpen in IMG/M
3300004480Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of AARS Block 4EnvironmentalOpen in IMG/M
3300004643Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Combined assembly of AARS Block 3EnvironmentalOpen in IMG/M
3300004803Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-2 (Metagenome Metatranscriptome)Host-AssociatedOpen in IMG/M
3300005166Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_123EnvironmentalOpen in IMG/M
3300005335Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaGHost-AssociatedOpen in IMG/M
3300005365Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaGEnvironmentalOpen in IMG/M
3300005434Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaGEnvironmentalOpen in IMG/M
3300005436Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaGEnvironmentalOpen in IMG/M
3300005437Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaGEnvironmentalOpen in IMG/M
3300005438Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaGEnvironmentalOpen in IMG/M
3300005467Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaGEnvironmentalOpen in IMG/M
3300005532Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen14_06102014_R1EnvironmentalOpen in IMG/M
3300005533Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen06_05102014_R1EnvironmentalOpen in IMG/M
3300005535Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaGEnvironmentalOpen in IMG/M
3300005536Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaGEnvironmentalOpen in IMG/M
3300005545Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaGEnvironmentalOpen in IMG/M
3300005555Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_141EnvironmentalOpen in IMG/M
3300005557Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_153EnvironmentalOpen in IMG/M
3300005560Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_119EnvironmentalOpen in IMG/M
3300005561Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_148EnvironmentalOpen in IMG/M
3300005576Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_157EnvironmentalOpen in IMG/M
3300005617Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2Host-AssociatedOpen in IMG/M
3300005712Warmed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WRM 4EnvironmentalOpen in IMG/M
3300005841Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2Host-AssociatedOpen in IMG/M
3300005921Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 6EnvironmentalOpen in IMG/M
3300005993Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Organic soil replicate 1 DNA2013-046EnvironmentalOpen in IMG/M
3300005995Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Organic soil replicate 3 DNA2013-050EnvironmentalOpen in IMG/M
3300006162Freshwater sediment microbial communities from Pennsylvania, USA - Little Laurel Run_MetaG_LLR_2012EnvironmentalOpen in IMG/M
3300006172Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Cold Stream Run_MetaG_CSR_2014EnvironmentalOpen in IMG/M
3300006173Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaGEnvironmentalOpen in IMG/M
3300006794Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_107EnvironmentalOpen in IMG/M
3300006914Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5Host-AssociatedOpen in IMG/M
3300009101Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaGHost-AssociatedOpen in IMG/M
3300009174Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaGHost-AssociatedOpen in IMG/M
