NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome / Metatranscriptome Family F083183

Metagenome / Metatranscriptome Family F083183

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F083183
Family Type Metagenome / Metatranscriptome
Number of Sequences 113
Average Sequence Length 45 residues
Representative Sequence FFACPVCVKTRGLESAVWVKGAEVKGAPSLYEFTAGGALTFNY
Number of Associated Samples 106
Number of Associated Scaffolds 113

Quality Assessment
Transcriptomic Evidence Yes
Most common taxonomic group Bacteria
% of genes with valid RBS motifs 3.54 %
% of genes near scaffold ends (potentially truncated) 92.04 %
% of genes from short scaffolds (< 2000 bps) 91.15 %
Associated GOLD sequencing projects 104
AlphaFold2 3D model prediction Yes
3D model pTM-score0.26

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Bacteria (86.726 % of family members)
NCBI Taxonomy ID 2
Taxonomy All Organisms → cellular organisms → Bacteria

Most Common Ecosystem
GOLD Ecosystem Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil
(7.965 % of family members)
Environment Ontology (ENVO) Unclassified
(25.664 % of family members)
Earth Microbiome Project Ontology (EMPO) Free-living → Non-saline → Soil (non-saline)
(39.823 % of family members)


 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      

 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Globular Signal Peptide: No Secondary Structure distribution: α-helix: 8.45%    β-sheet: 16.90%    Coil/Unstructured: 74.65%
Feature Viewer
Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer
Per-residue confidence (pLDDT):
  0-50   51-70   71-90   91-100  		pTM-score: 0.26
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.

 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 113 Family Scaffolds
PF13847Methyltransf_31 9.73
PF00903Glyoxalase 5.31
PF13649Methyltransf_25 3.54
PF01243Putative_PNPOx 2.65
PF00753Lactamase_B 2.65
PF10604Polyketide_cyc2 2.65
PF13191AAA_16 1.77
PF02635DrsE 1.77
PF00196GerE 1.77
PF05222AlaDh_PNT_N 1.77
PF00067p450 1.77
PF12681Glyoxalase_2 1.77
PF08241Methyltransf_11 1.77
PF13676TIR_2 1.77
PF13564DoxX_2 0.88
PF13561adh_short_C2 0.88
PF13115YtkA 0.88
PF13248zf-ribbon_3 0.88
PF00400WD40 0.88
PF13610DDE_Tnp_IS240 0.88
PF12680SnoaL_2 0.88
PF04542Sigma70_r2 0.88
PF01593Amino_oxidase 0.88
PF00027cNMP_binding 0.88
PF02566OsmC 0.88
PF02371Transposase_20 0.88
PF09844DUF2071 0.88
PF02583Trns_repr_metal 0.88
PF08327AHSA1 0.88
PF06348DUF1059 0.88
PF07969Amidohydro_3 0.88
PF14657Arm-DNA-bind_4 0.88
PF00248Aldo_ket_red 0.88
PF01135PCMT 0.88
PF00313CSD 0.88
PF08279HTH_11 0.88
PF00296Bac_luciferase 0.88
PF01022HTH_5 0.88
PF07883Cupin_2 0.88
PF12697Abhydrolase_6 0.88
PF08240ADH_N 0.88
PF13473Cupredoxin_1 0.88
PF13411MerR_1 0.88
PF104171-cysPrx_C 0.88
PF00561Abhydrolase_1 0.88

Neighboring Clusters of Orthologous Genes (COGs)

COG IDNameFunctional Category % Frequency in 113 Family Scaffolds
COG2124Cytochrome P450Defense mechanisms [V] 1.77
COG0568DNA-directed RNA polymerase, sigma subunit (sigma70/sigma32)Transcription [K] 0.88
COG1191DNA-directed RNA polymerase specialized sigma subunitTranscription [K] 0.88
COG1595DNA-directed RNA polymerase specialized sigma subunit, sigma24 familyTranscription [K] 0.88
COG1764Organic hydroperoxide reductase OsmC/OhrADefense mechanisms [V] 0.88
COG1765Uncharacterized OsmC-related proteinGeneral function prediction only [R] 0.88
COG1937DNA-binding transcriptional regulator, FrmR familyTranscription [K] 0.88
COG2141Flavin-dependent oxidoreductase, luciferase family (includes alkanesulfonate monooxygenase SsuD and methylene tetrahydromethanopterin reductase)Coenzyme transport and metabolism [H] 0.88
COG2226Ubiquinone/menaquinone biosynthesis C-methylase UbiE/MenGCoenzyme transport and metabolism [H] 0.88
COG2518Protein-L-isoaspartate O-methyltransferasePosttranslational modification, protein turnover, chaperones [O] 0.88
COG2519tRNA A58 N-methylase Trm61Translation, ribosomal structure and biogenesis [J] 0.88
COG3547TransposaseMobilome: prophages, transposons [X] 0.88
COG4122tRNA 5-hydroxyU34 O-methylase TrmR/YrrMTranslation, ribosomal structure and biogenesis [J] 0.88
COG4941Predicted RNA polymerase sigma factor, contains C-terminal TPR domainTranscription [K] 0.88

