NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome / Metatranscriptome Family F083033

Metagenome / Metatranscriptome Family F083033

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F083033
Family Type Metagenome / Metatranscriptome
Number of Sequences 113
Average Sequence Length 42 residues
Representative Sequence PEIIVTDVRLSDADLVLGIDFLRPRRIWFSYGSQQIFIMRRA
Number of Associated Samples 95
Number of Associated Scaffolds 113

Quality Assessment
Transcriptomic Evidence Yes
Most common taxonomic group Bacteria
% of genes with valid RBS motifs 0.00 %
% of genes near scaffold ends (potentially truncated) 96.46 %
% of genes from short scaffolds (< 2000 bps) 92.92 %
Associated GOLD sequencing projects 93
AlphaFold2 3D model prediction Yes
3D model pTM-score0.28

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Bacteria (87.611 % of family members)
NCBI Taxonomy ID 2
Taxonomy All Organisms → cellular organisms → Bacteria

Most Common Ecosystem
GOLD Ecosystem Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil
(45.133 % of family members)
Environment Ontology (ENVO) Unclassified
(47.788 % of family members)
Earth Microbiome Project Ontology (EMPO) Free-living → Non-saline → Soil (non-saline)
(46.903 % of family members)



 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      


 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Globular Signal Peptide: No Secondary Structure distribution: α-helix: 0.00%    β-sheet: 24.29%    Coil/Unstructured: 75.71%
Feature Viewer
Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer
Per-residue confidence (pLDDT):
  0-50   51-70   71-90   91-100  
pTM-score: 0.28
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.


 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 113 Family Scaffolds
PF03972MmgE_PrpD 38.94
PF12146Hydrolase_4 2.65
PF00496SBP_bac_5 1.77
PF13487HD_5 0.88
PF01343Peptidase_S49 0.88
PF13007LZ_Tnp_IS66 0.88
PF00296Bac_luciferase 0.88
PF00657Lipase_GDSL 0.88
PF09912DUF2141 0.88
PF14579HHH_6 0.88
PF00211Guanylate_cyc 0.88
PF13358DDE_3 0.88
PF12681Glyoxalase_2 0.88
PF02738MoCoBD_1 0.88

Neighboring Clusters of Orthologous Genes (COGs)

COG IDNameFunctional Category % Frequency in 113 Family Scaffolds
COG20792-methylcitrate dehydratase PrpDCarbohydrate transport and metabolism [G] 38.94
COG0616Periplasmic serine protease, ClpP classPosttranslational modification, protein turnover, chaperones [O] 1.77
COG2114Adenylate cyclase, class 3Signal transduction mechanisms [T] 0.88
COG2141Flavin-dependent oxidoreductase, luciferase family (includes alkanesulfonate monooxygenase SsuD and methylene tetrahydromethanopterin reductase)Coenzyme transport and metabolism [H] 0.88