3300009177Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaGHost-AssociatedOpen in IMG/M
3300009545Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaGHost-AssociatedOpen in IMG/M
3300009700Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_4_PS metaGEnvironmentalOpen in IMG/M
3300010049Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3Host-AssociatedOpen in IMG/M
3300010358Tropical forest soil microbial communities from Panama - MetaG Plot_3EnvironmentalOpen in IMG/M
3300010371Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-1EnvironmentalOpen in IMG/M
3300010376Tropical forest soil microbial communities from Panama - MetaG Plot_28EnvironmentalOpen in IMG/M
3300010400Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-2EnvironmentalOpen in IMG/M
3300011110Peat soil microbial communities from Weissenstadt, Germany - Metatranscriptome 65 (Metagenome Metatranscriptome) (version 2)EnvironmentalOpen in IMG/M
3300012212Combined assembly of Hopland grassland soilHost-AssociatedOpen in IMG/M
3300012351Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_100_16 metaGEnvironmentalOpen in IMG/M
3300012353Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_80_16 metaGEnvironmentalOpen in IMG/M
3300012362Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_80_16 metaGEnvironmentalOpen in IMG/M
3300012469Combined assembly of Soil carbon rhizosphereHost-AssociatedOpen in IMG/M
3300012923Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_40_16 metaGEnvironmentalOpen in IMG/M
3300012951Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_226_MGEnvironmentalOpen in IMG/M
3300012975Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_5_11112015EnvironmentalOpen in IMG/M
3300013105Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaGHost-AssociatedOpen in IMG/M
3300013296Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaGHost-AssociatedOpen in IMG/M
3300013306Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaGHost-AssociatedOpen in IMG/M
3300015242Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_16fungal (Hybrid Assembly)EnvironmentalOpen in IMG/M
3300015371Combined assembly of cpr5 and col0 rhizosphere and soilHost-AssociatedOpen in IMG/M
3300015374Col-0 rhizosphere combined assemblyHost-AssociatedOpen in IMG/M
3300016387Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.176EnvironmentalOpen in IMG/M
3300016698Metatranscriptome of peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin02_30_metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300017656Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_5_11112015EnvironmentalOpen in IMG/M
3300017657Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_2_09212015EnvironmentalOpen in IMG/M
3300017928Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - ASW_1EnvironmentalOpen in IMG/M
3300017930Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SourceSoil_5EnvironmentalOpen in IMG/M
3300017943Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_4EnvironmentalOpen in IMG/M
3300017995Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_1EnvironmentalOpen in IMG/M
3300017998Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_13_150EnvironmentalOpen in IMG/M
3300018007Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - Control_5EnvironmentalOpen in IMG/M
3300019786Permafrost microbial communities from Stordalen Mire, Sweden - P3-2 metaG (PacBio error correction)EnvironmentalOpen in IMG/M
