NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome / Metatranscriptome Family F083179

Metagenome / Metatranscriptome Family F083179

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F083179
Family Type Metagenome / Metatranscriptome
Number of Sequences 113
Average Sequence Length 40 residues
Representative Sequence EAAAKLKEAAASPKKSALLLLNRRGVTQYVGVNLSANQG
Number of Associated Samples 98
Number of Associated Scaffolds 113

Quality Assessment
Transcriptomic Evidence Yes
Most common taxonomic group Bacteria
% of genes with valid RBS motifs 0.89 %
% of genes near scaffold ends (potentially truncated) 98.23 %
% of genes from short scaffolds (< 2000 bps) 89.38 %
Associated GOLD sequencing projects 93
AlphaFold2 3D model prediction Yes
3D model pTM-score0.26

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Bacteria (81.416 % of family members)
NCBI Taxonomy ID 2
Taxonomy All Organisms → cellular organisms → Bacteria

Most Common Ecosystem
GOLD Ecosystem Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil
(31.858 % of family members)
Environment Ontology (ENVO) Unclassified
(30.973 % of family members)
Earth Microbiome Project Ontology (EMPO) Free-living → Non-saline → Soil (non-saline)
(52.212 % of family members)


 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      

 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Fibrous Signal Peptide: No Secondary Structure distribution: α-helix: 19.40%    β-sheet: 17.91%    Coil/Unstructured: 62.69%
Feature Viewer
Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer
Per-residue confidence (pLDDT):
  0-50   51-70   71-90   91-100  		pTM-score: 0.26
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.

 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 113 Family Scaffolds
PF02913FAD-oxidase_C 24.78
PF01264Chorismate_synt 4.42
PF02775TPP_enzyme_C 2.65
PF13551HTH_29 0.88
PF00496SBP_bac_5 0.88
PF00471Ribosomal_L33 0.88
PF03989DNA_gyraseA_C 0.88
PF01053Cys_Met_Meta_PP 0.88
PF01370Epimerase 0.88
PF00890FAD_binding_2 0.88
PF13358DDE_3 0.88
PF12833HTH_18 0.88

Neighboring Clusters of Orthologous Genes (COGs)

COG IDNameFunctional Category % Frequency in 113 Family Scaffolds
COG0277FAD/FMN-containing lactate dehydrogenase/glycolate oxidaseEnergy production and conversion [C] 24.78
COG0082Chorismate synthaseAmino acid transport and metabolism [E] 4.42
COG0075Archaeal aspartate aminotransferase or a related aminotransferase, includes purine catabolism protein PucGAmino acid transport and metabolism [E] 0.88
COG01567-keto-8-aminopelargonate synthetase or related enzymeCoenzyme transport and metabolism [H] 0.88
COG0188DNA gyrase/topoisomerase IV, subunit AReplication, recombination and repair [L] 0.88
COG0267Ribosomal protein L33Translation, ribosomal structure and biogenesis [J] 0.88
COG0399dTDP-4-amino-4,6-dideoxygalactose transaminaseCell wall/membrane/envelope biogenesis [M] 0.88
COG0436Aspartate/methionine/tyrosine aminotransferaseAmino acid transport and metabolism [E] 0.88
COG0520Selenocysteine lyase/Cysteine desulfuraseAmino acid transport and metabolism [E] 0.88
COG0626Cystathionine beta-lyase/cystathionine gamma-synthaseAmino acid transport and metabolism [E] 0.88
COG1921Seryl-tRNA(Sec) selenium transferaseTranslation, ribosomal structure and biogenesis [J] 0.88
COG1982Arginine/lysine/ornithine decarboxylaseAmino acid transport and metabolism [E] 0.88
COG2008Threonine aldolaseAmino acid transport and metabolism [E] 0.88
COG2873O-acetylhomoserine/O-acetylserine sulfhydrylase, pyridoxal phosphate-dependentAmino acid transport and metabolism [E] 0.88
COG4100Cystathionine beta-lyase family protein involved in aluminum resistanceInorganic ion transport and metabolism [P] 0.88