 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms87.61 %
UnclassifiedrootN/A12.39 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
3300004152|Ga0062386_100773898All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium790Open in IMG/M
3300005172|Ga0066683_10677957All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium614Open in IMG/M
3300005332|Ga0066388_106555876All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Acetobacteraceae587Open in IMG/M
3300005437|Ga0070710_10117640All Organisms → cellular organisms → Bacteria → Proteobacteria1604Open in IMG/M
3300005437|Ga0070710_10234773All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria1172Open in IMG/M
3300005439|Ga0070711_101562100All Organisms → cellular organisms → Bacteria → Proteobacteria576Open in IMG/M
3300005445|Ga0070708_101401303All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium652Open in IMG/M
3300005552|Ga0066701_10526376All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria729Open in IMG/M
3300005556|Ga0066707_10292640All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium1066Open in IMG/M
3300005569|Ga0066705_10401083All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria859Open in IMG/M
3300005764|Ga0066903_106393237All Organisms → cellular organisms → Bacteria615Open in IMG/M
3300006175|Ga0070712_101288788All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium636Open in IMG/M
3300006175|Ga0070712_101912301All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium520Open in IMG/M
3300006796|Ga0066665_10971799All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium653Open in IMG/M
3300006806|Ga0079220_11763224Not Available544Open in IMG/M
3300010048|Ga0126373_10182680All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria2019Open in IMG/M
3300010048|Ga0126373_11908265Not Available657Open in IMG/M
3300010343|Ga0074044_10140526All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium1618Open in IMG/M
3300010359|Ga0126376_11813526All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria648Open in IMG/M
3300010360|Ga0126372_12352133All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium583Open in IMG/M
3300010376|Ga0126381_100393469All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria1928Open in IMG/M
3300010398|Ga0126383_13367629Not Available522Open in IMG/M
3300010398|Ga0126383_13448900All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium516Open in IMG/M
3300012202|Ga0137363_10815339All Organisms → cellular organisms → Bacteria792Open in IMG/M
3300012210|Ga0137378_10259654All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium1617Open in IMG/M
3300012210|Ga0137378_11007188All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium747Open in IMG/M
3300012210|Ga0137378_11706518All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium536Open in IMG/M
3300012971|Ga0126369_10844506All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1000Open in IMG/M
3300014497|Ga0182008_10715015Not Available574Open in IMG/M
3300014497|Ga0182008_10991613Not Available500Open in IMG/M
3300015245|Ga0137409_10537654All Organisms → cellular organisms → Bacteria → Proteobacteria995Open in IMG/M
3300016270|Ga0182036_10317492All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium1190Open in IMG/M
3300016270|Ga0182036_11398882All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium586Open in IMG/M
3300016294|Ga0182041_11843918All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium561Open in IMG/M
3300016357|Ga0182032_10309420All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium1250Open in IMG/M
3300016357|Ga0182032_11164398All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium663Open in IMG/M
3300016387|Ga0182040_10348833All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria1147Open in IMG/M
3300016387|Ga0182040_10468423Not Available1001Open in IMG/M
3300016422|Ga0182039_11885495All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium549Open in IMG/M
3300020199|Ga0179592_10077577All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium1523Open in IMG/M
3300021178|Ga0210408_11078755All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium618Open in IMG/M
3300021401|Ga0210393_10767397All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium785Open in IMG/M
3300021407|Ga0210383_11497992All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium558Open in IMG/M
3300021432|Ga0210384_11126471All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium688Open in IMG/M
3300021474|Ga0210390_11357716All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium568Open in IMG/M
3300021478|Ga0210402_10488805All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium1143Open in IMG/M
3300021560|Ga0126371_11532064All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria794Open in IMG/M
3300022507|Ga0222729_1013139All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium900Open in IMG/M
3300022525|Ga0242656_1013570All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium1132Open in IMG/M
3300022531|Ga0242660_1092402All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium729Open in IMG/M
3300022713|Ga0242677_1034663All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium689Open in IMG/M
3300022726|Ga0242654_10203126All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium690Open in IMG/M
3300025939|Ga0207665_10381684All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium1069Open in IMG/M
3300026550|Ga0209474_10268058All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium1038Open in IMG/M