3300020070Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2)EnvironmentalOpen in IMG/M
3300021088Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-28-MEnvironmentalOpen in IMG/M
3300021432Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-MEnvironmentalOpen in IMG/M
3300021475Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-30-OEnvironmentalOpen in IMG/M
3300021560Tropical forest soil microbial communities from Panama - MetaG Plot_4EnvironmentalOpen in IMG/M
3300023259Peat soil microbial communities from Stordalen Mire, Sweden - 717 P3 20-24EnvironmentalOpen in IMG/M
3300025505Arctic peat soil from Barrow, Alaska - NGEE Surface sample 53-1 deep-072012 (SPAdes)EnvironmentalOpen in IMG/M
3300025625Arctic peat soil from Barrow, Alaska - NGEE Surface sample 53-2 shallow-072012 (SPAdes)EnvironmentalOpen in IMG/M
3300025864Arctic peat soil from Barrow, Alaska - Barrow Graham LP Ref core NGADG0004-212 (SPAdes)EnvironmentalOpen in IMG/M
3300025905Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025911Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025916Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025928Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300026088Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300026330Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_133 (SPAdes)EnvironmentalOpen in IMG/M
3300027432Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM2_O2 (SPAdes)EnvironmentalOpen in IMG/M
3300027773Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen14_06102014_R1 (SPAdes)EnvironmentalOpen in IMG/M
3300027812Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP12_OM2 (SPAdes)EnvironmentalOpen in IMG/M
3300027846Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H2.8 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300028381Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300028906Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 5 (v2)EnvironmentalOpen in IMG/M
3300029910III_Palsa_E2 coassemblyEnvironmentalOpen in IMG/M
3300030057Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Palsa_E1_1EnvironmentalOpen in IMG/M
3300030531Metatranscriptome of forest soil microbial communities from Boreal Montmorency Forest, Quebec, Canada - FO143-VCO038SO (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300030815Metatranscriptome of soil microbial communities from Maridalen valley, Oslo, Norway - NSU2 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300031057Oak Coassembly Site 11 - Champenoux / Amance forestEnvironmentalOpen in IMG/M
3300031122Oak Spring Coassembly Site 11 - Champenoux / Amance forestEnvironmentalOpen in IMG/M
3300031231Coassembly Site 11 (all samples) - Champenoux / Amance forestEnvironmentalOpen in IMG/M
3300031469Fir Spring Coassembly Site 11 - Champenoux / Amance forestEnvironmentalOpen in IMG/M
3300031474Fir Coassembly Site 11 - Champenoux / Amance forestEnvironmentalOpen in IMG/M
3300031890Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.176 (v2)EnvironmentalOpen in IMG/M
3300032828Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.4EnvironmentalOpen in IMG/M
3300033412Soil microbial communities from experimental microcosm in Duke University, North Carolina, United States - NCEnvironmentalOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap


 ⦗Top⦘

Family Sequences