 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms81.42 %
UnclassifiedrootN/A18.58 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
3300001867|JGI12627J18819_10164231All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium902Open in IMG/M
3300004082|Ga0062384_101051582All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → unclassified Rhodospirillales → Rhodospirillales bacterium URHD0088585Open in IMG/M
3300004082|Ga0062384_101249799All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales541Open in IMG/M
3300004114|Ga0062593_101469138Not Available732Open in IMG/M
3300005332|Ga0066388_108430362All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales513Open in IMG/M
3300005451|Ga0066681_10717328All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → unclassified Rhodospirillales → Rhodospirillales bacterium URHD0088608Open in IMG/M
3300005537|Ga0070730_10694778All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium645Open in IMG/M
3300005764|Ga0066903_101524727All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium1263Open in IMG/M
3300006028|Ga0070717_11880893All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium540Open in IMG/M
3300006046|Ga0066652_101577623All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → unclassified Rhodospirillales → Rhodospirillales bacterium URHD0088605Open in IMG/M
3300006172|Ga0075018_10780371All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales522Open in IMG/M
3300006173|Ga0070716_101529476All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales546Open in IMG/M
3300006796|Ga0066665_10485145All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium1015Open in IMG/M
3300006804|Ga0079221_11549365All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales534Open in IMG/M
3300007265|Ga0099794_10799568All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium504Open in IMG/M
3300009088|Ga0099830_10410102All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium1096Open in IMG/M
3300009088|Ga0099830_11078909All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium666Open in IMG/M
3300009090|Ga0099827_11733917All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium544Open in IMG/M
3300010048|Ga0126373_11112626All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium856Open in IMG/M
3300010048|Ga0126373_12328421All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → unclassified Rhodospirillales → Rhodospirillales bacterium URHD0088596Open in IMG/M
3300010048|Ga0126373_12873406All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium537Open in IMG/M
3300010154|Ga0127503_10957874All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium580Open in IMG/M
3300010358|Ga0126370_12546157All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium511Open in IMG/M
3300010361|Ga0126378_11342937All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium809Open in IMG/M
3300011120|Ga0150983_15089863All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium1118Open in IMG/M
3300011269|Ga0137392_10392180All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium1152Open in IMG/M
3300012203|Ga0137399_11782306All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium504Open in IMG/M
3300012212|Ga0150985_104849460Not Available585Open in IMG/M
3300012285|Ga0137370_10573496Not Available695Open in IMG/M
3300012285|Ga0137370_10635280Not Available662Open in IMG/M
3300012359|Ga0137385_10717363All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium834Open in IMG/M
3300014654|Ga0181525_10024688All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales3669Open in IMG/M
3300016294|Ga0182041_10142308All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium1837Open in IMG/M
3300016319|Ga0182033_11394710All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Rhodobiaceae → unclassified Rhodobiaceae → Rhodobiaceae bacterium631Open in IMG/M
3300016371|Ga0182034_10975076All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium731Open in IMG/M
3300016404|Ga0182037_11522429All Organisms → cellular organisms → Bacteria → Proteobacteria594Open in IMG/M
3300016422|Ga0182039_10298132Not Available1334Open in IMG/M
3300016445|Ga0182038_10948758All Organisms → cellular organisms → Bacteria → Proteobacteria760Open in IMG/M
3300018085|Ga0187772_11125767All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium576Open in IMG/M
3300020579|Ga0210407_10296414All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium1262Open in IMG/M
3300020580|Ga0210403_10790181All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium755Open in IMG/M
3300020580|Ga0210403_11365523Not Available538Open in IMG/M
3300021170|Ga0210400_10087233All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Azospirillaceae → Azospirillum2458Open in IMG/M
3300021171|Ga0210405_10248608All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium1407Open in IMG/M
3300021384|Ga0213876_10465404All Organisms → cellular organisms → Bacteria → Proteobacteria673Open in IMG/M
3300021405|Ga0210387_11229968All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium649Open in IMG/M
3300021406|Ga0210386_11374705All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium592Open in IMG/M
3300021441|Ga0213871_10129031All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium758Open in IMG/M
3300021479|Ga0210410_11438218All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium582Open in IMG/M
3300021559|Ga0210409_10183442All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium1910Open in IMG/M
3300021560|Ga0126371_13732267Not Available513Open in IMG/M
3300022508|Ga0222728_1010118All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium1213Open in IMG/M
