NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome / Metatranscriptome Family F083040

Metagenome / Metatranscriptome Family F083040

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F083040
Family Type Metagenome / Metatranscriptome
Number of Sequences 113
Average Sequence Length 44 residues
Representative Sequence ACILVGTLIGWAAGSVGYGLAFGAVVGIPVGVAATVIKYRNA
Number of Associated Samples 106
Number of Associated Scaffolds 113

Quality Assessment
Transcriptomic Evidence Yes
Most common taxonomic group Bacteria
% of genes with valid RBS motifs 13.27 %
% of genes near scaffold ends (potentially truncated) 77.88 %
% of genes from short scaffolds (< 2000 bps) 94.69 %
Associated GOLD sequencing projects 103
AlphaFold2 3D model prediction Yes
3D model pTM-score0.39

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Bacteria (95.575 % of family members)
NCBI Taxonomy ID 2
Taxonomy All Organisms → cellular organisms → Bacteria

Most Common Ecosystem
GOLD Ecosystem Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil
(7.965 % of family members)
Environment Ontology (ENVO) Unclassified
(32.743 % of family members)
Earth Microbiome Project Ontology (EMPO) Host-associated → Plant → Plant rhizosphere
(42.478 % of family members)


 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      

 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Transmembrane (alpha-helical) Signal Peptide: No Secondary Structure distribution: α-helix: 52.86%    β-sheet: 0.00%    Coil/Unstructured: 47.14%
Feature Viewer
Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer
Per-residue confidence (pLDDT):
  0-50   51-70   71-90   91-100  		pTM-score: 0.39
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.

 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 113 Family Scaffolds
PF00119ATP-synt_A 15.93
PF08240ADH_N 4.42
PF00953Glycos_transf_4 1.77
PF13450NAD_binding_8 1.77
PF03462PCRF 0.88
PF05221AdoHcyase 0.88
PF02874ATP-synt_ab_N 0.88
PF00155Aminotran_1_2 0.88
PF08352oligo_HPY 0.88
PF00137ATP-synt_C 0.88
PF00213OSCP 0.88

Neighboring Clusters of Orthologous Genes (COGs)

COG IDNameFunctional Category % Frequency in 113 Family Scaffolds
COG0356FoF1-type ATP synthase, membrane subunit aEnergy production and conversion [C] 15.93
COG0472UDP-N-acetylmuramyl pentapeptide phosphotransferase/UDP-N-acetylglucosamine-1-phosphate transferaseCell wall/membrane/envelope biogenesis [M] 1.77
COG0216Protein chain release factor RF1Translation, ribosomal structure and biogenesis [J] 0.88
COG0499S-adenosylhomocysteine hydrolaseCoenzyme transport and metabolism [H] 0.88
COG0636FoF1-type ATP synthase, membrane subunit c/Archaeal/vacuolar-type H+-ATPase, subunit KEnergy production and conversion [C] 0.88
COG0712FoF1-type ATP synthase, delta subunitEnergy production and conversion [C] 0.88
COG1186Protein chain release factor PrfBTranslation, ribosomal structure and biogenesis [J] 0.88