Protein ID Sample Taxon ID Habitat Sequence
NODE_058626913300000156Sugar Cane Bagasse Incubating BioreactorFDAEHGKITAVSLTLFRRDGRVVVEGDKSSPAVTETKVVR*
JGI12269J14319_1005563833300001356Peatlands SoilAEQGKITGVSLTFFRRDDRVLVEGEASTPVVTQTRVAH*
JGI12712J15308_1005245433300001471Forest SoilERGKISGDSLTFYRHDDKVLVEGKQTSPTVTQTHVAR*
C688J35102_11991046313300002568SoilLTGGPPCIFDAEHGKITGVSLTLFRHDDRVVVEGDSRSPAVTQTRMER*
Ga0062593_10098457123300004114SoilPSIFDAEHGKITGVSLTLFRHDDRVVVEGDSRSPAVTQTRMER*
Ga0062589_10013306333300004156SoilGGPPSIFDAEHGKITAVSLTLFRRDGRVVVEGDKSSPAVTETKVVR*
Ga0062595_10004922233300004479SoilPSIFDAEHGKITAVSLTLFRRDGRVVVEGDKSSPAVTETKVVR*
Ga0062595_10031961023300004479SoilPSIFDAEHGKITGVSLTLYRRDDRVVVEGNSSSPAITQTRVVR*
Ga0062592_10000253073300004480SoilDAEHGKITAVSLTLFRRDGRVVVEGDKSSPAVTETKVVR*
Ga0062591_10271108513300004643SoilLTGGPPSIFDAERGKITGDSLTFYRRDDRVVVEGRETSPTSTTVRVAR*
Ga0058862_1254068413300004803Host-AssociatedSIFDAERGQITGDSLTFYSRNDTVQVEGGSSPSITQTRVAK*
Ga0066674_1032729613300005166SoilSDDKFVLTGGSPSIFDTEHGKITGVSLTLYRRDDRVVVDGDSSSPAVTQTRVVR*
Ga0070666_1088045723300005335Switchgrass RhizosphereFVLTGGSPSIFDAEHGKITGVSLTLFRHDGRVLVEGNNTSPTVTTTRVAR*
Ga0070688_10095334713300005365Switchgrass RhizosphereKFVLTGGPPSIFDAEHGKITAVSLTLFRRDGRVVVEGDKSSPAVTETKVVR*
Ga0070709_1004773313300005434Corn, Switchgrass And Miscanthus RhizosphereGGPPSIFDAEHGKITAVSLTLFRRDGRVVVEGDSKSPAVTETKVVR*
Ga0070713_10072730523300005436Corn, Switchgrass And Miscanthus RhizosphereGPPSIFDAERGKITGVSLTLFRRDDRVIVDGNSSLPAVTNTRVVR*
Ga0070710_1073479613300005437Corn, Switchgrass And Miscanthus RhizosphereTGGPPSIFDAEHGKITAVSLTLFRRDGRVVVEGDSKSPAVTETKVVR*
Ga0070701_1098091723300005438Corn, Switchgrass And Miscanthus RhizosphereGGPPSIFDAEQGKITGVSLTLFRRDDRVLIEGDSASPVVTQTRVAR*
Ga0070706_10173122423300005467Corn, Switchgrass And Miscanthus RhizosphereSIFDAEQGKITGVSLTLFRHDGRVVVEGNNTSPTVTQTRVAR*
Ga0070739_1006108623300005532Surface SoilVRTASTFNAEHCKITAVSLTLYRTDDRVILDGSSSSHAVTENKVER*
Ga0070734_1005111233300005533Surface SoilEQGKITGVSLTFFRRDDRVLVEGGASAPVVTQTRVAQ*
Ga0070684_10192132723300005535Corn RhizosphereIFDAEHGKITAVSLTLFRRDGRVVVEGDKGSPAVTETKVVR*
Ga0070697_10135707123300005536Corn, Switchgrass And Miscanthus RhizosphereGPPSIFDAEQGKITGVSLTLFRHDGRVVVEGNNTSPTVTQTRVAR*
Ga0070695_10047456913300005545Corn, Switchgrass And Miscanthus RhizosphereLTGGPPSIFDAEHGKITAVSLTLFRRDGRVVVEGDKSSPAVTETKVVR*
Ga0066692_1052476813300005555SoilTGGPPSIFDAEHGKITGVSLTLFRRDDRVVVEGDSRSPAVTQTRMER*
Ga0066704_1034869413300005557SoilSPSIFDAEHGKITGVSLTLYRRDDRVVVDGDSSSPAVTQTRVVR*
Ga0066670_1049437113300005560SoilGGPPSIFDAEHGKITGVSLTFFRGDDRVVIEGSQALPTVTQTRVAR*
Ga0066699_1111035923300005561SoilSIFDAEHGKITGVSLTLFRRDDRVVVDGDSSSPAVTQTRVVR*
Ga0066708_1026684213300005576SoilYTSEDDRFILTGGPPSIFDAERGRITGVSLTLFRRDDRVIVDGSSSLPAVTNTRVVR*
Ga0068859_10217250913300005617Switchgrass RhizosphereKFVLTGGPPSIFDAEHGKITGVSLTFFRRDARVLVEGNSGSPAVTQTRVAR*
Ga0070764_1110343713300005712SoilGKITGVSLTFFRGDDRVLVEGEASTPVVTQTRVAR*
Ga0068863_10006544213300005841Switchgrass RhizosphereIFDAEHGKITGVSLTFFRGDDRVVIEGSQALPTVTQTRVAR*
Ga0070766_1005547733300005921SoilGKITGVSLTFFRGDDRVLVEGEASTPVVTQTRVAK*
Ga0080027_1032022413300005993Prmafrost SoilSIFDAEHGKITGVSLTLYRRDDRVVVEGDRSSPAVTQTRVVR*
Ga0066790_1044979523300005995SoilEQGKITGVSLTFFRRDDRVLVEGEASTPVVTQTRVAR*
Ga0075030_10032076213300006162WatershedsPPSIFDAERGKITGVSLTFFRRDDTVLVEGGASTPVVTQTRVAR*