 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms86.73 %
UnclassifiedrootN/A13.27 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
2170459005|F1BAP7Q02IGGB9All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria508Open in IMG/M
2170459010|GIO7OMY02JC6HBAll Organisms → cellular organisms → Bacteria → Terrabacteria group516Open in IMG/M
3300000891|JGI10214J12806_10731003All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia847Open in IMG/M
3300001536|A1565W1_10083971All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria503Open in IMG/M
3300003992|Ga0055470_10164020All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia590Open in IMG/M
3300004156|Ga0062589_101492797All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria664Open in IMG/M
3300004156|Ga0062589_101769292All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria619Open in IMG/M
3300005093|Ga0062594_100508645All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1022Open in IMG/M
3300005093|Ga0062594_103206867All Organisms → cellular organisms → Bacteria513Open in IMG/M
3300005172|Ga0066683_10612354All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria658Open in IMG/M
3300005186|Ga0066676_10682283All Organisms → cellular organisms → Bacteria699Open in IMG/M
3300005289|Ga0065704_10871689All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria503Open in IMG/M
3300005343|Ga0070687_100379522All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria921Open in IMG/M
3300005354|Ga0070675_101919815All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia546Open in IMG/M
3300005540|Ga0066697_10780329All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Corynebacteriales520Open in IMG/M
3300005544|Ga0070686_101444802All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium578Open in IMG/M
3300005560|Ga0066670_10575851All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria687Open in IMG/M
3300005569|Ga0066705_10400331All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria860Open in IMG/M
3300005614|Ga0068856_102535010All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria519Open in IMG/M
3300005947|Ga0066794_10176509All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria642Open in IMG/M
3300005981|Ga0081538_10336555All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria548Open in IMG/M
3300006038|Ga0075365_11263618All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria519Open in IMG/M
3300006047|Ga0075024_100395966All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria701Open in IMG/M
3300006057|Ga0075026_100956797All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria530Open in IMG/M
3300006172|Ga0075018_10692522All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia550Open in IMG/M
3300006354|Ga0075021_10607168All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria699Open in IMG/M
3300006605|Ga0074057_11702256All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria544Open in IMG/M
3300006854|Ga0075425_102952744All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Corynebacteriales521Open in IMG/M
3300006864|Ga0066797_1107906All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria975Open in IMG/M
3300006904|Ga0075424_101903225All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria628Open in IMG/M
3300006918|Ga0079216_11081902All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia630Open in IMG/M
3300009012|Ga0066710_101072647All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium HGW-Chloroflexi-91245Open in IMG/M
3300009098|Ga0105245_11775314Not Available670Open in IMG/M
3300009174|Ga0105241_11444010All Organisms → cellular organisms → Bacteria660Open in IMG/M
3300009551|Ga0105238_11685922All Organisms → cellular organisms → Bacteria665Open in IMG/M
3300009553|Ga0105249_12222904All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Propionibacteriales621Open in IMG/M
3300009683|Ga0116224_10202740All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria950Open in IMG/M
3300010029|Ga0105074_1093411All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium564Open in IMG/M
3300010038|Ga0126315_11198292All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria516Open in IMG/M
3300010044|Ga0126310_11357235All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia577Open in IMG/M
3300010337|Ga0134062_10541137All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria591Open in IMG/M
3300010375|Ga0105239_10946911Not Available989Open in IMG/M
3300010392|Ga0118731_107787547All Organisms → cellular organisms → Bacteria1132Open in IMG/M
3300010397|Ga0134124_11447672All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia714Open in IMG/M
3300010399|Ga0134127_13206003All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria534Open in IMG/M
3300010400|Ga0134122_11184185Not Available764Open in IMG/M
3300010430|Ga0118733_101272306All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1468Open in IMG/M
3300012014|Ga0120159_1186788All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium558Open in IMG/M
3300012022|Ga0120191_10052095All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria717Open in IMG/M
3300012094|Ga0136638_10391898All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium653Open in IMG/M
3300012211|Ga0137377_11509430All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi598Open in IMG/M
3300012354|Ga0137366_11040844All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria567Open in IMG/M
3300012469|Ga0150984_102631211Not Available653Open in IMG/M
3300012668|Ga0157216_10178694All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Acidimicrobiia → Acidimicrobiales → Acidimicrobiaceae → unclassified Acidimicrobiaceae → Acidimicrobiaceae bacterium1013Open in IMG/M
3300012680|Ga0136612_10309845All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia801Open in IMG/M
3300012922|Ga0137394_10613915Not Available919Open in IMG/M
3300012922|Ga0137394_11571925All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium515Open in IMG/M
3300012984|Ga0164309_11310461Not Available613Open in IMG/M
3300012986|Ga0164304_11449440All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria566Open in IMG/M
3300013297|Ga0157378_10175355All Organisms → cellular organisms → Bacteria2013Open in IMG/M
3300013297|Ga0157378_11710770All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria676Open in IMG/M
3300013306|Ga0163162_10921155All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria986Open in IMG/M
3300013306|Ga0163162_13194197All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia526Open in IMG/M
3300014311|Ga0075322_1196380All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Pseudonocardiales → Pseudonocardiaceae → Pseudonocardia → unclassified Pseudonocardia → Pseudonocardia sp. H11422515Open in IMG/M
3300014325|Ga0163163_11590413All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria715Open in IMG/M
3300015208|Ga0167664_1117808All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria790Open in IMG/M
3300015373|Ga0132257_104250664All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria521Open in IMG/M
3300015374|Ga0132255_105621427All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria530Open in IMG/M
3300016371|Ga0182034_11164440All Organisms → cellular organisms → Bacteria670Open in IMG/M
3300016387|Ga0182040_11802220Not Available524Open in IMG/M
3300018032|Ga0187788_10458373All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria545Open in IMG/M
3300018422|Ga0190265_13646347All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium513Open in IMG/M
3300018433|Ga0066667_10014239All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria3981Open in IMG/M
3300018465|Ga0190269_10475014All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria802Open in IMG/M
3300025934|Ga0207686_11295015Not Available598Open in IMG/M
3300025934|Ga0207686_11603386All Organisms → cellular organisms → Bacteria537Open in IMG/M
3300025940|Ga0207691_11349121All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia588Open in IMG/M
3300025945|Ga0207679_11064728All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micromonosporales → Micromonosporaceae → Actinoplanes742Open in IMG/M
3300025960|Ga0207651_10226462All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1515Open in IMG/M
3300026075|Ga0207708_10091009All Organisms → cellular organisms → Bacteria → Acidobacteria → Vicinamibacteria → Vicinamibacterales → Vicinamibacteraceae → Luteitalea → Luteitalea pratensis2352Open in IMG/M
3300026095|Ga0207676_11414380All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria692Open in IMG/M
3300026550|Ga0209474_10110124All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium1841Open in IMG/M
3300027696|Ga0208696_1240413All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria564Open in IMG/M
3300027788|Ga0209711_10040884Not Available2630Open in IMG/M
3300027834|Ga0209344_10101320All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia1560Open in IMG/M
3300027894|Ga0209068_10915467All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia519Open in IMG/M
3300027902|Ga0209048_10064177All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria2937Open in IMG/M
3300027909|Ga0209382_12039327All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia549Open in IMG/M
3300027911|Ga0209698_10129318All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria2085Open in IMG/M
3300028741|Ga0302256_10016929All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1759Open in IMG/M
3300028796|Ga0307287_10319899All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria586Open in IMG/M
3300028803|Ga0307281_10312110All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia589Open in IMG/M
3300028824|Ga0307310_10479594All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria625Open in IMG/M
3300028869|Ga0302263_10019190All Organisms → cellular organisms → Bacteria2645Open in IMG/M
3300029636|Ga0222749_10696846All Organisms → cellular organisms → Bacteria556Open in IMG/M
3300029984|Ga0311332_10001423All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria13523Open in IMG/M
3300030047|Ga0302286_10554325All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria584Open in IMG/M
3300030336|Ga0247826_11766289Not Available506Open in IMG/M
3300031229|Ga0299913_10028353All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria5248Open in IMG/M
3300031232|Ga0302323_100011447All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria7488Open in IMG/M
3300031561|Ga0318528_10258218Not Available935Open in IMG/M
3300031768|Ga0318509_10451240All Organisms → cellular organisms → Bacteria → Terrabacteria group719Open in IMG/M
3300031771|Ga0318546_10556039All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria806Open in IMG/M
3300031794|Ga0318503_10257673All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia566Open in IMG/M
3300031797|Ga0318550_10564965Not Available547Open in IMG/M
3300032039|Ga0318559_10216465All Organisms → cellular organisms → Bacteria → Terrabacteria group882Open in IMG/M
3300032066|Ga0318514_10445474All Organisms → cellular organisms → Bacteria → Terrabacteria group688Open in IMG/M
3300032180|Ga0307471_100945677Not Available1029Open in IMG/M
3300032805|Ga0335078_12581406All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria522Open in IMG/M
3300033168|Ga0272423_1100785All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1638Open in IMG/M
3300033412|Ga0310810_10568707Not Available1101Open in IMG/M
3300033412|Ga0310810_10959234All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria739Open in IMG/M
3300033433|Ga0326726_12243251Not Available531Open in IMG/M