3300022512|Ga0242676_1039665All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium559Open in IMG/M
3300022530|Ga0242658_1041372All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium939Open in IMG/M
3300025898|Ga0207692_10158033All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium1304Open in IMG/M
3300025921|Ga0207652_11763277All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium524Open in IMG/M
3300025928|Ga0207700_11626004Not Available571Open in IMG/M
3300026023|Ga0207677_10506142All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium1045Open in IMG/M
3300026498|Ga0257156_1117970All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium552Open in IMG/M
3300027104|Ga0208095_1003731All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium1022Open in IMG/M
3300027376|Ga0209004_1005574All Organisms → cellular organisms → Bacteria1722Open in IMG/M
3300027701|Ga0209447_10088065All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium853Open in IMG/M
3300027701|Ga0209447_10088949Not Available848Open in IMG/M
3300027767|Ga0209655_10158168All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium749Open in IMG/M
3300027882|Ga0209590_10784118All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium606Open in IMG/M
3300028747|Ga0302219_10118739All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium1005Open in IMG/M
3300028906|Ga0308309_10218845All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium1578Open in IMG/M
3300029636|Ga0222749_10476620All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium672Open in IMG/M
3300030532|Ga0210290_1530308All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium642Open in IMG/M
3300030659|Ga0316363_10415223All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium521Open in IMG/M
3300030743|Ga0265461_11812458All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium684Open in IMG/M
3300031058|Ga0308189_10219755All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium700Open in IMG/M
3300031090|Ga0265760_10166003All Organisms → cellular organisms → Bacteria731Open in IMG/M
3300031231|Ga0170824_102974103All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium785Open in IMG/M
3300031231|Ga0170824_105663182All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium640Open in IMG/M
3300031236|Ga0302324_101398988All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium916Open in IMG/M
3300031469|Ga0170819_12847359All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium686Open in IMG/M
3300031545|Ga0318541_10855922All Organisms → cellular organisms → Bacteria507Open in IMG/M
3300031595|Ga0265313_10416991All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium525Open in IMG/M
3300031679|Ga0318561_10027455All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales2718Open in IMG/M
3300031679|Ga0318561_10034007All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales2479Open in IMG/M
3300031679|Ga0318561_10809875All Organisms → cellular organisms → Bacteria515Open in IMG/M
3300031724|Ga0318500_10223156All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium908Open in IMG/M
3300031747|Ga0318502_10978893All Organisms → cellular organisms → Bacteria515Open in IMG/M
3300031763|Ga0318537_10203721All Organisms → cellular organisms → Bacteria → Proteobacteria736Open in IMG/M
3300031771|Ga0318546_11353222All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium500Open in IMG/M
3300031781|Ga0318547_10330350All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium929Open in IMG/M
3300031792|Ga0318529_10146439Not Available1085Open in IMG/M
3300031793|Ga0318548_10489985All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium601Open in IMG/M
3300031819|Ga0318568_10205933Not Available1214Open in IMG/M
3300031879|Ga0306919_10021795All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales3892Open in IMG/M
3300031879|Ga0306919_10246078Not Available1344Open in IMG/M
3300031879|Ga0306919_10336624All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium1151Open in IMG/M
3300031879|Ga0306919_10535616All Organisms → cellular organisms → Bacteria → Proteobacteria903Open in IMG/M
3300031890|Ga0306925_10799840Not Available978Open in IMG/M
3300031910|Ga0306923_10411782Not Available1537Open in IMG/M
3300031912|Ga0306921_10028415Not Available6211Open in IMG/M
3300031946|Ga0310910_10240609Not Available1413Open in IMG/M
3300031954|Ga0306926_10051083All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales4947Open in IMG/M
3300032001|Ga0306922_10188972All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales2209Open in IMG/M
3300032041|Ga0318549_10012396All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales3030Open in IMG/M
3300032064|Ga0318510_10114960All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria1037Open in IMG/M
3300032064|Ga0318510_10232983Not Available752Open in IMG/M
3300032066|Ga0318514_10591252All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium591Open in IMG/M
3300032068|Ga0318553_10022048Not Available2976Open in IMG/M
3300032068|Ga0318553_10214404Not Available1004Open in IMG/M
3300032160|Ga0311301_11699685All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium760Open in IMG/M
3300032205|Ga0307472_100357364All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium1202Open in IMG/M
3300032515|Ga0348332_11625839Not Available636Open in IMG/M
3300032955|Ga0335076_11488377All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium564Open in IMG/M
3300033290|Ga0318519_10027335All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales2646Open in IMG/M
3300033486|Ga0316624_11005169All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium752Open in IMG/M