3300026557|Ga0179587_10954801All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium565Open in IMG/M
3300027698|Ga0209446_1095729All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium761Open in IMG/M
3300027765|Ga0209073_10253375Not Available685Open in IMG/M
3300027903|Ga0209488_10032177All Organisms → cellular organisms → Bacteria3823Open in IMG/M
3300028047|Ga0209526_10448448All Organisms → cellular organisms → Bacteria849Open in IMG/M
3300031469|Ga0170819_10815268All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium686Open in IMG/M
3300031545|Ga0318541_10660730All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium584Open in IMG/M
3300031549|Ga0318571_10264289All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium636Open in IMG/M
3300031564|Ga0318573_10014061All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria3469Open in IMG/M
3300031668|Ga0318542_10603872All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium572Open in IMG/M
3300031724|Ga0318500_10575725All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium569Open in IMG/M
3300031740|Ga0307468_101326829All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium657Open in IMG/M
3300031744|Ga0306918_10197931All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium1513Open in IMG/M
3300031748|Ga0318492_10118361All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium1315Open in IMG/M
3300031764|Ga0318535_10036770Not Available1991Open in IMG/M
3300031770|Ga0318521_10353962All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium870Open in IMG/M
3300031771|Ga0318546_10475376All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium876Open in IMG/M
3300031777|Ga0318543_10297885All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium721Open in IMG/M
3300031792|Ga0318529_10101020Not Available1301Open in IMG/M
3300031794|Ga0318503_10033039All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium1525Open in IMG/M
3300031795|Ga0318557_10115595All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium1197Open in IMG/M
3300031795|Ga0318557_10358375All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium670Open in IMG/M
3300031796|Ga0318576_10491732All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium579Open in IMG/M
3300031798|Ga0318523_10314226All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium781Open in IMG/M
3300031819|Ga0318568_10685477All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria637Open in IMG/M
3300031823|Ga0307478_10124421All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium2025Open in IMG/M
3300031831|Ga0318564_10361340All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium637Open in IMG/M
3300031833|Ga0310917_11005294All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium559Open in IMG/M
3300031835|Ga0318517_10158756All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria1013Open in IMG/M
3300031835|Ga0318517_10519130All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium536Open in IMG/M
3300031859|Ga0318527_10036493All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium1860Open in IMG/M
3300031893|Ga0318536_10446704All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium652Open in IMG/M
3300031896|Ga0318551_10415165All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium766Open in IMG/M
3300031897|Ga0318520_10970390All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium536Open in IMG/M
3300031910|Ga0306923_10336113All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium1723Open in IMG/M
3300031941|Ga0310912_11031821All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium630Open in IMG/M
3300031942|Ga0310916_11518114All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium546Open in IMG/M
3300031945|Ga0310913_10701150All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium716Open in IMG/M
3300031946|Ga0310910_10637194All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium844Open in IMG/M
3300031947|Ga0310909_10189518All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium1705Open in IMG/M
3300031981|Ga0318531_10039609All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium1967Open in IMG/M
3300032001|Ga0306922_10242046All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria1938Open in IMG/M
3300032001|Ga0306922_10585795All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium1183Open in IMG/M
3300032001|Ga0306922_11074421All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium826Open in IMG/M
3300032025|Ga0318507_10036504All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium1868Open in IMG/M
3300032025|Ga0318507_10493307All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium533Open in IMG/M
3300032035|Ga0310911_10301643All Organisms → cellular organisms → Bacteria922Open in IMG/M
3300032035|Ga0310911_10326717All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium884Open in IMG/M
3300032051|Ga0318532_10205427All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium699Open in IMG/M
3300032065|Ga0318513_10125661Not Available1213Open in IMG/M
3300032065|Ga0318513_10583099All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium548Open in IMG/M
3300032094|Ga0318540_10309603All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium762Open in IMG/M
3300032261|Ga0306920_100128679All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales3768Open in IMG/M
3300032261|Ga0306920_101222408All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium1084Open in IMG/M
3300032515|Ga0348332_11798773All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium889Open in IMG/M
3300032893|Ga0335069_11914567Not Available627Open in IMG/M