 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil7.96%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil7.08%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Soil6.19%
WatershedsEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds5.31%
FenEnvironmental → Terrestrial → Peat → Unclassified → Unclassified → Fen4.42%
Vadose Zone SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil3.54%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil3.54%
Terrestrial SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil2.65%
Populus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere2.65%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere2.65%
Corn RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere2.65%
Polar Desert SandEnvironmental → Aquatic → Freshwater → Ice → Unclassified → Polar Desert Sand1.77%
Serpentine SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Serpentine Soil1.77%
Glacier Forefield SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Glacier Forefield Soil1.77%
Peatlands SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil1.77%
PermafrostEnvironmental → Terrestrial → Soil → Unclassified → Permafrost → Permafrost1.77%
Grasslands SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil1.77%
Grass SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Grass Soil1.77%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil1.77%
SoilEnvironmental → Terrestrial → Soil → Wetlands → Permafrost → Soil1.77%
Switchgrass RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Switchgrass Rhizosphere1.77%
Arabidopsis RhizosphereHost-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere1.77%
Switchgrass RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere1.77%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere1.77%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Miscanthus Rhizosphere1.77%
Freshwater Lake SedimentEnvironmental → Aquatic → Freshwater → Lentic → Sediment → Freshwater Lake Sediment0.89%
MarineEnvironmental → Aquatic → Marine → Oceanic → Unclassified → Marine0.89%
MarineEnvironmental → Aquatic → Marine → Coastal → Sediment → Marine0.89%
Marine SedimentEnvironmental → Aquatic → Marine → Coastal → Sediment → Marine Sediment0.89%
Natural And Restored WetlandsEnvironmental → Aquatic → Marine → Wetlands → Unclassified → Natural And Restored Wetlands0.89%
MarineEnvironmental → Aquatic → Marine → Oil Seeps → Unclassified → Marine0.89%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil0.89%
Grasslands SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil0.89%
TerrestrialEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial0.89%
Agricultural SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil0.89%
Hardwood Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil0.89%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural → Soil0.89%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Uranium Contaminated → Soil0.89%
SoilEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Soil0.89%
Natural And Restored WetlandsEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Natural And Restored Wetlands0.89%
Tropical PeatlandEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland0.89%
Corn, Switchgrass And Miscanthus RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere0.89%
Groundwater SandEnvironmental → Terrestrial → Soil → Sand → Unclassified → Groundwater Sand0.89%
Peat SoilEnvironmental → Terrestrial → Peat → Unclassified → Unclassified → Peat Soil0.89%
RockEnvironmental → Terrestrial → Rock-Dwelling (Endoliths) → Unclassified → Unclassified → Rock0.89%
Switchgrass RhizosphereHost-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Switchgrass Rhizosphere0.89%
Corn RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere0.89%
Switchgrass RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere0.89%
Populus EndosphereHost-Associated → Plants → Roots → Bulk Soil → Unclassified → Populus Endosphere0.89%
Tabebuia Heterophylla RhizosphereHost-Associated → Plants → Roots → Rhizosphere → Unclassified → Tabebuia Heterophylla Rhizosphere0.89%
Switchgrass RhizosphereHost-Associated → Plants → Roots → Rhizosphere → Soil → Switchgrass Rhizosphere0.89%
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere0.89%
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere0.89%
Corn RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere0.89%
Avena Fatua RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Avena Fatua Rhizosphere0.89%