 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms95.58 %
UnclassifiedrootN/A4.42 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
2140918008|ConsensusfromContig268984All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium718Open in IMG/M
3300001536|A1565W1_10620920All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1245Open in IMG/M
3300001686|C688J18823_11026093All Organisms → cellular organisms → Bacteria523Open in IMG/M
3300002568|C688J35102_120580846All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1204Open in IMG/M
3300004479|Ga0062595_102373703All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium525Open in IMG/M
3300004480|Ga0062592_100458758All Organisms → cellular organisms → Bacteria1037Open in IMG/M
3300005093|Ga0062594_102373773All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium579Open in IMG/M
3300005166|Ga0066674_10421171All Organisms → cellular organisms → Bacteria615Open in IMG/M
3300005172|Ga0066683_10630195All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria646Open in IMG/M
3300005339|Ga0070660_100303802All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales1308Open in IMG/M
3300005435|Ga0070714_101672779All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria622Open in IMG/M
3300005549|Ga0070704_101388859All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales644Open in IMG/M
3300005549|Ga0070704_101525136All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium615Open in IMG/M
3300005557|Ga0066704_10958598All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium528Open in IMG/M
3300005578|Ga0068854_101739998All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium571Open in IMG/M
3300005842|Ga0068858_101148979All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → Conexibacteraceae → Conexibacter → Conexibacter woesei763Open in IMG/M
3300005844|Ga0068862_101642941All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria650Open in IMG/M
3300006046|Ga0066652_101365799All Organisms → cellular organisms → Bacteria665Open in IMG/M
3300006175|Ga0070712_100988131All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → Conexibacteraceae → Conexibacter → Conexibacter woesei728Open in IMG/M
3300006794|Ga0066658_10425054All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → Conexibacteraceae → Conexibacter → Conexibacter woesei723Open in IMG/M
3300006806|Ga0079220_10994472All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium665Open in IMG/M
3300006904|Ga0075424_101795054All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium649Open in IMG/M
3300006953|Ga0074063_13596466All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria906Open in IMG/M
3300009093|Ga0105240_11541474All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium696Open in IMG/M
3300009176|Ga0105242_11634903All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium679Open in IMG/M
3300009176|Ga0105242_11915632All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium633Open in IMG/M
3300009545|Ga0105237_12228525All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium557Open in IMG/M
3300009551|Ga0105238_10890726All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria908Open in IMG/M
3300009660|Ga0105854_1000533All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria17165Open in IMG/M
3300010042|Ga0126314_10460612All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium920Open in IMG/M
3300010042|Ga0126314_10855525All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium671Open in IMG/M
3300010123|Ga0127479_1166488All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium618Open in IMG/M
3300010325|Ga0134064_10269535All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium637Open in IMG/M
3300010326|Ga0134065_10300772All Organisms → cellular organisms → Bacteria → Proteobacteria615Open in IMG/M
3300010361|Ga0126378_12516387All Organisms → cellular organisms → Bacteria588Open in IMG/M
3300010364|Ga0134066_10376212All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium534Open in IMG/M
3300010366|Ga0126379_10863549All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium1006Open in IMG/M
3300010396|Ga0134126_12762598All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium532Open in IMG/M
3300011271|Ga0137393_11151594All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium659Open in IMG/M
3300011969|Ga0120166_1019439All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium794Open in IMG/M
3300012200|Ga0137382_10498923All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium864Open in IMG/M
3300012203|Ga0137399_11581148All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium543Open in IMG/M
3300012212|Ga0150985_108752943All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium774Open in IMG/M
3300012212|Ga0150985_123006118All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia1220Open in IMG/M
3300012353|Ga0137367_10001107All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria20828Open in IMG/M
3300012360|Ga0137375_10001928All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria24280Open in IMG/M
3300012406|Ga0134053_1166668All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes891Open in IMG/M
3300012469|Ga0150984_103509320All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → Conexibacteraceae → Conexibacter → Conexibacter woesei794Open in IMG/M
3300012469|Ga0150984_103587693All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium671Open in IMG/M
3300012929|Ga0137404_10995711All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia767Open in IMG/M
3300012930|Ga0137407_11204470All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria719Open in IMG/M
3300012957|Ga0164303_10657993All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium699Open in IMG/M
3300012958|Ga0164299_10257742All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium1047Open in IMG/M
3300012960|Ga0164301_11751502All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium521Open in IMG/M
3300012977|Ga0134087_10505990All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium609Open in IMG/M