 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil31.86%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil13.27%
Vadose Zone SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil8.85%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil5.31%
Bog Forest SoilEnvironmental → Aquatic → Freshwater → Wetlands → Bog → Bog Forest Soil4.42%
Forest SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil3.54%
Corn, Switchgrass And Miscanthus RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere3.54%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil2.65%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Soil2.65%
Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil2.65%
Peatlands SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil1.77%
SoilEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Soil1.77%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil1.77%
PalsaEnvironmental → Terrestrial → Peat → Unclassified → Unclassified → Palsa1.77%
BogEnvironmental → Aquatic → Freshwater → Wetlands → Bog → Bog0.89%
SoilEnvironmental → Aquatic → Freshwater → Groundwater → Unclassified → Soil0.89%
WatershedsEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds0.89%
Surface SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil0.89%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil0.89%
Agricultural SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil0.89%
Hardwood Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil0.89%
Tropical PeatlandEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland0.89%
SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Soil0.89%
Corn RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere0.89%
Plant LitterEnvironmental → Terrestrial → Plant Litter → Unclassified → Unclassified → Plant Litter0.89%
Avena Fatua RhizosphereHost-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Avena Fatua Rhizosphere0.89%
Miscanthus RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere0.89%
Plant RootsHost-Associated → Plants → Roots → Unclassified → Unclassified → Plant Roots0.89%
RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere0.89%
RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Rhizosphere0.89%