Visualization
Powered by ApexCharts



Associated Samples

Taxon OIDSample NameHabitat TypeIMG/M Link
2170459005Grass soil microbial communities from Rothamsted Park, UK - July 2009 direct MP BIO1O1 lysis 0-21cmEnvironmentalOpen in IMG/M
2170459010Grass soil microbial communities from Rothamsted Park, UK - December 2009 direct MP BIO1O1 lysis 0-9cm (no DNA from 10 to 21cm!!!)EnvironmentalOpen in IMG/M
3300000891Soil microbial communities from Great Prairies - Wisconsin, Continuous corn soilEnvironmentalOpen in IMG/M
3300001536Permafrost active layer microbial communities from McGill Arctic Research Station, Canada - (A15-65cm-8A)- 1 week illuminaEnvironmentalOpen in IMG/M
3300003992Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - MayberryNW_TuleB_D1EnvironmentalOpen in IMG/M
3300004156Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Combined assembly of AARS Block 1EnvironmentalOpen in IMG/M
3300005093Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of KBS All BlocksEnvironmentalOpen in IMG/M
3300005172Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_132EnvironmentalOpen in IMG/M
3300005186Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_125EnvironmentalOpen in IMG/M
3300005289Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2Host-AssociatedOpen in IMG/M
3300005343Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaGEnvironmentalOpen in IMG/M
3300005354Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaGHost-AssociatedOpen in IMG/M
3300005540Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_146EnvironmentalOpen in IMG/M
3300005544Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaGEnvironmentalOpen in IMG/M
3300005560Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_119EnvironmentalOpen in IMG/M
3300005569Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_154EnvironmentalOpen in IMG/M
3300005614Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2Host-AssociatedOpen in IMG/M
3300005947Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Permafrost soil replicate 2 DNA2013-190EnvironmentalOpen in IMG/M
3300005981Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1Host-AssociatedOpen in IMG/M
3300006038Populus root and rhizosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5Host-AssociatedOpen in IMG/M
3300006047Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Straight Creek_MetaG_SC_2013EnvironmentalOpen in IMG/M
3300006057Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Straight Creek_MetaG_SC_2012EnvironmentalOpen in IMG/M
3300006172Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Cold Stream Run_MetaG_CSR_2014EnvironmentalOpen in IMG/M
3300006354Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Cold Stream Run_MetaG_CSR_2012EnvironmentalOpen in IMG/M
3300006605Soil and rhizosphere microbial communities from Centre INRS-Institut Armand-Frappier, Laval, Canada - Soil microcosm metaTmtHAB (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300006854Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD4Host-AssociatedOpen in IMG/M
3300006864Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Permafrost soil replicate 3 DNA2013-193EnvironmentalOpen in IMG/M
3300006904Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD3Host-AssociatedOpen in IMG/M
3300006918Agricultural soil microbial communities from Utah to study Nitrogen management - NC AS100EnvironmentalOpen in IMG/M
3300009012Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_159EnvironmentalOpen in IMG/M
3300009098Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaGHost-AssociatedOpen in IMG/M
3300009174Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaGHost-AssociatedOpen in IMG/M
3300009551Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaGHost-AssociatedOpen in IMG/M
3300009553Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaGHost-AssociatedOpen in IMG/M
3300009683Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_b_LC metaGEnvironmentalOpen in IMG/M
3300010029Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW S1_10_20EnvironmentalOpen in IMG/M
3300010038Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot106EnvironmentalOpen in IMG/M
3300010044Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot60EnvironmentalOpen in IMG/M
3300010337Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_2_09082015EnvironmentalOpen in IMG/M
3300010375Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaGHost-AssociatedOpen in IMG/M
3300010392Coastal sediment microbial communities from Rhode Island, USA. Combined Assembly of Gp0121717, Gp0123912, Gp0123935, Gp0139423, Gp0139424, Gp0139388, Gp0139387, Gp0139386, Gp0139385EnvironmentalOpen in IMG/M
3300010397Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-4EnvironmentalOpen in IMG/M
3300010399Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-3EnvironmentalOpen in IMG/M
3300010400Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-2EnvironmentalOpen in IMG/M
3300010430Marine sediment microbial communities from Gulf of Thailand under amendment with organic carbon and nitrate - JGI co-assembly of 8 samplesEnvironmentalOpen in IMG/M
3300012014Permafrost microbial communities from Nunavut, Canada - A10_80cm_6MEnvironmentalOpen in IMG/M
3300012022Terrestrial microbial communites from a soil warming plot in Okalahoma, USA - C6EnvironmentalOpen in IMG/M
3300012094Polar desert sand microbial communities from Dry Valleys, Antarctica - metaG UQ858 (22.06)EnvironmentalOpen in IMG/M
3300012211Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_40_16 metaGEnvironmentalOpen in IMG/M
3300012354Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_60_16 metaGEnvironmentalOpen in IMG/M
3300012469Combined assembly of Soil carbon rhizosphereHost-AssociatedOpen in IMG/M
3300012668Arctic soils microbial communities. Combined Assembly of 23 SPsEnvironmentalOpen in IMG/M