 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil45.13%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil13.27%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil7.96%
Vadose Zone SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil7.08%
Corn, Switchgrass And Miscanthus RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere6.19%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Soil5.31%
Bog Forest SoilEnvironmental → Aquatic → Freshwater → Wetlands → Bog → Bog Forest Soil1.77%
Agricultural SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil1.77%
Hardwood Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil1.77%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil1.77%
RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere1.77%
Grass SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Grass Soil0.89%
Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil0.89%
SoilEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Soil0.89%
Bog Forest SoilEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Bog Forest Soil0.89%
Forest SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil0.89%
SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Soil0.89%
Plant LitterEnvironmental → Terrestrial → Plant Litter → Unclassified → Unclassified → Plant Litter0.89%

Visualization
Powered by ApexCharts



Associated Samples

Taxon OIDSample NameHabitat TypeIMG/M Link
2170459010Grass soil microbial communities from Rothamsted Park, UK - December 2009 direct MP BIO1O1 lysis 0-9cm (no DNA from 10 to 21cm!!!)EnvironmentalOpen in IMG/M
3300004152Coassembly of ECP12_OM1, ECP12_OM2, ECP12_OM3EnvironmentalOpen in IMG/M
3300005172Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_132EnvironmentalOpen in IMG/M
3300005332Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly)EnvironmentalOpen in IMG/M
3300005437Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaGEnvironmentalOpen in IMG/M
3300005439Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaGEnvironmentalOpen in IMG/M
3300005445Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaGEnvironmentalOpen in IMG/M
3300005552Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_150EnvironmentalOpen in IMG/M
3300005556Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_156EnvironmentalOpen in IMG/M
3300005569Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_154EnvironmentalOpen in IMG/M
3300005764Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2)EnvironmentalOpen in IMG/M
3300005921Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 6EnvironmentalOpen in IMG/M
3300006175Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaGEnvironmentalOpen in IMG/M
3300006796Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_114EnvironmentalOpen in IMG/M
3300006806Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS100EnvironmentalOpen in IMG/M
3300010048Tropical forest soil microbial communities from Panama - MetaG Plot_11EnvironmentalOpen in IMG/M
3300010343Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - Bog Forest MetaG ECP23OM1EnvironmentalOpen in IMG/M
3300010359Tropical forest soil microbial communities from Panama - MetaG Plot_15EnvironmentalOpen in IMG/M
3300010360Tropical forest soil microbial communities from Panama - MetaG Plot_6EnvironmentalOpen in IMG/M
3300010376Tropical forest soil microbial communities from Panama - MetaG Plot_28EnvironmentalOpen in IMG/M
3300010398Tropical forest soil microbial communities from Panama - MetaG Plot_35EnvironmentalOpen in IMG/M
3300012202Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_115_16 metaGEnvironmentalOpen in IMG/M
3300012210Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_60_16 metaGEnvironmentalOpen in IMG/M
3300012971Tropical forest soil microbial communities from Panama - MetaG Plot_1EnvironmentalOpen in IMG/M
3300014497Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaGHost-AssociatedOpen in IMG/M
3300015245Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug1_16fungal (Hybrid Assembly)EnvironmentalOpen in IMG/M
3300016270Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.080EnvironmentalOpen in IMG/M
3300016294Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.178EnvironmentalOpen in IMG/M
3300016357Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.000EnvironmentalOpen in IMG/M
3300016387Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.176EnvironmentalOpen in IMG/M
3300016422Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.111EnvironmentalOpen in IMG/M
3300020199Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_08_16fungal (Illumina Assembly)EnvironmentalOpen in IMG/M
3300020583Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-32-MEnvironmentalOpen in IMG/M
3300021178Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-4-MEnvironmentalOpen in IMG/M
3300021401Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-27-OEnvironmentalOpen in IMG/M
3300021407Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-14-OEnvironmentalOpen in IMG/M
3300021432Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-MEnvironmentalOpen in IMG/M
3300021474Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-11-OEnvironmentalOpen in IMG/M
3300021478Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-7-MEnvironmentalOpen in IMG/M
3300021560Tropical forest soil microbial communities from Panama - MetaG Plot_4EnvironmentalOpen in IMG/M
3300022507Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-C-27-M (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300022525Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-H-4-M (Metagenome Metatranscriptome) (v2)EnvironmentalOpen in IMG/M
3300022531Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-H-28-M (Metagenome Metatranscriptome) (v2)EnvironmentalOpen in IMG/M
3300022713Metatranscriptome of lab incubated forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-27-O (Metagenome Metatranscriptome) (v2)EnvironmentalOpen in IMG/M
3300022726Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-C-30-M (Metagenome Metatranscriptome) (v2)EnvironmentalOpen in IMG/M
3300025939Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300026550Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_145 (SPAdes)EnvironmentalOpen in IMG/M
3300026557Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_08_16fungalEnvironmentalOpen in IMG/M
3300027698Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP04_OM2 (SPAdes)EnvironmentalOpen in IMG/M
3300027765Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS100 (SPAdes)EnvironmentalOpen in IMG/M
3300027903Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_2 (SPAdes)EnvironmentalOpen in IMG/M
3300028047Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM2H0_M1 (SPAdes)EnvironmentalOpen in IMG/M
3300031469Fir Spring Coassembly Site 11 - Champenoux / Amance forestEnvironmentalOpen in IMG/M
3300031545Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.166b4f26EnvironmentalOpen in IMG/M
3300031549Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.088b5f24EnvironmentalOpen in IMG/M
3300031564Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f21EnvironmentalOpen in IMG/M
3300031668Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.168b4f23EnvironmentalOpen in IMG/M
3300031724Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.174b1f20EnvironmentalOpen in IMG/M
3300031740Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gases AM2C_05EnvironmentalOpen in IMG/M
3300031744Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.00H (v2)EnvironmentalOpen in IMG/M
3300031748Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.108b1f22EnvironmentalOpen in IMG/M
3300031764Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.117b4f27EnvironmentalOpen in IMG/M
3300031770Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f17EnvironmentalOpen in IMG/M
3300031771Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f19EnvironmentalOpen in IMG/M
3300031777Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.168b4f24EnvironmentalOpen in IMG/M
3300031792Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.053b4f23EnvironmentalOpen in IMG/M
3300031794Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.174b1f23EnvironmentalOpen in IMG/M
3300031795Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.065b5f19EnvironmentalOpen in IMG/M
3300031796Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f24EnvironmentalOpen in IMG/M
3300031798Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f19EnvironmentalOpen in IMG/M
3300031819Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.088b5f21EnvironmentalOpen in IMG/M
3300031823Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM4C_05EnvironmentalOpen in IMG/M
3300031831Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.066b5f20EnvironmentalOpen in IMG/M
3300031833Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.LF178EnvironmentalOpen in IMG/M
3300031835Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f21EnvironmentalOpen in IMG/M
3300031859Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.052b4f25EnvironmentalOpen in IMG/M
3300031893Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.117b4f28EnvironmentalOpen in IMG/M
3300031896Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f19EnvironmentalOpen in IMG/M
3300031897Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f16EnvironmentalOpen in IMG/M
3300031910Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.108 (v2)EnvironmentalOpen in IMG/M
3300031941Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.OX080EnvironmentalOpen in IMG/M
3300031942Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.LF176EnvironmentalOpen in IMG/M
3300031945Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.OX082EnvironmentalOpen in IMG/M
3300031946Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.HF172EnvironmentalOpen in IMG/M
3300031947Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.T000HEnvironmentalOpen in IMG/M
3300031981Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.053b4f25EnvironmentalOpen in IMG/M
3300032001Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.082 (v2)EnvironmentalOpen in IMG/M
3300032025Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.084b2f20EnvironmentalOpen in IMG/M
3300032035Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.HF170EnvironmentalOpen in IMG/M
3300032051Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.053b4f26EnvironmentalOpen in IMG/M
3300032065Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.171b2f20EnvironmentalOpen in IMG/M
3300032094Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.166b4f25EnvironmentalOpen in IMG/M
3300032261Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170 (v2)EnvironmentalOpen in IMG/M
3300032515FICUS49499 Metatranscriptome Czech Republic combined assembly (additional data)EnvironmentalOpen in IMG/M
3300032893Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_1.1EnvironmentalOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap



 ⦗Top⦘

Family Sequences

Protein ID Sample Taxon ID Habitat Sequence
F62_075086602170459010Grass SoilEINLNDADFVLGIDFLGSQRVWISYGSQQLFLMRRI
Ga0062386_10077389813300004152Bog Forest SoilPALIVADVSLRDADLILGVDFLSSRRIWLSYGSQQIFLSRRT*
Ga0066683_1067795723300005172SoilRNPEIIIADLKLSDADLVLCIDIVRQRRIWLSYGAQKIFLLRRT*
Ga0066388_10655587623300005332Tropical Forest SoilIRNPQLIVTDIRLNDADVVLGIDLLKSQRVWMSYGSQQIFLMRR*
Ga0070710_1011764023300005437Corn, Switchgrass And Miscanthus RhizosphereIRDPEIGVTDLRLSDADLVLGVDFLQSRRVWMSYGSQQIFLSRVG*
Ga0070710_1023477353300005437Corn, Switchgrass And Miscanthus RhizosphereIRDPEIGVTDLRLSDADLVLGVDFLQSRRVWMSYGSQQIFLSRRS*
Ga0070711_10156210033300005439Corn, Switchgrass And Miscanthus RhizosphereEVIRDPEIGVTDLRLSDADLVLGVDFLQSRRVWMSYGSQQIFLSRRS*
Ga0070708_10140130313300005445Corn, Switchgrass And Miscanthus RhizosphereIVTDVKLSDADLVLGIDFLNSRRIWLSYGSQQIFLLRRT*
Ga0066701_1052637613300005552SoilGGEVIRNPEIIIADLKLGDADLVLGIDIVRPWRIWLSYGAQKIFVLRRT*
Ga0066707_1029264013300005556SoilRNPEIIIADLKLSDADLVLGIDVVRPWRIWLSYGAQKIFVLRRT*
Ga0066705_1040108313300005569SoilNPTLIVADVSLKDADLILGIDFLSSRRIWLSYGSQQIFLSRRT*
Ga0066903_10639323723300005764Tropical Forest SoilDIFIRNPEIDVADIRLSEADLVLGIDFLSSRRIWMSYGSQQIFLWGRT*
Ga0070766_1012904713300005921SoilEINLNDADFVLGIDFLGSQRVWISYGSQQLFLMRRI*
Ga0070712_10128878813300006175Corn, Switchgrass And Miscanthus RhizosphereVADVSLKDADLILGIDFLGSRRIWLSYGSQQIFLLRPT*
Ga0070712_10191230123300006175Corn, Switchgrass And Miscanthus RhizosphereRLSDADLVLGVDFLQSRRVWMSYGSQQIFLSRRS*
Ga0066665_1097179913300006796SoilVVRNPELIVTDFKLNDADLLIWIDILSSRRIWLSYGSQQIFLSHRV*
Ga0079220_1176322413300006806Agricultural SoilLRLSDADLVLGVDFLQSRRVWMSYGSQQIFLSRRN*
Ga0126373_1018268013300010048Tropical Forest SoilPQVVRNPELIVTDIRLNDADIVLGIDFLRSQRIWMSYGSEQIFLMRR*
Ga0126373_1190826513300010048Tropical Forest SoilVVRNPEIIVTDVRLNDADLVLGIDLMRSQRVWLSYGSRQIFLMRR*
Ga0074044_1014052633300010343Bog Forest SoilVTDVRLSDADLVLGIDFLKSRRIWLSYGSQQIFLLRRT*
Ga0126376_1181352623300010359Tropical Forest SoilVADVSIKDADLVLGFDFLSARRLWLSYGSQQIFLTRRG*
Ga0126372_1235213313300010360Tropical Forest SoilTIRNPEIIVTDVTLSDADLVLGIDFLRPRRIWFSYGSQQIFIMRRT*
Ga0126381_10039346933300010376Tropical Forest SoilGGDIFIRNPEIDVADIRLSEADLVLGIDFLSSRRIWMSYGSQQIFLWGRT*
Ga0126383_1336762913300010398Tropical Forest SoilQLQIGPEVIRNPQLIVTDIRLNDADVVLGIDLLKSQRVWMSYGSQQIFLMRR*