Visualization
Powered by ApexCharts



Associated Samples

Taxon OIDSample NameHabitat TypeIMG/M Link
3300001867Texas A ecozone_OM1H0_M2 (Combined assembly for Texas A ecozone Site metagenome samples, ASSEMBLY_DATE=20130705)EnvironmentalOpen in IMG/M
3300004082Coassembly of ECP03_0M1, ECP03_OM2, ECP03_OM3EnvironmentalOpen in IMG/M
3300004114Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of AARS Block 5EnvironmentalOpen in IMG/M
3300005332Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly)EnvironmentalOpen in IMG/M
3300005451Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_130EnvironmentalOpen in IMG/M
3300005537Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen01_05102014_R1EnvironmentalOpen in IMG/M
3300005764Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2)EnvironmentalOpen in IMG/M
3300006028Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaGEnvironmentalOpen in IMG/M
3300006046Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_101EnvironmentalOpen in IMG/M
3300006172Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Cold Stream Run_MetaG_CSR_2014EnvironmentalOpen in IMG/M
3300006173Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaGEnvironmentalOpen in IMG/M
3300006796Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_114EnvironmentalOpen in IMG/M
3300006804Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS200EnvironmentalOpen in IMG/M
3300007265Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1EnvironmentalOpen in IMG/M
3300009088Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H3.8 metaGEnvironmentalOpen in IMG/M
3300009090Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con1.8 metaGEnvironmentalOpen in IMG/M
3300010048Tropical forest soil microbial communities from Panama - MetaG Plot_11EnvironmentalOpen in IMG/M
3300010154Soil microbial communities from Willow Creek, Wisconsin, USA - WC-WI-TBF metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300010358Tropical forest soil microbial communities from Panama - MetaG Plot_3EnvironmentalOpen in IMG/M
3300010361Tropical forest soil microbial communities from Panama - MetaG Plot_23EnvironmentalOpen in IMG/M
3300011120Combined assembly of Microbial Forest Soil metaTEnvironmentalOpen in IMG/M
3300011269Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h3.4A metaGEnvironmentalOpen in IMG/M
3300012203Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz3.16 metaGEnvironmentalOpen in IMG/M
3300012212Combined assembly of Hopland grassland soilHost-AssociatedOpen in IMG/M
3300012285Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_20_16 metaGEnvironmentalOpen in IMG/M
3300012359Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_80_16 metaGEnvironmentalOpen in IMG/M
3300014654Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin06_10_metaGEnvironmentalOpen in IMG/M
3300016294Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.178EnvironmentalOpen in IMG/M
3300016319Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.00HEnvironmentalOpen in IMG/M
3300016371Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.172EnvironmentalOpen in IMG/M
3300016404Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.082EnvironmentalOpen in IMG/M
3300016422Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.111EnvironmentalOpen in IMG/M
3300016445Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.108EnvironmentalOpen in IMG/M
3300018085Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP15_20_MGEnvironmentalOpen in IMG/M
3300020579Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-27-MEnvironmentalOpen in IMG/M
3300020580Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-19-MEnvironmentalOpen in IMG/M
3300021170Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-26-MEnvironmentalOpen in IMG/M
3300021171Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-11-MEnvironmentalOpen in IMG/M
3300021384Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9Host-AssociatedOpen in IMG/M
3300021405Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-7-OEnvironmentalOpen in IMG/M
3300021406Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-32-OEnvironmentalOpen in IMG/M
3300021441Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1Host-AssociatedOpen in IMG/M
3300021479Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-4-MEnvironmentalOpen in IMG/M
3300021559Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-17-MEnvironmentalOpen in IMG/M
3300021560Tropical forest soil microbial communities from Panama - MetaG Plot_4EnvironmentalOpen in IMG/M
3300022508Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-C-19-M (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300022512Metatranscriptome of lab incubated forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-7-O (Metagenome Metatranscriptome) (v2)EnvironmentalOpen in IMG/M
3300022530Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-C-30-O (Metagenome Metatranscriptome) (v2)EnvironmentalOpen in IMG/M
3300025898Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025921Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025928Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300026023Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300026498Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - NI-49-AEnvironmentalOpen in IMG/M
3300027104Forest soil microbial communities from Harvard Forest Long Term Ecological Research site in Petersham, Massachusetts, USA - MetaG HF024 (SPAdes)EnvironmentalOpen in IMG/M
3300027376Forest soil microbial communities from Davy Crockett National Forest, Groveton, Texas, USA - Texas A ecozone_RefH0_M1 (SPAdes)EnvironmentalOpen in IMG/M
3300027701Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP04_OM3 (SPAdes)EnvironmentalOpen in IMG/M
3300027767Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP03_OM2 (SPAdes)EnvironmentalOpen in IMG/M
3300027882Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con1.8 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300028747Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Palsa_E1_2EnvironmentalOpen in IMG/M
3300028906Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 5 (v2)EnvironmentalOpen in IMG/M
3300029636Metatranscriptome of lab incubated forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-M (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300030532Metatranscriptome of forest soil microbial communities from Boreal Montmorency Forest, Quebec, Canada - FO410-VDE108SO (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300030659Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_a_PC metaG (v2)EnvironmentalOpen in IMG/M
3300030743Forest Soil Metatranscriptomes Boreal Montmorency Forest, Quebec, Canada VCO Co-assemblyEnvironmentalOpen in IMG/M
3300031058Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_184 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300031090Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300031231Coassembly Site 11 (all samples) - Champenoux / Amance forestEnvironmentalOpen in IMG/M
3300031236Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Palsa_T0_1EnvironmentalOpen in IMG/M
3300031469Fir Spring Coassembly Site 11 - Champenoux / Amance forestEnvironmentalOpen in IMG/M
3300031545Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.166b4f26EnvironmentalOpen in IMG/M
3300031595Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaGHost-AssociatedOpen in IMG/M
3300031679Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.065b5f23EnvironmentalOpen in IMG/M
3300031724Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.174b1f20EnvironmentalOpen in IMG/M
3300031747Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.174b1f22EnvironmentalOpen in IMG/M
3300031763Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.117b4f29EnvironmentalOpen in IMG/M
3300031771Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f19EnvironmentalOpen in IMG/M
3300031781Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f20EnvironmentalOpen in IMG/M
3300031792Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.053b4f23EnvironmentalOpen in IMG/M
3300031793Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f21EnvironmentalOpen in IMG/M
3300031819Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.088b5f21EnvironmentalOpen in IMG/M
3300031879Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.172 (v2)EnvironmentalOpen in IMG/M
3300031890Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.176 (v2)EnvironmentalOpen in IMG/M
3300031910Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.108 (v2)EnvironmentalOpen in IMG/M
3300031912Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.080 (v2)EnvironmentalOpen in IMG/M
3300031946Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.HF172EnvironmentalOpen in IMG/M
3300031954Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.178 (v2)EnvironmentalOpen in IMG/M
3300032001Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.082 (v2)EnvironmentalOpen in IMG/M
3300032041Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f22EnvironmentalOpen in IMG/M
3300032064Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.171b2f17EnvironmentalOpen in IMG/M
3300032066Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f18EnvironmentalOpen in IMG/M
3300032068Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f21EnvironmentalOpen in IMG/M
3300032160Sb_50d combined assembly (MetaSPAdes)EnvironmentalOpen in IMG/M
3300032205Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_05EnvironmentalOpen in IMG/M
3300032515FICUS49499 Metatranscriptome Czech Republic combined assembly (additional data)EnvironmentalOpen in IMG/M
3300032955Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_2.5EnvironmentalOpen in IMG/M
3300033290Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f15EnvironmentalOpen in IMG/M
3300033486Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_Aug_N3_C1_D5_AEnvironmentalOpen in IMG/M
3300034644Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_123 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap


 ⦗Top⦘

Family Sequences

Protein ID Sample Taxon ID Habitat Sequence
JGI12627J18819_1016423113300001867Forest SoilQQPVKTPQEAAEKLKEAAASPKKSALLLLNRRGVTQYVGVNLSTNQG*
Ga0062384_10105158213300004082Bog Forest SoilTPQEAAEKLKEVAASPKKSALLLLNRHGVTQYVGVNLGGNSG*
Ga0062384_10124979923300004082Bog Forest SoilSPEEAAQQLKEIANSPKKTALLLLNRHGVTQYLGVKLSKDEG*
Ga0062593_10146913823300004114SoilAQDAAQLLRDASKGAKKTALLLLNRRGVTRYVGVDLGANNKG*
Ga0066388_10843036213300005332Tropical Forest SoilKTPEEAAAKLKEIAASPKKSALLLLNRRGVTQYVGVNLGANQG*
Ga0066681_1071732813300005451SoilEAAQKLKEIANSPRKTALLLLNRHGTTQYVGLDLSKNEG*
Ga0070730_1069477813300005537Surface SoilEAADRLKEIASSPNKTALLLLNRHGVTQYLGVEIGRNQG*
Ga0066903_10152472723300005764Tropical Forest SoilAAKLKEIAASPKKSALLLLNRRGITQYVGVNLGANQG*
Ga0070717_1188089313300006028Corn, Switchgrass And Miscanthus RhizosphereQQPVKTPQEAAAKLKDVASSPKKSALLLLNRRGVTQYVGVGLGNQG*
Ga0066652_10157762313300006046SoilPVGTPQETAQKLKEIANSSRKSALLLLNRHGTTQYVGLDLSKNEG*
Ga0075018_1078037123300006172WatershedsTPQEAAAKLKEAAASPKKSALLLLNRHGVTQYVGLNLSANQG*
Ga0070716_10152947613300006173Corn, Switchgrass And Miscanthus RhizosphereQEAAAKLKEVGASPKKSALLLLNRHGVTQYVGVTPGGNQG*
Ga0066665_1048514513300006796SoilQPINTPQEAAAKLKEVAASPKKSALLLLNRHGVTQYVGVSLAGNQG*
Ga0079221_1154936513300006804Agricultural SoilDQQSVKTPQEAAAKLKEAAASSKKSALLLLNRRGATQYVGLNLAANQG*
Ga0099794_1079956823300007265Vadose Zone SoilQEAAAKLKEVGASPKKSALLLLNRHGVTQYVGVAPGGNQG*
Ga0099830_1041010223300009088Vadose Zone SoilGSPAEAAQQLKEIANSPKKTALLLLNRHGVTQYIGVKLSKDEG*
Ga0099830_1107890913300009088Vadose Zone SoilSKLKEIAASPKKSALLLLNRHGVTQYVGVSLGEDRG*
Ga0099827_1173391723300009090Vadose Zone SoilQLKEIANSPKKTALLLLNRHGVTQYVGVKRSKDEG*
Ga0126373_1111262613300010048Tropical Forest SoilAAQQLKEIAASKKSALLLLNRHGVTQYVGVSLGENRG*
Ga0126373_1232842123300010048Tropical Forest SoilTPEEAAEKLKEVANSPKKSTLLLLNRHGVTQYVGVNLGGNNG*
Ga0126373_1287340613300010048Tropical Forest SoilPIGSPKEAADRLRNIAKSPNKSALLLLNRRGVTQYLGVQLDKNQG*
Ga0127503_1095787413300010154SoilKSPQEAAAKLKEVGASPKKSALLLLNRHGVTQYVGVTPSGNQG*
Ga0126370_1254615713300010358Tropical Forest SoilAAKLKEIAASPKKSALLLLNRRGVTQYVGVNLGANQG*
Ga0126378_1134293723300010361Tropical Forest SoilIDQQPVNTPQEAAAKLKEIAASPKKSALLLLNRRGITQYVGVNLGANQG*
Ga0150983_1508986313300011120Forest SoilNTPQEAAAILKEIAASPKKSALLLLNRRGVTQYVGVSLGDYRG*
Ga0137392_1039218033300011269Vadose Zone SoilPAEAAQQLREIAKSQKKTALLLLNRHGVTQYVGVNLGKDQG*
Ga0137399_1178230623300012203Vadose Zone SoilQPVRNPVEAAQQLTEIANSPKKTALLLLNRHGVTQYLGVKLSKDEG*
Ga0150985_10484946013300012212Avena Fatua RhizospherePQEAAQKLKEIANSSRKSALLLLNRHGTTQYVGLDLSKNEG*
Ga0137370_1057349623300012285Vadose Zone SoilVGTPQEAAQKLKEIANSPRKTALLLLNRHGTTQYVGLDLSKNEG*
Ga0137370_1063528013300012285Vadose Zone SoilAAQKLKEAASSPRKSALLLLNRHGVTQYVGLDLGKNEG*
Ga0137385_1071736313300012359Vadose Zone SoilAQQLKEIANSPKKTALLLLNRHGVTQYVGVKLSKDEG*
Ga0181525_1002468843300014654BogSSPQQAADKLRDIANSSNKSALLLLNRHGVTQYLGVELGKNQG*
Ga0182041_1014230813300016294SoilAADQLKEIAASKKSALLLLNRHGVTQYVGVSLGENRG
Ga0182033_1139471023300016319SoilAAKLNEVSKSSKKSALLLLNRHGVTQYVGVNLGGNNG