3300012680Polar desert sand microbial communities from Dry Valleys, Antarctica - metaG UQ224A (23.06)EnvironmentalOpen in IMG/M
3300012922Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czobulk1.16 metaGEnvironmentalOpen in IMG/M
3300012984Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_247_MGEnvironmentalOpen in IMG/M
3300012986Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_217_MGEnvironmentalOpen in IMG/M
3300013297Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaGHost-AssociatedOpen in IMG/M
3300013306Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaGHost-AssociatedOpen in IMG/M
3300014311Natural and restored wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - MayberryNW_CattailB_D1EnvironmentalOpen in IMG/M
3300014325Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaGHost-AssociatedOpen in IMG/M
3300015208Arctic soil microbial communities from a glacier forefield, Storglaci?ren, Tarfala, Sweden (Samples st-15,16,16 pooled, 1st-3rd transect points, snow/rock/ice interface)EnvironmentalOpen in IMG/M
3300015373Combined assembly of cpr5 rhizosphereHost-AssociatedOpen in IMG/M
3300015374Col-0 rhizosphere combined assemblyHost-AssociatedOpen in IMG/M
3300016371Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.172EnvironmentalOpen in IMG/M
3300016387Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.176EnvironmentalOpen in IMG/M
3300018032Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_BV01_MP10_20_MGEnvironmentalOpen in IMG/M
3300018422Populus adjacent soil microbial communities from riparian zone of Indian Creek, Utah, USA - 124 TEnvironmentalOpen in IMG/M
3300018433Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_116EnvironmentalOpen in IMG/M
3300018465Populus adjacent soil microbial communities from riparian zone of Blue River, Arizona, USA - 249 ISEnvironmentalOpen in IMG/M
3300025934Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025940Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025945Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025960Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300026075Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300026095Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300026550Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_145 (SPAdes)EnvironmentalOpen in IMG/M
3300027696Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_b_LC metaG (SPAdes)EnvironmentalOpen in IMG/M
3300027788Marine microbial communities from western Arctic Ocean - ArcticOcean_MG_CB11_88 (SPAdes)EnvironmentalOpen in IMG/M
3300027834Oil polluted marine microbial communities from Coal Oil Point, Santa Barbara, California, USA - Santa Barbara Oil Seep Sample 6 (SPAdes)EnvironmentalOpen in IMG/M
3300027894Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Cold Stream Run_MetaG_CSR_2012 (SPAdes)EnvironmentalOpen in IMG/M
3300027902Freshwater lake sediment microbial communities from the University of Notre Dame, USA, for methane emissions studies - CRP12 CR (SPAdes)EnvironmentalOpen in IMG/M
3300027909Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD5 (SPAdes)Host-AssociatedOpen in IMG/M
3300027911Freshwater sediment microbial communities from Pennsylvania, USA - Little Laurel Run_MetaG_LLR_2012 (SPAdes)EnvironmentalOpen in IMG/M
3300028741Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Fen_E3_4EnvironmentalOpen in IMG/M
3300028796Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_141EnvironmentalOpen in IMG/M
3300028803Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_120EnvironmentalOpen in IMG/M
3300028824Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_197EnvironmentalOpen in IMG/M
3300028869Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Fen_N1_4EnvironmentalOpen in IMG/M
3300029636Metatranscriptome of lab incubated forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-M (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300029984I_Fen_E1 coassemblyEnvironmentalOpen in IMG/M
3300030047Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - III_Fen_E2_3EnvironmentalOpen in IMG/M
3300030336Soil microbial communities from agricultural site in Penn Yan, New York, United States - 12C_Control_Day1EnvironmentalOpen in IMG/M
3300031229Soil microbial communities from uranium-contaminated site in the Upper Colorado River Basin, Wyoming, United States - RVT155D38EnvironmentalOpen in IMG/M
3300031232Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Fen_T0_3EnvironmentalOpen in IMG/M
3300031561Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.052b4f26EnvironmentalOpen in IMG/M
3300031768Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.084b2f22EnvironmentalOpen in IMG/M
3300031771Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f19EnvironmentalOpen in IMG/M
3300031794Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.174b1f23EnvironmentalOpen in IMG/M
3300031797Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f23EnvironmentalOpen in IMG/M
3300032039Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.065b5f21EnvironmentalOpen in IMG/M
3300032066Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f18EnvironmentalOpen in IMG/M
3300032180Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_515EnvironmentalOpen in IMG/M
3300032805Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.2EnvironmentalOpen in IMG/M
3300033168Rock endolithic microbial communities from Victoria Land, Antarctica - Mt New Zealand sudEnvironmentalOpen in IMG/M
3300033412Soil microbial communities from experimental microcosm in Duke University, North Carolina, United States - NCEnvironmentalOpen in IMG/M
3300033433Lab enriched peat soil microbial communities from Michigan Hollow, Ithaca, NY, United States - MHF15MNEnvironmentalOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap


 ⦗Top⦘

Family Sequences

Protein ID Sample Taxon ID Habitat Sequence
E41_078549802170459005Grass SoilFACPVCVKTRGLESAAWVEGAEVKGAPSLYEFTQGGALTFNY
F62_084343802170459010Grass SoilLCPRPTGLEGTDLVEGAEAKGAPAVYEFCEGGALTFNY
JGI10214J12806_1073100333300000891SoilRFFACPVCVKTRGLENAEWVETAEVKGAPSVYEFAEGGALTFNY*
A1565W1_1008397123300001536PermafrostRFYACPVCVKTRGLQDASWVSTAEVKGAPSVYEFAEGGALTFSY*
Ga0055470_1016402023300003992Natural And Restored WetlandsKGGRFYACPVCVKTRGLENAVWSDGAEVKGAPSLYEFTQGGALTFNY*
Ga0062589_10149279723300004156SoilFFACPVCVKTHGLEAAEWVQGAEVKGAPSLYEFTAGGALIFNY*
Ga0062589_10176929213300004156SoilIADLHAEYVEKGGIFYVCPVCVKTRGMEDAVWTKGAEVKGAPSMYEFAKGGALTFNY*
Ga0062594_10050864513300005093SoilPVCVKTHGLEAAEWVQGAEVKGAPSLYEFTAGGALIFDY*
Ga0062594_10320686713300005093SoilCPICVKTHGLQDAEWVQGAEVKGAPSLFEFTAGGALTFNY*
Ga0066683_1061235433300005172SoilRFFACPVCVKTRNLEGAELVESAEVKGAPSLYEFTEGGALTFNY*
Ga0066676_1068228323300005186SoilRFFACPVCVKTRKLESATWVTGAEVKGAPSLYEFTQGGALVFNY*
Ga0065704_1087168913300005289Switchgrass RhizospherePVCVKTRGMEDAVWTKGAEVKGAPSVYEFTDGGALMFSY*
Ga0070687_10037952223300005343Switchgrass RhizosphereCPICVKTHGLESAEWVQGAEVKGAPSLFEFTAGGALTFNY*
Ga0070675_10191981523300005354Miscanthus RhizosphereEKGGRFFACPVCVKTRGMEDTVWTKGAEVKGAPSLYEFAAGGALTFNY*
Ga0066697_1078032913300005540SoilVCPVCVKTRGMEDATWTKGAEVKGAPSLYEFTEGGALTFNY*
Ga0070686_10144480223300005544Switchgrass RhizospherePVCVKVRAMEDAVWAKGAEVKGAPSLYEFTAGGALVFNY*
Ga0066670_1057585133300005560SoilVCVKTRGLEEASWVKGAEVKGAPSLYEFTAGGALTFNY*
Ga0066705_1040033113300005569SoilGGLFYVCPVCVKTRGMEDATWTKGAEVKGAPSLYEFTEGGALTFNY*
Ga0068856_10253501013300005614Corn RhizosphereYVASGGRFFACPVCVKTRNLEDASWVDNTEVAGMPSVYEYTTGGALVFNY*
Ga0066794_1017650913300005947SoilCVKTRNLEGAELVEGAEVKGAASLYEFTEGGALTFNY*
Ga0081538_1033655523300005981Tabebuia Heterophylla RhizospherePVCVKTHHLEDAEWVPGAEVKGAPALYEFTRGGALTFTY*
Ga0075365_1126361823300006038Populus EndosphereCPVCVKSRGLEDAEWVKGAEVKGAPSLYEFTAGGALTFNY*
Ga0075024_10039596623300006047WatershedsFYACPVCVKSRGLENAEWVQGAEVKGAPSLFEFTQGGALTFNY*
Ga0075026_10095679713300006057WatershedsSIKDLHAEYIEKGGRFFACPVCVKTHNLESASWVKGAEVKGAPSLYEFTVGGALTFNY*
Ga0075018_1069252223300006172WatershedsGGRFFACPVCVKSRNLESAAWVQGAEVEGAPSLFEFTQGGALTFNY*
Ga0075021_1060716813300006354WatershedsVENGGRFFACPVCVKTRNLESAAWVQGAEVKGAPSVYEFTQGGALVFNY*
Ga0074057_1170225623300006605SoilSIPELHAEYVQRGGRFFACPVCVKTHGLENAEWTDGAEVKGAPALYEFTQGGALTFNY*
Ga0075425_10295274413300006854Populus RhizosphereGRFYACPVCVKTRGMEDAVWTKGAEVKGAPSVYEFTEGGALIFNY*
Ga0066797_110790613300006864SoilRGGRFFACPVCVKTRNLEGAELVEGAEVKGAASLYEFTEGGALTFNY*
Ga0075424_10190322523300006904Populus RhizosphereFFACPICVKTHGLESAEWVQGAEVKGAPSLFEFTAGGALTFNY*
Ga0079216_1108190213300006918Agricultural SoilKGGRFFACPVCVKVRGMEDATWTKNAEVKGAPSLYEFTTGGALVFNY*
Ga0066710_10107264743300009012Grasslands SoilKTRGLEEASWVKGAEVKGAPSLFEFTAGGALTFNY
Ga0105245_1177531423300009098Miscanthus RhizospherePVCVKTHGLENAEWTDGAEVKGAPSLYEFTQGGALVFNY*
Ga0105241_1144401023300009174Corn RhizosphereEKGGRFFACPVCVKTRGLESAAWVEGAEVKGAPSLYEFTQGGALTFNY*
Ga0105238_1168592213300009551Corn RhizosphereKGGRFFACPVCVKTHKLESAAWVKGAEVKGAPSLYEFTQGGALVFNY*
Ga0105249_1222290423300009553Switchgrass RhizosphereYACPVCVKTRGLGEATWTKNAEVKGAPSLYEFTAGGALIFNY*
Ga0116224_1020274013300009683Peatlands SoilEKGGRFFACPVCAKARNLESAAWVQGAEVKGAPARYEFTQGGALTFNY*