Ga0126383_1344890013300010398Tropical Forest SoilGAETIRNPEIIVTDVTLSDADLVLGIDFLKPRRIWFSYGSQQIFIMRRT*
Ga0137363_1081533923300012202Vadose Zone SoilLRNPEIVVADVKLGDADLVLGIDFLISRRIWLSYGSEQIFLSRRG*
Ga0137378_1025965413300012210Vadose Zone SoilEILRNPEIVVADVKLGDADLVLGIDFLISRRIWLSYGSERIFLSRRT*
Ga0137378_1100718823300012210Vadose Zone SoilTLRDADLVLGVDFVRSRRIWFSYRSRQIFLRRATR*
Ga0137378_1170651813300012210Vadose Zone SoilDFKLNDADLLIGIDILSSRRIWLSYGSQQIFLSHRV*
Ga0126369_1084450623300012971Tropical Forest SoilIVTDIRLNDADIVLGIDFLRSQRIWMSYGSQQIFLARR*
Ga0182008_1071501523300014497RhizosphereVTNLRLQDADVVLGVDFLRSRRVWLSYGSHQIFLAHPA*
Ga0182008_1099161313300014497RhizosphereVTGNPEIGVTDLRLSDADLVLGVDFLRSRRVWMSYGSQLIFLSRRI*
Ga0137409_1053765413300015245Vadose Zone SoilRVHPVGEAIRNPEIIVADLNLSDADLVLGIDIVRPWRIWLSYGVQKIFLLRRT*
Ga0182036_1031749233300016270SoilVTDVMLSDADLVLGIDFLKSRRLWLSYGSQQLFLSRRT
Ga0182036_1139888213300016270SoilNPEIIVTDVRLSDADLVLGIDFLRARRIWFSYGSRQIFIMRRS
Ga0182041_1184391813300016294SoilLIIADVSLKDADLVLGIDFLGSRRVWLSYGSQQIFLARRT
Ga0182032_1030942033300016357SoilEIVVTDVRLSDADLVLGIDFLRARRIWFSYGSRQIFIMRRS
Ga0182032_1116439813300016357SoilDVRLSDADLVLGIDFLRPRRIWFSYGSQQIFIMRRA
Ga0182040_1034883313300016387SoilELIVADVSLKDADLILGIDFLSSRRLWLSYGAQQIFLSRRS
Ga0182040_1046842323300016387SoilGTVAIRSPEMIVTELRLSDADLVLGIDFLRSRRIWLSYGSGQIFLLHST
Ga0182039_1188549513300016422SoilIIVTDVRLSDADLVLGIDFLRPRRIWFSYGSQQIFIMRGA
Ga0179592_1007757713300020199Vadose Zone SoilIIVAGLNLSDADLVLGIDIVRSWRIWLSYGAQKIFLLRRT
Ga0210401_1126039213300020583SoilTEINLNDADFVLGIDFLGSQRVWISYGSQQLFLMRRI
Ga0210408_1107875513300021178SoilVKLGDADLVLGIDFLISRRIWLSYGSVQIFLSRRG
Ga0210393_1076739713300021401SoilNPEIIVAGLNLSDADLVLGIDIVRSWRIWLSYGAQKIFLLRRT
Ga0210383_1149799213300021407SoilEVIRDPEIGVTDLRLSDANLVLGVDFLQSRRVWMSYGSQQIFLSRRS
Ga0210384_1112647133300021432SoilEIIVAGLNLSDADLVLGIDIVRSWRIWLSYGAQKIFLLRRT
Ga0210390_1135771613300021474SoilADVSLRDADLVLGIDFLASRRIWLSYGSQQIFLSRRT
Ga0210402_1048880513300021478SoilDLKLSDADLVLGIDFLRPRRVWLSYGSQQLFLLRRI
Ga0126371_1153206413300021560Tropical Forest SoilEVGGEVVHNPELIVADVSLKDADLVLGIDFLSARRLWLSYGSQQIFLTRRG
Ga0222729_101313913300022507SoilIGGEAMRNPEIIVAGLNLSDADLVLGIDIVRSWRIWLSYGAQKIFLLRRT
Ga0242656_101357013300022525SoilLNLSDADLVLGIDMVRSWRIWLSYGAQKIFLLRRT
Ga0242660_109240223300022531SoilADVSLKDADLVLGIDFLGSRRIWLSYGSQQIFLSRRT