3300012985|Ga0164308_11107455All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium710Open in IMG/M
3300012987|Ga0164307_11622961All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium548Open in IMG/M
3300013100|Ga0157373_11221383All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium567Open in IMG/M
3300013105|Ga0157369_10105393All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales3002Open in IMG/M
3300013297|Ga0157378_12300280All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium590Open in IMG/M
3300014056|Ga0120125_1029403All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium1174Open in IMG/M
3300014325|Ga0163163_10696916All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium1079Open in IMG/M
3300014497|Ga0182008_10202104All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium1011Open in IMG/M
3300014969|Ga0157376_10415319All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1304Open in IMG/M
3300015171|Ga0167648_1096644All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium602Open in IMG/M
3300015242|Ga0137412_10698382All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium755Open in IMG/M
3300015264|Ga0137403_11164390Not Available617Open in IMG/M
3300015373|Ga0132257_101726676All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria803Open in IMG/M
3300015374|Ga0132255_103988290All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium627Open in IMG/M
3300016270|Ga0182036_10778239All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium778Open in IMG/M
3300017924|Ga0187820_1123191All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium762Open in IMG/M
3300017937|Ga0187809_10414476All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium515Open in IMG/M
3300017947|Ga0187785_10290787All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria747Open in IMG/M
3300017959|Ga0187779_10671296All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium699Open in IMG/M
3300018032|Ga0187788_10288280All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium662Open in IMG/M
3300018032|Ga0187788_10461595All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium543Open in IMG/M
3300019890|Ga0193728_1348644All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium533Open in IMG/M
3300020080|Ga0206350_11651674All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium941Open in IMG/M
3300020082|Ga0206353_10334366All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium683Open in IMG/M
3300020610|Ga0154015_1457180All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium529Open in IMG/M
3300021374|Ga0213881_10566466All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium517Open in IMG/M
3300022467|Ga0224712_10097734All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → Conexibacteraceae → Conexibacter → Conexibacter woesei1240Open in IMG/M
3300024182|Ga0247669_1035533All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → Conexibacteraceae → Conexibacter → Conexibacter woesei837Open in IMG/M
3300024222|Ga0247691_1037880All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium733Open in IMG/M
3300025937|Ga0207669_10399999All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → Conexibacteraceae → Conexibacter → Conexibacter woesei1076Open in IMG/M
3300026041|Ga0207639_10975023All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → Conexibacteraceae → Conexibacter → Conexibacter woesei794Open in IMG/M
3300026078|Ga0207702_11402801All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium692Open in IMG/M
3300026142|Ga0207698_11365218All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → Conexibacteraceae → Conexibacter → Conexibacter woesei724Open in IMG/M
3300026324|Ga0209470_1202581All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium838Open in IMG/M
3300026325|Ga0209152_10460816All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium514Open in IMG/M
3300027765|Ga0209073_10298066All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium638Open in IMG/M
3300027826|Ga0209060_10354826All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium668Open in IMG/M
3300028558|Ga0265326_10039600Not Available1339Open in IMG/M
3300028558|Ga0265326_10188122All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium592Open in IMG/M
3300028563|Ga0265319_1005898All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia5762Open in IMG/M
3300028573|Ga0265334_10188754All Organisms → cellular organisms → Bacteria → Terrabacteria group718Open in IMG/M
3300028721|Ga0307315_10068413All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1011Open in IMG/M
3300028800|Ga0265338_10676090Not Available714Open in IMG/M
3300028878|Ga0307278_10250559All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria786Open in IMG/M
3300029990|Ga0311336_10546100All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → Conexibacteraceae → Conexibacter → Conexibacter woesei985Open in IMG/M
3300031240|Ga0265320_10272144All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium750Open in IMG/M
3300031251|Ga0265327_10059139All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1964Open in IMG/M
3300031549|Ga0318571_10456300All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium508Open in IMG/M
3300031726|Ga0302321_101907016Not Available689Open in IMG/M
3300031835|Ga0318517_10489553All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium554Open in IMG/M
3300031939|Ga0308174_10160600All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales1681Open in IMG/M
3300032074|Ga0308173_11588792Not Available615Open in IMG/M
3300032782|Ga0335082_11143259All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium645Open in IMG/M
3300032828|Ga0335080_11478067All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria673Open in IMG/M
3300032893|Ga0335069_10093248All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia3818Open in IMG/M
3300034125|Ga0370484_0177257All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium579Open in IMG/M
3300034195|Ga0370501_0091163All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium1017Open in IMG/M
3300034268|Ga0372943_0548828All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria756Open in IMG/M