Ga0075018_1060904913300006172WatershedsDAEQGKITGVSLTLFRHDGRVLVEGNNTSPTVTQTRVAR*
Ga0070716_10060874523300006173Corn, Switchgrass And Miscanthus RhizosphereEHGKITGVSLTLFRRDDRVIVDGSSSLPAVTNTRVVR*
Ga0070716_10113577323300006173Corn, Switchgrass And Miscanthus RhizosphereKITGVSLTFFRRDDRVLVEGGTSTPVVTTTRVAH*
Ga0066658_1050394323300006794SoilDDKFVLTGGSPSIFDTEHGKITGVSLTLYRRDDRVVVDGDSSSPAVTQTRVVR*
Ga0075436_10117905513300006914Populus RhizosphereTGGPPSIFDAERGKITGVSLTLFRRDDRVIVDGNSSLPAVTNTRVVR*
Ga0105247_1077087613300009101Switchgrass RhizosphereEHGKITAVSLTLFRRDGRVVVEGDKSSPAVTETKVVR*
Ga0105241_1047620833300009174Corn RhizosphereDDKFVLTGGSPSIFDAEHGKITGVSLTLFRHDGRVLVEGNNTSPTVTTTRVAR*
Ga0105248_1201326613300009177Switchgrass RhizosphereTGGPPSIFDAEHGKITGVSLTFFRGDDRVVIEGSQALPTVTQTRVAR*
Ga0105237_1231546623300009545Corn RhizospherePSIFDAEHGKITAVSLTLFRRDGRVVVEGDKGSPAVTETKVVR*
Ga0116217_1076233713300009700Peatlands SoilRGKTTGDSLTFYKHDDRVLVEGKETSPAVTRTQVAR*
Ga0123356_1118146923300010049Termite GutDAEHGKTTGVSLTLFRTDDRVIVDGSSSSPAVTETRVER*
Ga0126370_1160745913300010358Tropical Forest SoilPSIFDAEHGKITGVSLTFFRGDGRVVIEGNEALPTVTQTRVAR*
Ga0134125_1082354723300010371Terrestrial SoilLSGNSPSIFDAEHGKITGVSLTFFRHDDRVLIEGSSQFPAVTHTQMAR*
Ga0126381_10368531413300010376Tropical Forest SoilSIFDAERGKITGVSLTLFRHDDRVIVEGNSRSPAVTKMRMER*
Ga0134122_1058321933300010400Terrestrial SoilDDKFVLTGGSPSIFDAEHGKITGVSLTLFRHDGRVLGEGNNTSPTVTTTRVAR*
Ga0138578_103903543300011110Peatlands SoilGKITGVSLTFYKRDDRVLVEGEASTPVVTQTRVAR*
Ga0150985_10139789623300012212Avena Fatua RhizosphereIFDAEHGKITAVSLTLFRRDGRVVVEGDSKSPAVTETKVVR*
Ga0137386_1078638713300012351Vadose Zone SoilGPPSIFDAERGKITGVSLTLFRRDDRVVVEGDSSSPAVTQTRVVR*
Ga0137367_1014982713300012353Vadose Zone SoilSIFDAEHGKITAVSLTLFRRDGRVVVEGDSKSPAVTETKVVR*
Ga0137361_1108301223300012362Vadose Zone SoilFDAEHGKITGVSLTLFRHDDRVVVEGNDTSPTVTQTQVAR*
Ga0150984_11426707923300012469Avena Fatua RhizospherePPSIFDAERGKITGVSLTLFRRDDRVIVDGSSSLPAVTNTRVVR*
Ga0137359_1121332913300012923Vadose Zone SoilKITGVSLTFFRRDDRVLVEGEASTPVVTQTRVAR*
Ga0164300_1046248123300012951SoilVLTGGSPSIFDAEHGKITGVSLTLFRHDGRVLVEGNNTSPTVTQTRVAR*
Ga0134110_1048880423300012975Grasslands SoilFVLTGGSPSIFDTEHGKITGVSLTLYRRDDRVVVDGDSSSPAVTQTRVVR*
Ga0157369_1000048113300013105Corn RhizosphereDDKFVLTGGPPSIFDAEHGKITAVSLTLFRRDGRVVVEGDKSSPAVTETKVVR*
Ga0157374_1222841623300013296Miscanthus RhizosphereFDAEHGKITAVSLTLFRRDGRVVVEGDKGSPAVTETKVVR*
Ga0157374_1234035313300013296Miscanthus RhizosphereIFDAEHGKITGVSLTLFRHDDRVVVEEDSRSPAVTQTRMER*
Ga0163162_1040453113300013306Switchgrass RhizosphereIFDAEHGKITGVSLTFFRRDARVLVEGNSGSPAVTQTRVAR*
Ga0137412_1126934813300015242Vadose Zone SoilIFDAEHGKITGVSLTLFRGDDRVVVEGDSKSPAVTQTRVVR*
Ga0132258_1015300473300015371Arabidopsis RhizosphereEDKFVLTGGPPSIFDAEHGKITAVSLTLFRRDGRVVVEGDKSSPAVTETKVVR*
Ga0132255_10014754143300015374Arabidopsis RhizosphereDKFVLTGGPPSIFDAEHGKITAVSLTLFRRDGRVVVEGDKSSPAVTETKVVR*
Ga0182040_1152400313300016387SoilGKITGVSLTYFRRDDRVVVEGDSRLPAVTHTRVVR
Ga0181503_110900933300016698PeatlandGKITGVSLTFFRADDRVLVEGEASTPVVTQTRVAK
Ga0134112_1032208223300017656Grasslands SoilEDDRFILTGGPPSIFDAERGKITGVSLTLFRRDDRVIVDGSSSLPAVTNTRVVR
Ga0134074_111045813300017657Grasslands SoilTYTASDDKFVLTGGSPSIFDTEHGKITGVSLTLYRRDDRVVVDGDSSSPAVTQTRVVR
Ga0187806_123362023300017928Freshwater SedimentFDAERGKITGVSLTFFRADDRVLVEGKASTPVVTQSRMAR
Ga0187825_1016895113300017930Freshwater SedimentQGKITGVSLTFFRRDDRVLVEGGASTPVVTQTRVAP