Ga0105074_109341113300010029Groundwater SandEYVERGGRFFACPVCVKTHGLEGADWTEGAEVKGAPALYEFTQGGALTFNY*
Ga0126315_1119829223300010038Serpentine SoilVVSSPRSGGRFFVCPVCVKSRRLENADWVTGADVKGAKALYEFTACGALTFTY*
Ga0126310_1135723523300010044Serpentine SoilYIERGGRFYACPVCVKTHHLQDADWVQGAEVKGAPALYAFTQGGALTFNY*
Ga0134062_1054113723300010337Grasslands SoilCPVCVKTRGMEDAVWTKGAEVKGAPSVYEFTEGGALIFNY*
Ga0105239_1094691113300010375Corn RhizosphereRFFACPVCVKTHGLENAEWTDGAEVKGAPSLYEFTQGGALVFNY*
Ga0118731_10778754713300010392MarineREYVDRGGRFYVCPVCVKIRGMDDAVWTRNAEVKGAPSMYEYAAGGALVFNY*
Ga0134124_1144767213300010397Terrestrial SoilKQAKEYMERGGRFFACPVCVKTRGLENAEWVETAEVKGAPSVYEFAEGGALTFNY*
Ga0134127_1320600323300010399Terrestrial SoilEKGGRFFACPICVKTHGLQDAEWVQGAEVKGAPSLFEFTAGGALTFNY*
Ga0134122_1118418523300010400Terrestrial SoilVKTRGMEDAVWTKGAEVKGAPAMYEFAKGGALTFNY*
Ga0118733_10127230613300010430Marine SedimentREYVDRGGRFYVCPVCVKIRGMNDAVWTRNAEVKGAPSMYEYAAGGALVFNY*
Ga0120159_118678813300012014PermafrostTRNLEGAELVEGAEVKGAPSLYEFTEGGALTFNY*
Ga0120191_1005209523300012022TerrestrialFSPCPGCVKPHGLEGADWTEGAEVKGAPALYEFTQGGALTFSY*
Ga0136638_1039189823300012094Polar Desert SandFYVCPVCVKTRGMEDAVWTKGAEVKGAPSLYEFTEGGALVFNY*
Ga0137377_1150943023300012211Vadose Zone SoilGRFFACPVCVKTRGLEGAALVDGAEVKGAPGLYEFTEGGALTFNY*
Ga0137366_1104084413300012354Vadose Zone SoilSIKDLHAEYVDKGGRFFACPVCVKTHKLEEATWVTGAEVKGAPSLYEFTQGGALTFNY*
Ga0150984_10263121113300012469Avena Fatua RhizosphereKDLHAEYIDKGGRFFACPVCVKTHGLEGAEWVQGAEVKGAPSLFEFTAGGALTFNY*
Ga0157216_1017869413300012668Glacier Forefield SoilVKSRGLENAEWVQGAEVKGVPSLLEFTQGGALTFNY*
Ga0136612_1030984513300012680Polar Desert SandPRKDLHAEYVESGGRFYACPVCVKTRGLEQATWTKGAEVKGAPSLYEFTSGGALVFNY*
Ga0137394_1061391513300012922Vadose Zone SoilGRFFACPVCVKTRKLESATWAKGADVKGAPSLYEFTQGGALTFNY*
Ga0137394_1157192523300012922Vadose Zone SoilGGRFFACPVCVKTRGLEGTALVDGAEVKGAPGLYEFTEGGALTFNY*
Ga0164309_1131046113300012984SoilRFFACPVCVKTHGLEAAEWVQGAEVKGAPSLFEFTAGGALTFNY*
Ga0164304_1144944023300012986SoilVKTRGLQEASWVKGAEVKGAPSLYEFTAGGALTFNY*
Ga0157378_1017535533300013297Miscanthus RhizosphereVCVKTHGLEAAEWVQGAEVKGAPSLFEFTAGGALTFNY*
Ga0157378_1171077033300013297Miscanthus RhizosphereCVKTHGLEAAEWVQRAEVKGAPSLYEFTAGGASIFNY*
Ga0163162_1092115513300013306Switchgrass RhizosphereLHAEYIDKGGRFFACPVCVKTHGLEGAEWVQGAEVKGAPSLYEFTTGGALIFNY*
Ga0163162_1319419723300013306Switchgrass RhizosphereFFACPVCVKTRGLESAVWVKGAEVKGAPSLYEFTAGGALTFNY*
Ga0075322_119638013300014311Natural And Restored WetlandsACPVCVKTRGMEDTVWTKGAEVKGAPSLYEFTAGGALTFSY*
Ga0163163_1159041313300014325Switchgrass RhizosphereRAGLEAADWVKGAEVKGAPSLFEFTAGGALTFNY*
Ga0167664_111780813300015208Glacier Forefield SoilERGGRFYACPVCVKSRGLNDAEWVQGAEVKGAPSLFEFTSGGALTFNY*
Ga0132257_10425066413300015373Arabidopsis RhizosphereGRFFACPVCVKVRMMEDATWTKNAEVKGAPAMYEFAAGGALTFNY*
Ga0132255_10562142713300015374Arabidopsis RhizosphereCVKTRGLESAAWVKGAEVKGAPSLYEFTQGGALVFNY*
Ga0182034_1116444013300016371SoilAEYIEKGGRFFACPVCVKTRELEDASWVKGAEVKGAPSLFEFTAGGALTFSY
Ga0182040_1180222023300016387SoilCPVCVKSRQLEEAAWVKGAEVKGAPSLYEFTQGGALTFNY
Ga0187788_1045837323300018032Tropical PeatlandYVERGGRFFACPVCVKTRGLQDAEWVEGAEVKGAPSVYEFTEGGALTFNY
Ga0190265_1364634713300018422SoilKNRGLEGAELVEGAEVKGAPSLYEFTEGGALTFNY
Ga0066667_1001423913300018433Grasslands SoilKTRGMEDATWTKGAEVKGAPSLYEFTEGGALTFNY
Ga0190269_1047501413300018465SoilVERGGRFYACPVCVKVRKMEDATWAANVEVKGAPAMYEFAAGGALTFNY