 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
Vadose Zone SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil7.96%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil7.08%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Soil6.19%
RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Rhizosphere6.19%
Grasslands SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil5.31%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil4.42%
Corn, Switchgrass And Miscanthus RhizosphereEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Corn, Switchgrass And Miscanthus Rhizosphere3.54%
Tropical PeatlandEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland3.54%
Corn RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere3.54%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil2.65%
PermafrostEnvironmental → Terrestrial → Soil → Unclassified → Permafrost → Permafrost2.65%
SoilEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Soil2.65%
Corn, Switchgrass And Miscanthus RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere2.65%
Corn RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere2.65%
Freshwater SedimentEnvironmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment1.77%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil1.77%
Serpentine SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Serpentine Soil1.77%
Agricultural SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil1.77%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural → Soil1.77%
Untreated Peat SoilEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Untreated Peat Soil1.77%
SoilEnvironmental → Terrestrial → Soil → Loam → Grasslands → Soil1.77%
FenEnvironmental → Terrestrial → Peat → Unclassified → Unclassified → Fen1.77%
Arabidopsis RhizosphereHost-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere1.77%
Avena Fatua RhizosphereHost-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Avena Fatua Rhizosphere1.77%
Switchgrass RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere1.77%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere1.77%
Corn RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere1.77%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere1.77%
Avena Fatua RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Avena Fatua Rhizosphere1.77%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil0.89%
Terrestrial SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil0.89%
Glacier Forefield SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Glacier Forefield Soil0.89%
Surface SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil0.89%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Permafrost → Soil0.89%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil0.89%
Permafrost SoilEnvironmental → Terrestrial → Soil → Wetlands → Permafrost → Permafrost Soil0.89%
Agricultural SoilEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Agricultural Soil0.89%
Exposed RockEnvironmental → Terrestrial → Rock-Dwelling (Subaerial Biofilms) → Unclassified → Unclassified → Exposed Rock0.89%
Switchgrass RhizosphereHost-Associated → Plants → Roots → Rhizosphere → Soil → Switchgrass Rhizosphere0.89%
Populus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere0.89%
RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere0.89%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Miscanthus Rhizosphere0.89%
Corn RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere0.89%