Ga0242677_103466313300022713SoilDVSLRDAELFLGIDFLGSRRIWLSYGSQQIFLSRRT
Ga0242654_1020312613300022726SoilIRNPEIIVAGLNLSDADLVVGIDIVRSWRIWVSYGAQKIFLLRRT
Ga0207665_1038168443300025939Corn, Switchgrass And Miscanthus RhizosphereADVSLKDADLILGIDFLGSRRIWLSYGSQQIFLSRPT
Ga0209474_1026805813300026550SoilGEVVRNPALIVADVSLKDGDLVLGIDFIAARRIWLSYGSQQIFLSRRT
Ga0179587_1095480113300026557Vadose Zone SoilIIVADLNLSDADLVLGIDIVRPWRIWLSYGVQKIFLLRRT
Ga0209446_109572913300027698Bog Forest SoilVADVSLRDADLVLGIDFLGSRRIWLSYGSQQIFLSRRT
Ga0209073_1025337513300027765Agricultural SoilLRLSDADLVLGVDFLQSRRVWMSYGSQQIFLSRRN
Ga0209488_1003217713300027903Vadose Zone SoilPEIIVAGLNLSDADLVLGIDIVRSWRIWLSYGAQKIFLLRRT
Ga0209526_1044844813300028047Forest SoilADVKLSDADLVLGIDFLISRRIWLSYGSAQIFLSRRG
Ga0170819_1081526823300031469Forest SoilVADLRLSDADLVLGVDFLQSRRVWMSYGSQQIFLSRRI
Ga0318541_1066073013300031545SoilPDFIVADVKLSDADLVLGIDFLGSRRVWWSYGSQKIFLSRRN
Ga0318571_1026428913300031549SoilVMLSDADLVLGIDFLRPRRIWFSYGSQQIFIMRPT
Ga0318573_1001406113300031564SoilVTDVTLSDADLVLGIDFLRPRRIWFSYGSQQIFIMRRT
Ga0318542_1060387223300031668SoilVTDIRLNDADIVLGIDFLGSQRIWMSYGSQQIFLMRR
Ga0318500_1057572513300031724SoilNPEIIVTDVRLSDADLVLGIDFLRPRRIWFSYGSQQIFIMRGA
Ga0307468_10132682923300031740Hardwood Forest SoilGEAIHNSEIIVADLNLSDADLVLGIDILRSWRIWLSYGAQKVFLLRRN
Ga0306918_1019793123300031744SoilAETIRDPEIIVTDVTLNDADLVMGIDFLRPRRIWLSYGSQQIFIMHRA
Ga0318492_1011836113300031748SoilVRLSDADLVLGIDFLRARRIWFSYGSRQIFIMRRS
Ga0318535_1003677013300031764SoilIIRTPELIVTDIRLNDADIVLGIDFLRSQRMWMSYGSQQIFLMRR
Ga0318521_1035396213300031770SoilIVTDVRLSDADLVLGIDFLRPRRIWFSYGSQQIFIMRGA
Ga0318546_1047537633300031771SoilIMTDLRLSDADLVLGIDFLRARRIWFSYGSRQIFIMRRS
Ga0318543_1029788513300031777SoilIIVNDLRLSDADLVLGIDFLRARRIWFSYGSRQIFIMRRS
Ga0318529_1010102023300031792SoilTPELIVTNIRLNDADIVLGIDFLRSQRMWMSYGSQQIFLMRR
Ga0318503_1003303933300031794SoilPEIIVTDVRLSDADLVLGIDFLRPRRIWFSYGSQQIFIMRGA
Ga0318557_1011559513300031795SoilIVTDVRLSDADLVLGIDFLRPRRIWLSYGSQQIFIMRRV
Ga0318557_1035837533300031795SoilVTDVMLSDADLVLGIDFLRPRRIWFSYGSQQIFIMRGA
Ga0318576_1049173213300031796SoilVTDVRLSDADLVLGIDFLRARRIWFSYGSRQIFIMRRS
Ga0318523_1031422633300031798SoilVRLSDADLVLGIDFLRPRRIWFSYGSQQIFIMRRA
Ga0318568_1068547713300031819SoilVVRNPELIVADVSLKDADLILGIDFLSSRRLWLSYGAQQIFLSRRS
Ga0307478_1012442133300031823Hardwood Forest SoilNPDIIVTDVRLSDADLVLGIDFLRPRRIWLSYGSQQIFIMRRA