Ga0207686_1129501513300025934Miscanthus RhizosphereKTHGLEAAEWVQGAEVKGAPSLFEFTAGGALTFNY
Ga0207686_1160338623300025934Miscanthus RhizosphereMNARYCPCLAVKGGRFFACPVCVKVRAMEDAVWAKGAEVKGAPSLYEFTAGGALVFNY
Ga0207691_1134912113300025940Miscanthus RhizosphereCVKTRGMEDAVWTKGAEVKGAPAMYEFAKGGALTFNY
Ga0207679_1106472813300025945Corn RhizospherePICVKTHGLESAEWVQGAEVKGAPSLFEFTAGGALTFNY
Ga0207651_1022646213300025960Switchgrass RhizosphereYIDKGGRFFACPVCVKTHGLEGAEWVQGAEVKGAPSLYEFTTGGALIFNY
Ga0207708_1009100933300026075Corn, Switchgrass And Miscanthus RhizosphereMERGGRFFACPVCVKTRGLENAEWVETAEVKGAPSVYEFAEGGALTFNY
Ga0207676_1141438033300026095Switchgrass RhizosphereHAEYIEKGGRFFACPICVKTHGLESAEWVQGAEVKGAPSLFEFTAGGALTFNY
Ga0209474_1011012443300026550SoilVKTRGMEDAVWTKGAEVKGAPSVYEFTEGGALIFNY
Ga0208696_124041323300027696Peatlands SoilFACPVCAKARNLESAAWVQGAEVKGAPARYEFTQGGALTFNY
Ga0209711_1004088463300027788MarineAELHDEYVNSGGRFLVCPVCVKLRGLEEAVWTSNAEVKGAPAVYEFTTGGALTLSY
Ga0209344_1010132023300027834MarineGRFFVCPVCVKMRGLTEASWAENVEIVGAPSVYEYTAGGALVFNY
Ga0209068_1091546713300027894WatershedsYVDRGGRFFACPVCVKTRKLESAVWVRGAEVKGAPSVFEFTQGGALIFNY
Ga0209048_1006417713300027902Freshwater Lake SedimentKGGRFFACPVCVRTRNLESAAWVKGAEVKGAPFLYEFTEGGALTFNY
Ga0209382_1203932713300027909Populus RhizosphereHKEYVERGGRFFACPVCVKTHGLEDAEWVETAEVKGAPAVYEFTEGGALTFTY
Ga0209698_1012931823300027911WatershedsMEKGGRFFACPVCVKARNLESAAWVQGAEVKGAPSLFEFTQGGALTFNY
Ga0302256_1001692913300028741FenKGGRFFACPVCVKTRGLESAAWVQGAEVKGAPSLYEFTAGGALVFNY
Ga0307287_1031989923300028796SoilRFFACPVCVKTHGLEAAEWVQGAEVKGAPSLYEFTAGGALIFNY
Ga0307281_1031211023300028803SoilEFIERGGRFYACPVCVKTHHLEDADWVQGAEVKGAPALYEFTQGGALTFNY
Ga0307310_1047959423300028824SoilEYIDKGGRFFACPVCVKTHGLEAAEWVQGAEVKGAPSLYEFTAGGALIFNH
Ga0302263_1001919033300028869FenFACPVCVRSRHLEDAELIENAVVQGAATVYEFAEGGALTFNY
Ga0222749_1069684613300029636SoilKTRGLEAASWVRGAEVKGAPSLFEFTQGGALTFNY
Ga0311332_10001423143300029984FenEYVERGGRFFACPVCVRSRHLEDAELIENAVVQGAATVYEFAEGGALTFNY
Ga0302286_1055432513300030047FenTKVLHDEYIERGGKIFVCPVCVKTHNMEDATWIPAAEVKGVPSLFEFTAGGALVFNY
Ga0247826_1176628923300030336SoilLYACPVCVKTHGLESAEWTEGAEVKGAPSLYEFTQGGALTFNY
Ga0299913_1002835343300031229SoilGGRFFACPVCVKTRHLEDAEWVSGAEVKGAPALYEFAEGGALTFNY
Ga0302323_10001144783300031232FenVCVRSRHLEDAELIENAVVQGAATVYEFAEGGALTFNY
Ga0318528_1025821813300031561SoilCPVCVKTRELEDASWVKGAEVKGAPSLFEFTAGGALTFSY
Ga0318509_1045124023300031768SoilVCVKTHHLEDADWVPGAEVKGAPSLYEFTSGGALTFNY
Ga0318546_1055603913300031771SoilDAPSIKDLHAEYIDKGGRFFVCPVCVKTHKLEDATWVKGAEVKGAPSLYEFTTGGALTFN
Ga0318503_1025767313300031794SoilSIADLHAEYVERGGRFYACPVCVKTHHLEDADWVPGAEVKGAPSLYEFTSGGALTFNY
Ga0318550_1056496523300031797SoilKTRELEDASWVKGAVVKGAPSLFEFTAGGALTFSY
Ga0318559_1021646513300032039SoilGRFYACPVCVKTHHLEDADWVPGAEVKGAPSLYEFTSGGALTFNY
Ga0318514_1044547423300032066SoilKTHHLEDADWVPGAEVKGAPSLYEFTSGGALTFNY
Ga0307471_10094567723300032180Hardwood Forest SoilKSRQLEEASWVRGAEVKGAPSLYEFTQGGALTFNY
Ga0335078_1258140613300032805SoilEYIEKGGRFFACPVCVKTRNLQDATWVPNTEVAGMPSVYEFTAGGALVFNY
Ga0272423_110078513300033168RockSVSELHVEYVERGGRFYVCPVCVKKRNLEDVTWTGGAEVKGAPSLYEFTAGGALVFNY
Ga0310810_1056870713300033412SoilGGRFFACPVCVKTHGLENAEWTDGAEVKGAPSLYEFTQGGALVFNY
Ga0310810_1095923413300033412SoilMLYVCPVCVKTRGMEDAVWTKGAEVKGAPSMYEFAKGGALTFNY
Ga0326726_1224325123300033433Peat SoilKTRGLESAAWVKGAEVKGAPSLYEFTQGGALVFNY

 ⦗Top⦘


Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.