Visualization
Powered by ApexCharts



Associated Samples

Taxon OIDSample NameHabitat TypeIMG/M Link
2140918008Permafrost microbial communities from permafrost in Bonanza Creek, Alaska - Bog_allEnvironmentalOpen in IMG/M
3300001536Permafrost active layer microbial communities from McGill Arctic Research Station, Canada - (A15-65cm-8A)- 1 week illuminaEnvironmentalOpen in IMG/M
3300001686Grasslands soil microbial communities from Hopland, California, USAEnvironmentalOpen in IMG/M
3300002568Grasslands soil microbial communities from Hopland, California, USA - 2EnvironmentalOpen in IMG/M
3300004479Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of All WPAsEnvironmentalOpen in IMG/M
3300004480Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of AARS Block 4EnvironmentalOpen in IMG/M
3300005093Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of KBS All BlocksEnvironmentalOpen in IMG/M
3300005166Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_123EnvironmentalOpen in IMG/M
3300005172Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_132EnvironmentalOpen in IMG/M
3300005339Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaGHost-AssociatedOpen in IMG/M
3300005435Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaGEnvironmentalOpen in IMG/M
3300005549Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaGEnvironmentalOpen in IMG/M
3300005557Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_153EnvironmentalOpen in IMG/M
3300005578Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2Host-AssociatedOpen in IMG/M
3300005842Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2Host-AssociatedOpen in IMG/M
3300005844Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2Host-AssociatedOpen in IMG/M
3300006046Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_101EnvironmentalOpen in IMG/M
3300006175Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaGEnvironmentalOpen in IMG/M
3300006794Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_107EnvironmentalOpen in IMG/M
3300006806Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS100EnvironmentalOpen in IMG/M
3300006904Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD3Host-AssociatedOpen in IMG/M
3300006953Soil and rhizosphere microbial communities from Centre INRS-Institut Armand-Frappier, Laval, Canada - Soil microcosm metaTmtHMB (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300009093Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaGHost-AssociatedOpen in IMG/M
3300009176Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaGHost-AssociatedOpen in IMG/M
3300009545Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaGHost-AssociatedOpen in IMG/M
3300009551Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaGHost-AssociatedOpen in IMG/M
3300009660Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Organic soil DNA_2013-058EnvironmentalOpen in IMG/M
3300010042Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot105BEnvironmentalOpen in IMG/M
3300010123Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Met_20_5_8_2 metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300010325Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_20cm_2_0_1 metaGEnvironmentalOpen in IMG/M
3300010326Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_20cm_2_24_1 metaGEnvironmentalOpen in IMG/M
3300010361Tropical forest soil microbial communities from Panama - MetaG Plot_23EnvironmentalOpen in IMG/M
3300010364Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_2_09212015EnvironmentalOpen in IMG/M
3300010366Tropical forest soil microbial communities from Panama - MetaG Plot_24EnvironmentalOpen in IMG/M
3300010396Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-2EnvironmentalOpen in IMG/M
3300011271Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h3.4B metaGEnvironmentalOpen in IMG/M
3300011969Permafrost microbial communities from Nunavut, Canada - A23_80cm_12MEnvironmentalOpen in IMG/M
3300012200Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_20_16 metaGEnvironmentalOpen in IMG/M
3300012203Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz3.16 metaGEnvironmentalOpen in IMG/M
3300012212Combined assembly of Hopland grassland soilHost-AssociatedOpen in IMG/M
3300012353Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_80_16 metaGEnvironmentalOpen in IMG/M
3300012360Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_113_16 metaGEnvironmentalOpen in IMG/M
3300012406Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Glu_40cm_5_4_1 metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300012469Combined assembly of Soil carbon rhizosphereHost-AssociatedOpen in IMG/M
3300012929Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_16fungal (Illumina Assembly)EnvironmentalOpen in IMG/M
3300012930Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_2_16fungal (Illumina Assembly)EnvironmentalOpen in IMG/M
3300012957Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_207_MGEnvironmentalOpen in IMG/M
3300012958Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_221_MGEnvironmentalOpen in IMG/M
3300012960Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_231_MGEnvironmentalOpen in IMG/M
3300012977Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Glu_20cm_5_24_1 metaGEnvironmentalOpen in IMG/M
3300012985Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_246_MGEnvironmentalOpen in IMG/M
3300012987Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_243_MGEnvironmentalOpen in IMG/M
3300013100Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaGHost-AssociatedOpen in IMG/M
3300013105Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaGHost-AssociatedOpen in IMG/M
3300013297Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaGHost-AssociatedOpen in IMG/M
3300014056Permafrost microbial communities from Nunavut, Canada - A20_5cm_0MEnvironmentalOpen in IMG/M
3300014325Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaGHost-AssociatedOpen in IMG/M
3300014497Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaGHost-AssociatedOpen in IMG/M
3300014969Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaGHost-AssociatedOpen in IMG/M
3300015171Arctic soil microbial communities from a glacier forefield, Storglaci?ren, Tarfala, Sweden (Sample st-3a, vegetated patch on medial moraine)EnvironmentalOpen in IMG/M
3300015242Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_16fungal (Hybrid Assembly)EnvironmentalOpen in IMG/M
3300015264Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_16fungal (Hybrid Assembly)EnvironmentalOpen in IMG/M
3300015373Combined assembly of cpr5 rhizosphereHost-AssociatedOpen in IMG/M
3300015374Col-0 rhizosphere combined assemblyHost-AssociatedOpen in IMG/M
3300016270Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.080EnvironmentalOpen in IMG/M
3300017924Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_5EnvironmentalOpen in IMG/M
3300017937Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - ASW_4EnvironmentalOpen in IMG/M
3300017947Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0815_BV2_4_20_MGEnvironmentalOpen in IMG/M
3300017959Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_Q2_SP10_10_MGEnvironmentalOpen in IMG/M
3300018032Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_BV01_MP10_20_MGEnvironmentalOpen in IMG/M
3300019890Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U1c1EnvironmentalOpen in IMG/M
3300020080Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2)EnvironmentalOpen in IMG/M
3300020082Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2)EnvironmentalOpen in IMG/M
3300020610Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300021374Barbacenia macrantha exposed rock microbial communities from rupestrian grasslands, the National Park of Serra do Cipo, Brazil - ER_R08EnvironmentalOpen in IMG/M
3300022467Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2)EnvironmentalOpen in IMG/M
3300024182Soil microbial communities from Purdue University Martell Research Forest, Indiana, United States - CNK10EnvironmentalOpen in IMG/M
3300024222Soil microbial communities from Purdue University Martell Research Forest, Indiana, United States - CNK32EnvironmentalOpen in IMG/M
3300025937Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300026041Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300026078Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300026142Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300026324Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_125 (SPAdes)EnvironmentalOpen in IMG/M
3300026325Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_107 (SPAdes)EnvironmentalOpen in IMG/M
3300027765Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS100 (SPAdes)EnvironmentalOpen in IMG/M
3300027826Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen06_05102014_R1 (SPAdes)EnvironmentalOpen in IMG/M
3300028558Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaGHost-AssociatedOpen in IMG/M
3300028563Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaGHost-AssociatedOpen in IMG/M
3300028573Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaGHost-AssociatedOpen in IMG/M
3300028721Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_355EnvironmentalOpen in IMG/M
3300028800Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaGHost-AssociatedOpen in IMG/M
3300028878Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_117EnvironmentalOpen in IMG/M
3300029990I_Fen_N2 coassemblyEnvironmentalOpen in IMG/M
3300031240Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaGHost-AssociatedOpen in IMG/M
3300031251Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaGHost-AssociatedOpen in IMG/M
3300031549Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.088b5f24EnvironmentalOpen in IMG/M
3300031726Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Fen_T0_1EnvironmentalOpen in IMG/M
3300031835Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f21EnvironmentalOpen in IMG/M
3300031939Soil microbial communities from UC Gill Tract Community Farm, Albany, California, United States - DLSLS.P.R2EnvironmentalOpen in IMG/M
3300032074Soil microbial communities from UC Gill Tract Community Farm, Albany, California, United States - DLSLS.P.R1EnvironmentalOpen in IMG/M
3300032782Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.1EnvironmentalOpen in IMG/M
3300032828Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.4EnvironmentalOpen in IMG/M
3300032893Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_1.1EnvironmentalOpen in IMG/M
3300034125Peat soil microbial communities from wetlands in Alaska, United States - Sheep_creek_tus_01_15EnvironmentalOpen in IMG/M
3300034195Peat soil microbial communities from wetlands in Alaska, United States - Sheep_creek_fen_01D_17EnvironmentalOpen in IMG/M
3300034268Forest soil microbial communities from Eldorado National Forest, California, USA - SNFC_MG_FRD_1.2EnvironmentalOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap


 ⦗Top⦘

Family Sequences

Protein ID Sample Taxon ID Habitat Sequence
Bog_all_C_068473802140918008SoilVLIGFTAACVVAGTLIGWAVGSLGYGLAFGAVVGVPVGVAVTVIRYRNI
A1565W1_1062092033300001536PermafrostCIAVGTLVGWAVGSIRYGLAFGAVVGIPVGVATTVIKYRNI*
C688J18823_1102609323300001686SoilCIAVGTLIGWAAGNAGYGLAFGAVVGIPVGVAATVIKYRNA*
C688J35102_12058084613300002568SoilTAAVIAAGTLLGWVVGNLKLGLLFGAVLGIPAGVAATVIKYRNA*
Ga0062595_10237370323300004479SoilTAACILIGTLIGWAAGSVVYGLAFGAVVGIPAGVAATVIKYRNA*
Ga0062592_10045875833300004480SoilTAACIVLGAVVGWAAGSVAYGLVFGAVVGIPVGVAATILRYRNV*
Ga0062594_10237377323300005093SoilTAACIVVGTLIGWAIGKTGYGLAFGAVVGIPVGVATTVIKYRNM*
Ga0066674_1042117123300005166SoilVAGTLIGWAVGKLGLGLAMGAVVGVPVGVAVTVIKYRNV*
Ga0066683_1063019513300005172SoilGSVLIGFTAACIVAGGLIGWALGNAGYGIALGAVVGIPVGVATTVIRYRNV*
Ga0070660_10030380233300005339Corn RhizosphereACILVGTLIGWAAGSVGYGLAFGAVVGIPVGVAATVIKYRNA*
Ga0070714_10167277913300005435Agricultural SoilTAACIVAGTLIGWAVGSADYGLVFGAVVGIPVGVAATVIKYRHI*
Ga0070704_10138885913300005549Corn, Switchgrass And Miscanthus RhizosphereIVLGTVIGWAAGSVAYGLVFGAVIGVPVGVAATILRYRDM*
Ga0070704_10152513613300005549Corn, Switchgrass And Miscanthus RhizosphereALGTVIGWVAGSAAYGLVFGAVVGIPVGVAATILRYRNI*
Ga0066704_1095859813300005557SoilGFTAACVVAGTLIGWAVGSLGYGLAFGAVVGIPVGVAVTVIRYRNI*
Ga0068854_10173999823300005578Corn RhizosphereGTLIGWAAGSVGYGLAFGAVVGIPVGVAATVIKYRNA*
Ga0068858_10114897913300005842Switchgrass RhizosphereIGWAAGSVAYGIVFGAVVGIPVGVAATIVKYRDM*
Ga0068862_10164294113300005844Switchgrass RhizosphereGGVLFGFTAACIVIGVVIGWAVGNAAYGLVFGALVGIPVGVAATILRYRDI*
Ga0066652_10136579913300006046SoilAGAGSVLIGFTAACIAVGTLIGWALGNVGYGLAFGAVVGIPVGVAATVVKYRNI*
Ga0070712_10098813133300006175Corn, Switchgrass And Miscanthus RhizosphereGTLIGWAVGKPGLGLALGSVVGVPVGVAATVIKYRNL*
Ga0066658_1042505433300006794SoilAAVIAVGTLIGWAFGKLGYGLAFGAVVGIPVGVAATVIKYRNI*
Ga0079220_1099447233300006806Agricultural SoilVVAGTLIGWAVGKPGLGLAFGAVVGVPVGVAVTVIKYRNV*
Ga0075424_10179505413300006904Populus RhizosphereVGTLIGWAVGELGYGFAFGAVVGVPVGIAATVIKYRNV*
Ga0074063_1359646613300006953SoilLVGTLIGWAAGSVRYGLAFGAVVGVPVGVAATVIKYRNV*
Ga0105240_1154147413300009093Corn RhizosphereACIAVGALVGWAMGNVGYGFAFGAVAGVPVGVAATVIRYRNI*
Ga0105242_1163490333300009176Miscanthus RhizosphereFGFTAACIVLGLLIGWAAGSVAYGLVFGAVVGIPVGVAATIWRYRNV*
Ga0105242_1191563213300009176Miscanthus RhizosphereGSVLIGFTAAVIAVGTLLGWAVGNLKLGLLFGAVLGIPAGVAATVIKYRNA*
Ga0105237_1222852523300009545Corn RhizosphereVLIGSTAACILLGTVIGWAIGKTGYGLALGAVVGIPVGVATTVIKYRNI*
Ga0105238_1089072623300009551Corn RhizosphereVLIGSTAACIVVGTLIGWAIGKTGYGLAFGAVVGIPVGVATTVIKYRNM*
Ga0105854_1000533163300009660Permafrost SoilVLIGSTTACIAVGTLVGWAAGSIRYGLAFGAVVGIPVGVATTVFKYRNI*
Ga0126314_1046061233300010042Serpentine SoilCIAAGALVGWAVGNWPVGLAIGTVVGIPVGVAVTVLRYRNAI*
Ga0126314_1085552533300010042Serpentine SoilGFTAACIILGALIGWAAGSVAYGIVFGAVIGIPVGVAATILRYRDMS*
Ga0127479_116648813300010123Grasslands SoilACIVLGALIGWAAGSLAYGIVFGAVIGIPVGVAATIVRYRDMS*
Ga0134064_1026953513300010325Grasslands SoilAGAGSVLIGFTAACVVAGTLIGWAVGKPGLGLAFGAVVGIPVGVAVTVIKYRNV*
Ga0134065_1030077223300010326Grasslands SoilTAACIVLGALIGWAAGSVAYGIVFGAVIGMPVGVAATIVRYRDMS*
Ga0126378_1251638723300010361Tropical Forest SoilTTAACVVLGALVGWALGNVGYGFAFGAVVGIPAGVAATVIKYRNA*
Ga0134066_1037621213300010364Grasslands SoilIGWAAGSLRYGLAFGAVVGIPAGVAATVIKYRNA*
Ga0126379_1086354933300010366Tropical Forest SoilFTAACIAVGAVIGWAAGSLAYGIAFGAVIGIPVGVAATIVKYRNV*