Ga0187819_1065668223300017943Freshwater SedimentAEQGKITGDSLTFYRHDDRVLVEGRITSPAVTRTQVAR
Ga0187816_1004749113300017995Freshwater SedimentEQGKITGVSLTFFRRDDRVLVEGEANTPVVTQTRVAK
Ga0187870_117620923300017998PeatlandAERGKTTGDSLTFYRHDDRVLVEGREKSPAVTRTQVAR
Ga0187805_1064112913300018007Freshwater SedimentGQVTGDSLTFYSHDDRVLVEGGNTSPTVTKARVIK
Ga0182025_110852713300019786PermafrostFDAERGKITGVSLTFFRGDDRVLVEGEASTPVVTQTRLAK
Ga0206356_1115953323300020070Corn, Switchgrass And Miscanthus RhizospherePSIFDAERGQLTGVSLTLFRRDDRVIGDGNSSLPAVTNTRVVR
Ga0210404_1081233213300021088SoilDDKFVLKGGSPSIFDAEQGKITGVSLTLFRHDGRVVVEGNNTSPTVTQTRVAR
Ga0210384_1136963113300021432SoilLKGGSPSIFDAEQGKITGVSLTLFRHDGRVVVEGNNTSPTVTQTRVAR
Ga0210392_1059080723300021475SoilGKITGASLTFFRRDDRVLVEGEASTPVVTQTRVAR
Ga0126371_1364144723300021560Tropical Forest SoilCIFDAEHGKITAVSLTLFRRDGRVVVEGDKSSPAVTETKVVR
Ga0224551_107308223300023259SoilEHGNVTGDSLTLYGHDARVLVEGSKQSPAVTEIRVAR
Ga0207929_109846923300025505Arctic Peat SoilPSIFDAEHGVVTGVSLTLFGHDGRVLVEGNDKSPAVTEIRVAR
Ga0208219_112963423300025625Arctic Peat SoilAEHGNVTGDSLTLYGHDARVLVEGSKQSPAVTEIRVAR
Ga0209429_1020553223300025864Arctic Peat SoilERGKITGDSLTFFQRDDRVLVESRSSPTVTRTRVAK
Ga0207685_1010916133300025905Corn, Switchgrass And Miscanthus RhizosphereGKITGVSLTLYRHDDRVIVEGDGSSPAVTETTVVR
Ga0207654_1124329413300025911Corn RhizosphereQGKITGVSLTLFRHDDRVLVEGNAASPVVTQTRVAR
Ga0207663_1016523333300025916Corn, Switchgrass And Miscanthus RhizospherePSIFDAEHGKITAVSLTLFRRDGRVVVEGDSKSPAVTETKVVR
Ga0207700_1025750013300025928Corn, Switchgrass And Miscanthus RhizosphereIFDAEHGKITAVSLTLFRRDGRVVVEGDSKSPAVTETKVVR
Ga0207641_1144284523300026088Switchgrass RhizosphereKFVLTGGPPSIFDAEHGKITAVSLTLFRRDGRVVVEGDKSSPAVTETKVVR
Ga0209473_123716113300026330SoilGGSPSIFDAERGKVTGVSLTLYRHDDRVVVDGSSSLPAVSKTQVVR
Ga0209421_111606223300027432Forest SoilDAEHGKITGVSLTLFRHDDNVLVEGNETSPSVTQTRVAR
Ga0209810_105761323300027773Surface SoilVRTASTFNAEHCKITAVSLTLYRTDDRVILDGSSSSHAVTENKVER
Ga0209656_1019365413300027812Bog Forest SoilEHGKITGVSLTLYRRDDRVVVEGDSSSPAVTQTRVVR
Ga0209180_1052318323300027846Vadose Zone SoilAERGKITGVSLTFFRRDGRVLVEGEASTPVVTQTRMAR
Ga0268264_1190027113300028381Switchgrass RhizosphereGGPPSIFDAEQGKITGVSLTLFRRDDRVLIEGDSASPVVTQTRVAR
Ga0308309_1117685613300028906SoilEQGKVTGVSLTFFRADDRVLVEGEASTPVVTQTRVAR
Ga0311369_1119349123300029910PalsaQGKITGVSLTFFRGDDRVLVEGEASTPVVTQTRVGK
Ga0302176_1036632913300030057PalsaGKITGVSLTFFRADDRVLVEGKASTPVVTQTRVAR
Ga0210274_142882823300030531SoilGKITGVSLTFFRRDDRVLVEGGASPPVVTQTRVAP
Ga0265746_102536823300030815SoilDAEQGKITGVSLTFFRGDDRVLVEGDVTPVVTQTRVAK
Ga0170834_10941181913300031057Forest SoilQGKITGVSLTFFRRDDRVLVEGEASTPVVTQTRVAR
Ga0170822_1630128733300031122Forest SoilGKITGVSLTFFRRDDRVLVEGEANTPVVTQTRVAR
Ga0170824_10064234513300031231Forest SoilAEHGKITGVSLTLFRHDGRVLIEGNNTSPTVTQTQVAR
Ga0170824_12842558013300031231Forest SoilTGGPPSIFDAERGKITGVSLTLYRRDDRVVVEGDSTSPAVTRTRVVR
Ga0170819_1084537713300031469Forest SoilSIFDAERGKITGVSLTLFRHDDRVVVEGDSRSPAVTQTRMER
Ga0170818_11014635333300031474Forest SoilPPSIFDAERGKITGVSLTLFRHDDRVVVEGDSRSPAVTQTRMER
Ga0306925_1090185523300031890SoilEHGKTTGDSLTFYKRDDRVQVEGTDASPTVTQTRVAR
Ga0335080_1122864213300032828SoilAEQGKITGVSLTFYRRDDRVLVEGEASTPVVTTTRVAQ
Ga0310810_1022601613300033412SoilEHGKITAVSLTLFRRDGRVVVEGDKSSPAVTETKVVR
Ga0310810_1065064813300033412SoilGPPSIFDAEHGKITAVSLTLFRRDGRVVVEGDKGSPAVTETKVVR

 ⦗Top⦘


Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.