Ga0182034_1097507623300016371SoilVKTPQEAGVKLKEAAAAPKKSVLLLLNRRGVTQYVGINLGANQG
Ga0182037_1152242913300016404SoilEAAEKLKEVANSPKKSALLLLNRHGVTQYVGVNLGGSNG
Ga0182039_1029813223300016422SoilNSPQEAAEKLKEVAASPKKSALLLLNRHGVMQYVGVSLGGNSG
Ga0182038_1094875813300016445SoilEAAEKLKEVANSPKKSALLLLNRHGVTQYVGVNLGGNNG
Ga0187772_1112576723300018085Tropical PeatlandDQKPVSTPQEAAQQLKEMAASKKSALLLLNRRGVTQYVGVSLGENRG
Ga0210407_1029641423300020579SoilKLKEAASSPKKSALLLLNRRGVTQYVGVNLSANQG
Ga0210403_1079018123300020580SoilSPQEAAAKLKEIAASPKKSALLLLNRHGVTQYVGVSLGEDRG
Ga0210403_1136552313300020580SoilAAKLKEIAASPKRSALILLNRRGITEYVGVTLGGNQG
Ga0210400_1008723313300021170SoilAAGKLKEIAASSKKSALLLLNRHGVTQYVGVSLGENRG
Ga0210405_1024860813300021171SoilVAKLKEAASSPKKSALLLLNRRGVTQYVGVNLSANQG
Ga0213876_1046540413300021384Plant RootsQMLRDAAKTPKKSALLLLNRRGVTRYVGLDLGRNQG
Ga0210387_1122996813300021405SoilAKLKEAASSPKKSALLLLNRHGVTQYVGVNLSANQG
Ga0210386_1137470523300021406SoilAAAKLKEAAASPKKSALLLLNRRGVTQYVGVNLSTNQG
Ga0213871_1012903113300021441RhizospherePEEAAAKLKGAAASPKKSALLLLNRRGVTQYVGLNLSTDQG
Ga0210410_1143821813300021479SoilVKTPQEAAAKLKEAAASPKKSALLLLNRHGTTQYVGVNLSANQG
Ga0210409_1018344213300021559SoilQEAAGKLTEIAGSTKKSALLLLNRHGVTQYVGVSLGENRG
Ga0126371_1373226713300021560Tropical Forest SoilSPQEAAQKLDEVVKSRQKTALLLLNRYGVEHYVGVDLEKNEG
Ga0222728_101011813300022508SoilQEAAAKLKEAAASPKKSALLLLNRRGVTQYVGVNLSTNQG
Ga0242676_103966513300022512SoilEAAAKLKEAAASPKKSALLLLNRHGTTQYVGVNLSANQG
Ga0242658_104137223300022530SoilEAAAKLKEAANSPKKSALLLLNRRGVTQYVGVNLSANQG
Ga0207692_1015803313300025898Corn, Switchgrass And Miscanthus RhizosphereAIDKHPVKTPQEAAEKLKDAATSAKKSALLLLNRRGVTQYVGVSLSANQG
Ga0207652_1176327723300025921Corn RhizosphereEEAAQQLKEAANSPRKSALLLLNRRGMTQYVGINLGKNEG
Ga0207700_1162600413300025928Corn, Switchgrass And Miscanthus RhizosphereMTGVRFSEQKLKEIANSPRKTALLLLNRHGTSQYVGLDLGKNEG
Ga0207677_1050614223300026023Miscanthus RhizosphereNKLRQAAKSQQKTALLLLNRRGVTQYVGVKLGKDEG
Ga0257156_111797023300026498SoilEAAGKLKEIAASSKKSALLLLNRHGVTQYVGVSLGENRG
Ga0208095_100373113300027104Forest SoilTPQEAAGKLKEIAASSKKSALLLLNRHGVTQYVGVSLGENRG
Ga0209004_100557413300027376Forest SoilNSPKEAAEKLKEVVASPKKSALLLLNRHGVTQYVGISVSGNSG
Ga0209447_1008806523300027701Bog Forest SoilRLNEAAHSPKKTVLLLLNRHGVTEYVGMSLGANQG
Ga0209447_1008894913300027701Bog Forest SoilEKLKQVAASPKKSALLLLNRHGVTQYVGVSLGGNSG
Ga0209655_1015816813300027767Bog Forest SoilAKLKEAAASPKKSALLLLNRRGVTQYVGVNLSANQG
Ga0209590_1078411823300027882Vadose Zone SoilQQLKEIAKSPKKTALLLLNRHGVTQYVGINLGKEQG
Ga0302219_1011873923300028747PalsaQEAADKLKDIANSPNKSALLLLNRHGVTQYLGIELGKNQG
Ga0308309_1021884513300028906SoilEAAAKLKEVAASPKKSALLLLNRRGVTQYVGVNLSTNQG
Ga0222749_1047662023300029636SoilQEAAEKLKDAATSAKKSALLLLNRRGVTQYVGVSLSANQG
Ga0210290_153030813300030532SoilAAARINEAAHSPKKTVLLLLNRHGVTEYVGMSLGANQG
Ga0316363_1041522313300030659Peatlands SoilRTPQDAADRLKEIANSPNKTALLLLNRHGVTQYLGVEIGKNQG
Ga0265461_1181245813300030743SoilTPQEAAARLNEAGHSPKKTVLLLLNRHGVTEYVGMSLGANQG
Ga0308189_1021975513300031058SoilPQEAAAKLKEAAASPKKSALLLLDRRGVTQYVGVNLSANQG
Ga0265760_1016600323300031090SoilQPMTSPEETAARLRDIAKSPNKNALLLLNRHGVTQYLGIQLDKNQG