Ga0134126_1276259823300010396Terrestrial SoilLIGFTLAVIVVGTLIGWAVGYAGYGLAFGAVVGIPVGVAATVIKYRNV*
Ga0137393_1115159433300011271Vadose Zone SoilSTAACIVVGTLIGWAIGKTGYGLAFGAVVGVPVGVATTVIKYRNM*
Ga0120166_101943913300011969PermafrostVLIGSTAACIVVGTLVGWAAGSIRYGLAFGAVVGIPVGVATTVIKYRNI*
Ga0137382_1049892323300012200Vadose Zone SoilVLIGFTAACVVAGTLIGWAVGSLGYGLAFGAVVGIPVGVAVTVIRYRNI*
Ga0137399_1158114823300012203Vadose Zone SoilVLIGSTAACIVVGTLIGWAIGKTGYGLAFGAVVGVPVGVATTVLKYRNI*
Ga0150985_10875294333300012212Avena Fatua RhizosphereLGALIGWAAGSLAYGIVFGAVIGIPVGVAATILRYRDMT*
Ga0150985_12300611813300012212Avena Fatua RhizosphereAAVIAVGTLLGWVVGNLKLGLLFGAVLGIPAGVAATVIKYRNA*
Ga0137367_10001107223300012353Vadose Zone SoilTAACIVLGAAIGWVAGSVAYGIVFGAVVGIPVGVAATILRYRNL*
Ga0137375_1000192813300012360Vadose Zone SoilGSVLIGFTAACLVAGLLVGWAFGSAGIGLAVGAVVGIPVGVAATVIKYRNV*
Ga0134053_116666833300012406Grasslands SoilLIGWAIGNVGYGLAFGAVVGIPVGVAATVIKYRNA*
Ga0150984_10350932033300012469Avena Fatua RhizosphereLIGWAFGELGYGLAFGAVVGIPVGVAATVIKYRNI*
Ga0150984_10358769313300012469Avena Fatua RhizosphereAAGTLLGWVVGNLKLGLLFGAVLGIPAGVAATVIKYRNA*
Ga0137404_1099571113300012929Vadose Zone SoilIGWAIGKTGYGLAFGAVVGIPVGVATTVIKYRNM*
Ga0137407_1120447023300012930Vadose Zone SoilVLIGSTAACILVGTLIGWAIGKTGYGLAFGAVVGIPVGVATTVIKYRNM*
Ga0164303_1065799313300012957SoilIGVVIGWAVGNAAYGLVFGALVGIPVGVAATILRYRNI*
Ga0164299_1025774233300012958SoilSTAACVVVGTFVGWAAGSIGYGLAFGAVVGIPVGVATTVIKYRNM*
Ga0164301_1175150213300012960SoilILVGTLIGWAAGSVGYGLAFGAVVGIPVGVAATVIKYRNA*
Ga0134087_1050599023300012977Grasslands SoilGFTAACVVAGTLIGWAVGNLGLGLALGAVVGISVGVAATVIKYRNA*
Ga0164308_1110745513300012985SoilLIGFTAACIVAGTLIGWAVGSADYGLVFGAVVGIPVGVAATVIKYRNI*
Ga0164307_1162296123300012987SoilILLGALIGWAAGSLGYGIAFGAVVGIPVGVAATIVKYRNV*
Ga0157373_1122138313300013100Corn RhizosphereLIGWAAGSVGYGLAFGAVVGIPAGVAATVIKYRNA*
Ga0157369_1010539363300013105Corn RhizosphereVLIGSTAACILLGTLIGWAIGKTGYGLALGAVVGIPVGVATTVIKYRNI*
Ga0157378_1230028013300013297Miscanthus RhizosphereIAVGTLIGWAVGNVGYGFAFGAVVGVPVGIAATVIKYRNI*
Ga0120125_102940333300014056PermafrostIGFTAACIVAGTLIGWAAGNFGYGLAFGAVVGIPVGVAATVIKYRNI*
Ga0163163_1069691633300014325Switchgrass RhizosphereVLGALIGWAAGSLAYGLVFGAVIGIPAGVAATILRYRDM*
Ga0182008_1020210433300014497RhizosphereVVGTLIGWAAGNFGYGLAFGAVVGIPVGVAATVIKYRNI*
Ga0157376_1041531913300014969Miscanthus RhizosphereAGTLIGWAVGSADYGLVFGAVVGIPVGVAATVIKYRNI*
Ga0167648_109664423300015171Glacier Forefield SoilVGALIGWAIGKTGYGLALGAVVGIPVGVATTVIKYRNI*
Ga0137412_1069838233300015242Vadose Zone SoilVLIGSTAACIVVGTLIGWAIGKTGYGLAFGAVVGVPVGVATTVIKYRNI*
Ga0137403_1116439013300015264Vadose Zone SoilVLIGFTAACIAAGTLIGWAAGGLGYGFALGAVVGIPVGVAATV
Ga0132257_10172667633300015373Arabidopsis RhizosphereSVLIGCTAACIGIGTLIGWALGSVGYGLAFGAVVGIPAGVAATVIKYRNA*
Ga0132255_10398829013300015374Arabidopsis RhizosphereVVIGWAAGNAAYGLVFGALVGIPVGVAATILRYRNI*
Ga0182036_1077823933300016270SoilALIGLAVGKFGYGFAIGAVVGVPVGVATTVIKYRNV
Ga0187820_112319113300017924Freshwater SedimentMVAGALVGLAVGSLGIGLAVGAVVGVPAGVAVTVVKYRNV
Ga0187809_1041447613300017937Freshwater SedimentTAACVVLGALVGWAVGNVGYGFAFGAVVGIPAGVAVTVIKYRNA
Ga0187785_1029078733300017947Tropical PeatlandLVGWLAGNVAYGVAFGSVVGIPVGVAATVIKYRNV
Ga0187779_1067129633300017959Tropical PeatlandLVGWALGSAAYGLAFGAVVGIPVGVAVTIVKYRNV
Ga0187788_1028828033300018032Tropical PeatlandALIGWAAGSGGMGIARGAVVGVPVGIAATVIRYRNV