Ga0318564_1036134033300031831SoilTDVRLSDADLVLGIDFLRPRRVWLSYGSQQIFIMRRA
Ga0310917_1100529423300031833SoilTIRNPEIVVTDVRLSDADLVLGVDFLRSRRIWLSYGSQQIFIKH
Ga0318517_1015875613300031835SoilPELIVADVSLKDADLILGIDFLSSRRLWLSYGAQQIFLSRRS
Ga0318517_1051913013300031835SoilGTEVLRNPEIIVTDLRLSDADLVLGIDFLRARRIWFSYGSRQIFIMRRS
Ga0318527_1003649313300031859SoilRNPEIIVTDVRLSDADLVLGIDFLRPRRIWFSYGSQQIFIMRGA
Ga0318536_1044670433300031893SoilVTDVRLSDADLVLGIDFLRPRRIWFSYGSQQIFIMRRA
Ga0318551_1041516533300031896SoilPELIVADVSLKDADLVLGVDFLASRRIWLSYGSQQIFLSRRT
Ga0318520_1097039013300031897SoilIIVTDVRLSDADLVLGIDFLRPRRIWFSYGSQQIFIMRRA
Ga0306923_1033611333300031910SoilVTDVRLSDADLVLGIDFLRPRRIWFSYGSQQIFIMRGA
Ga0310912_1103182113300031941SoilPEIIVTDVRLSDADLVLGIDFLRARRIWFSYGSRQIFIMRRS
Ga0310916_1151811413300031942SoilIRNPEIVVTDVRLSDADLVLGVDFLRSRRIWLSYGSQQIFIKH
Ga0310913_1070115033300031945SoilADVKLSDADLVLGIDFLGSRRVWWSYGSQKIFLSRRN
Ga0310910_1063719413300031946SoilPEIIVTDVRLSDADLVLGIDFLRPRRIWFSYGSQQIFIMRRA
Ga0310909_1018951833300031947SoilIRNPEIIVTDVMLSDADLVLGIDFLRPRRIWFSYGSQQIFIMRPT
Ga0318531_1003960913300031981SoilVRLSDADLVLGIDFLRPRRIWFSYGSQQIFIMRGA
Ga0306922_1024204613300032001SoilRMEVGGEVVRNPELIVADVSLKDADLILGIDFLSSRRLWLSYGAQQIFLSRRS
Ga0306922_1058579513300032001SoilDVTLNDADLVIGIDFLRPRRIWLSYGSQQIFIMRRA
Ga0306922_1107442133300032001SoilNPEIVVTDVMLSDADLVLGIDFLKSRRLWLSYGSQQLFLSRRT
Ga0318507_1003650433300032025SoilIRNPEIIVTDVGLSDADLVLGIDFLRPRRIWFSYGSQQIFIMRGA
Ga0318507_1049330723300032025SoilIVTDLRLSDADLVLGIDFLRARRIWFSYGSRQIFIMRRS
Ga0310911_1030164313300032035SoilVGTEVLRNPEIIVTDVRLSDADLVLGIDFLRARRIWFSYGSRQVFIMRRA
Ga0310911_1032671733300032035SoilTETIRNPEIIVTDVRLSDADLVLGIDFLRPRRIWLSYGSQQIFIMRRV
Ga0318532_1020542733300032051SoilIRDPEIIVTDVTLNDADLVMGIDFLRPRRIWLSYGSQQIFIMHRA
Ga0318513_1012566123300032065SoilPELIVTNIRLNDADIVLGIDFLRSQRMWMSYGSQQIFLMRR
Ga0318513_1058309923300032065SoilTDVRLSDADLVLGIDFLRPRRIWFSYGSQQIFIMRGA
Ga0318540_1030960333300032094SoilGAETIRDPEIIVTDVTLNDADLVMGIDFLRPRRIWLSYGSQQIFIMHRA
Ga0306920_10012867913300032261SoilFIVADVKLSDADLVLGIDFLGSRRVWWSYGSQKIFLSRRS
Ga0306920_10122240813300032261SoilIRNPEIIVTDVRLSDADLVLGIDFLRPRRIWFSYGSQQIFIMRGA
Ga0348332_1179877333300032515Plant LitterVRLSDADLVLGIDFLRPRRIWLSYGSQQIFIMHRA
Ga0335069_1191456723300032893SoilEVGSVTVRDPEVVVADIQLRDADIVLGADFLSARRIWLSYASFQIFLSER


 ⦗Top⦘


© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.