Ga0170824_10297410313300031231Forest SoilNQQPVNTPQEAAGKLKEIAASPKKSALLLLNRRGVTQYVGVSLGDYRG
Ga0170824_10566318223300031231Forest SoilEAAAKLKEAAASPKKSALLLLNRHGVTQYVGLNLSANQG
Ga0302324_10139898813300031236PalsaRLKEIGDSPQKNALLLLDRHGVTQYVGVKLGKDEG
Ga0170819_1284735913300031469Forest SoilQEAAAKLTEAATSPKKSALLLLNRHGVTQYVGVNLGANQG
Ga0318541_1085592213300031545SoilAEKLKEVANSPKKSALLLLNRHGVTQYVGVNLGGNNG
Ga0265313_1041699123300031595RhizosphereTPQEAADRLDEIAKSPQKTALLLLDRHGVTQYVGVTLGKNAG
Ga0318561_1002745513300031679SoilEKLKEVANSSKKNALLLLNRHGVTQYVGVNLANNNG
Ga0318561_1003400733300031679SoilSPQEAAEKLKEVAASPKKSALLLLNRHGVMQYVGVSLGGNSG
Ga0318561_1080987523300031679SoilNTPEQAAEKLKEVANSPRKSALLLLNRHGVTQYVGVNLSGNNG
Ga0318500_1022315613300031724SoilVKTPQEAGAKLKEAAAAPKKSVLLLLNRRGVTQYVGINLGANQG
Ga0318502_1097889323300031747SoilVNNPKEAADKLKEVANSPKKSALLLLNRHGVTQYVGVNLGSNNG
Ga0318537_1020372123300031763SoilPQEAVEKLKEIAASPKKSALLLLNRHGVTQYVGVSLGSDNG
Ga0318546_1135322223300031771SoilAVKTPQEAAAKLKEIAASPKKSALILLNRHGVTQYVGLTLGSNQG
Ga0318547_1033035023300031781SoilVKLKEAAAAPKKSVLLLLNRRGVTQYVGINLGANQG
Ga0318529_1014643923300031792SoilQEAAEKLKEVAASPKKSALLLLNRHGVMQYVGVSLGGNSG
Ga0318548_1048998523300031793SoilEAAEKLKEVASSSKKSALILLNRHGVAQYVGVSLGGNQG
Ga0318568_1020593313300031819SoilAAKLNEVANSPKKSALLLLNRHGVTQYVGVNLGSNNG
Ga0306919_1002179513300031879SoilAADKLKEVANSPKKSALLLLNRHGVTQYVGVNLGSNNG
Ga0306919_1024607813300031879SoilVNTPEEAAVKLKEVANSPKKSALLLLNRHGVTQYVGVNLGGNNG
Ga0306919_1033662413300031879SoilEAAAKLKEAAASPKKSALLLLNRRGVTQYVGVNLSANQG
Ga0306919_1053561613300031879SoilQEAVEKLKEIAASPKKSALLLLNRHGVTQYVGVSLGSDNG
Ga0306925_1079984013300031890SoilAAAKLNEVSKSSKKSALLLLNRHGVTQYVGVNLGNNNG
Ga0306923_1041178213300031910SoilEAAVKLKEVANSPKKSALLLLNRHGVTQYVGVNLGGNNG
Ga0306921_1002841513300031912SoilTPQEAAAKLNEAIHSPRKTALLLLNRHGVTEYIGVTLGANQG
Ga0310910_1024060923300031946SoilPEEAAAKLNEVSKSSKKSALLLLNRHGVTQYVGVNLGNNNG
Ga0306926_1005108313300031954SoilAGAKLKEAAAAPKKSVLLLLNRRGVTQYVGINLGANQG
Ga0306922_1018897233300032001SoilKLKEVANSPKKSALLLLNRHGVTQYVGVNLGGNNG
Ga0318549_1001239613300032041SoilEKLKEVANSSKKNALLLLNRHGVTQYVGVNLGNNNG
Ga0318510_1011496023300032064SoilIDQQPVNTPQEAAAKLKEIAASPKKSALLLLNRRGVTQYVGVNLGANQG
Ga0318510_1023298313300032064SoilPKEAADKLKEVANSPKKSALLLLNRHGVTQYVGVNLGSNNG
Ga0318514_1059125223300032066SoilEAAEKLKEIAASPKKSALLLLNRRGVTQYVGLNLRANQG
Ga0318553_1002204813300032068SoilNTPREAAEKLKEIAASPKKSALLLLNRRGVTQYVGLNLRANQG
Ga0318553_1021440413300032068SoilKEAADKLKEVANSPKKSALLLLNRHGVTQYVGVNLGSNNG
Ga0311301_1169968513300032160Peatlands SoilVRTPQEAAAKLTGVPASPKKNILLLLNRHGVTQYVGMELGKNQG
Ga0307472_10035736413300032205Hardwood Forest SoilKTPQEAAGKLKEIAASSKKSALLLLNRRGITQYVGVSLGDNRG
Ga0348332_1162583913300032515Plant LitterAARLRDIAKSPNKNALLLLNRHGVTQYLGVELGKNQG
Ga0335076_1148837713300032955SoilADKLREIANAPNKSALLLLNRHGVTQYLGVELNKG
Ga0318519_1002733513300033290SoilKEAAEKLKEVANSSKKNALLLLNRHGVTQYVGVNLANNNG
Ga0316624_1100516923300033486SoilVGSPEEAARTLKEIAKSPQKNALLLLNRHGVTQYVGVSLGKDEG
Ga0370548_050848_38_1963300034644SoilVVAIDQQPVKTPQEAAAKLKEAAASPKKSALLLLDRRGVAQYVGINLSANQG

 ⦗Top⦘


Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.