Ga0187788_1046159523300018032Tropical PeatlandALVGWLAGSVAYGLAFGAVVGIPVGVATTVIKYRNV
Ga0193728_134864413300019890SoilTLIGWAAGNFGYGLAFGAVVGIPVGVAATVIKYRNI
Ga0206350_1165167413300020080Corn, Switchgrass And Miscanthus RhizosphereLAGAGSVLIGFTAACIAVGALVGWAAGNVGYGLAFGALVGIPVGVAATVIKYRNA
Ga0206353_1033436623300020082Corn, Switchgrass And Miscanthus RhizosphereVLIGFTAACIVAGGLIGWAVGSVGIGIALGAVVGVPVGVATVVVKYRNA
Ga0154015_145718013300020610Corn, Switchgrass And Miscanthus RhizosphereFTAACIAVGALVGWAAGNVGYGLAFGALVGIPVGVAATVIKYRNA
Ga0213881_1056646623300021374Exposed RockSVLIGFTAACILVGTLIGWAVGSLGYGLAFGAVAGIPAGVAATVIKYRNV
Ga0224712_1009773433300022467Corn, Switchgrass And Miscanthus RhizosphereLIGWAAGSVGYGLAFGAVVGIPVGVAATVIKYRNA
Ga0247669_103553333300024182SoilAGSVLIGSTAACILLGTVIGWAIGKTGYGLALGAVVGIPVGVATTVIKYRNI
Ga0247691_103788033300024222SoilLIGWAVGKVGYGLAFGAVVGIPVGVAATVIKYRNI
Ga0207669_1039999933300025937Miscanthus RhizosphereCIVAGTLIGWAVGSADYGLVFGAVVGIPVGVAATVIKYRNI
Ga0207639_1097502333300026041Corn RhizosphereAACIAVGTLAGWLMGNLGYGLAFGSVVGVPVGVAATVIRYRDV
Ga0207702_1140280133300026078Corn RhizosphereAGAGSVLIGFTAAVIAVGTLLGWAVGNLKLGLLFGAVLGIPAGVAATVIKYRNA
Ga0207698_1136521813300026142Corn RhizosphereTAAVIAVGTLLGWAVGNLKLGLLFGAVLGIPAGVAATVIKYRNA
Ga0209470_120258113300026324SoilFTAACIVLGALIGWAAGSLAYGIVFGAVIGIPVGVAATIVRYRDMS
Ga0209152_1046081623300026325SoilIAAVIAVGTLIGWAFGKLGYGLAFGAVVGIPVGVAATVIKYRNI
Ga0209073_1029806613300027765Agricultural SoilVVAGTLIGWAVGKPGLGLAFGAVVGVPVGVAVTVIKYRNV
Ga0209060_1035482613300027826Surface SoilVLIGTTAACVVLGALVGWALGSVGYGFAFGAVVRIPAGVAATVIKYRNA
Ga0265326_1003960023300028558RhizosphereVLIGFTTACILVGTLIGWAAGGLGYGLAFGAVVGIPIGVAVTVVKYRNI
Ga0265326_1018812213300028558RhizosphereTACILVGTLIGWAAGGLGYGLAFGAVVGIPIGVAVTVVKYRNL
Ga0265319_100589833300028563RhizosphereVLIGFTTACILVGTLIGWAAGGLGYGLAFGAVVGIPVGVAVTVVKYRNL
Ga0265334_1018875423300028573RhizosphereVLIGFTTACILVGTLIGWAAGEVGYGLAFGAVVGVPVGVAVTVVKYRNV
Ga0307315_1006841313300028721SoilVVGTLIGWAIGKTGYGLAFGAVVGVPVGVATTVIKYRNM
Ga0265338_1067609023300028800RhizosphereVLIGFTTACILVGTLIGWAAGEVGYGLAFGAVVGVPVGVAVTVVKY
Ga0307278_1025055923300028878SoilMACIVAGTLIGWAAGSVRYGLAFGAVAGIPVGVAATVIKYRNI
Ga0311336_1054610013300029990FenVAGTLIGWAVGSLGYGLAFGAVVGIPVGVAVTVIRYRNI
Ga0265320_1027214413300031240RhizosphereLIGWAAGGVGYGLAFGAVVGVPVGVAVTVVKYRNV
Ga0265327_1005913923300031251RhizosphereVLIGFTAACVVAGTLIGWAVGNLGYGLAFGSVVGVPVGVAVTVIRYRNI
Ga0318571_1045630013300031549SoilSLAGAGSVLIGFTAACIVVGTLIGWAVGHLGLGLALGSVVGIPVGVAATVIKYRNV
Ga0302321_10190701613300031726FenVLIGFTTACILVGTLIGWAAGGVGYGLAFGAVVGVPVGVAVTVVKYRNV
Ga0318517_1048955323300031835SoilILIGALLGWAAGSLGYGIVFGAVIGIPVGVGVTIWKYRNV
Ga0308174_1016060013300031939SoilGSVLIGFTAACIAVGTLAGWLMGNLGYGLAFGSVVGVPVGVAATVIRYRDV
Ga0308173_1158879213300032074SoilLIGWAVGRVGIGVAIGAVVGIPVGVATTVVKYRNV
Ga0335082_1114325933300032782SoilGFTAACIVAGALVGWLAGNVAYGVAFGSVVGIPVGVAATVIKYRNL
Ga0335080_1147806713300032828SoilVLIGFTAACIVVGALVGWALGSFGYGLAFGAVVGIPVGVAVTVVKYRNI
Ga0335069_1009324823300032893SoilVLIGFTAACIVVGALVGWALGSFAYGLAFGAVVGIPVGVAVTVVKYRNV
Ga0370484_0177257_350_4993300034125Untreated Peat SoilVLIGFTAACVVAGTLIGWAVGSLGYGLAFGSVVGVPVGVAVTVIRYRNI
Ga0370501_0091163_167_2743300034195Untreated Peat SoilLIGWAVGSLGYGLAFGAVVGVPVGVAVTVIRYRNI
Ga0372943_0548828_102_2513300034268SoilVLIGFTAACVVAGTLIGWAVGHLGLGLAFGAVVGIPVGVAVTVIRYRNI

 ⦗Top⦘


Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.