NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome Family F082967

Metagenome Family F082967

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F082967
Family Type Metagenome
Number of Sequences 113
Average Sequence Length 38 residues
Representative Sequence GQKIRVLVDRIDPVEKKIQFAVLEEEPVRARGKRKKM
Number of Associated Samples 100
Number of Associated Scaffolds 113

Quality Assessment
Transcriptomic Evidence No
Most common taxonomic group Bacteria
% of genes with valid RBS motifs 0.00 %
% of genes near scaffold ends (potentially truncated) 96.46 %
% of genes from short scaffolds (< 2000 bps) 85.84 %
Associated GOLD sequencing projects 94
AlphaFold2 3D model prediction Yes
3D model pTM-score0.23

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Bacteria (83.186 % of family members)
NCBI Taxonomy ID 2
Taxonomy All Organisms → cellular organisms → Bacteria

Most Common Ecosystem
GOLD Ecosystem Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil
(14.159 % of family members)
Environment Ontology (ENVO) Unclassified
(21.239 % of family members)
Earth Microbiome Project Ontology (EMPO) Free-living → Non-saline → Soil (non-saline)
(50.442 % of family members)


 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      

 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Globular Signal Peptide: No Secondary Structure distribution: α-helix: 0.00%    β-sheet: 23.08%    Coil/Unstructured: 76.92%
Feature Viewer
Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer
Per-residue confidence (pLDDT):
  0-50   51-70   71-90   91-100  		pTM-score: 0.23
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.

 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 113 Family Scaffolds
PF02880PGM_PMM_III 15.93
PF01979Amidohydro_1 5.31
PF12900Pyridox_ox_2 4.42
PF00408PGM_PMM_IV 3.54
PF03551PadR 2.65
PF02457DAC 2.65
PF13602ADH_zinc_N_2 1.77
PF01266DAO 1.77
PF01663Phosphodiest 1.77
PF02894GFO_IDH_MocA_C 1.77
PF00072Response_reg 0.88
PF00496SBP_bac_5 0.88
PF13432TPR_16 0.88
PF07949YbbR 0.88
PF11645PDDEXK_5 0.88
PF01641SelR 0.88
PF02492cobW 0.88
PF06071YchF-GTPase_C 0.88
PF07992Pyr_redox_2 0.88
PF00535Glycos_transf_2 0.88
PF03544TonB_C 0.88
PF15780ASH 0.88
PF04191PEMT 0.88
PF08388GIIM 0.88
PF01883FeS_assembly_P 0.88
PF04978DUF664 0.88
PF01381HTH_3 0.88
PF00990GGDEF 0.88
PF14534DUF4440 0.88
PF08206OB_RNB 0.88
PF14329DUF4386 0.88
PF00069Pkinase 0.88
PF13669Glyoxalase_4 0.88
PF01797Y1_Tnp 0.88
PF12867DinB_2 0.88
PF13924Lipocalin_5 0.88

Neighboring Clusters of Orthologous Genes (COGs)

COG IDNameFunctional Category % Frequency in 113 Family Scaffolds
COG0033Phosphoglucomutase/phosphomannomutaseCarbohydrate transport and metabolism [G] 19.47
COG1109PhosphomannomutaseCarbohydrate transport and metabolism [G] 19.47
COG0515Serine/threonine protein kinaseSignal transduction mechanisms [T] 3.54
COG1695DNA-binding transcriptional regulator, PadR familyTranscription [K] 2.65
COG1733DNA-binding transcriptional regulator, HxlR familyTranscription [K] 2.65
COG1846DNA-binding transcriptional regulator, MarR familyTranscription [K] 2.65
COG0673Predicted dehydrogenaseGeneral function prediction only [R] 1.77
COG0012Ribosome-binding ATPase YchF, GTP1/OBG familyTranslation, ribosomal structure and biogenesis [J] 0.88
COG0229Peptide methionine sulfoxide reductase MsrBPosttranslational modification, protein turnover, chaperones [O] 0.88
COG0557Exoribonuclease RTranscription [K] 0.88
COG0810Periplasmic protein TonB, links inner and outer membranesCell wall/membrane/envelope biogenesis [M] 0.88
COG1158Transcription termination factor RhoTranscription [K] 0.88
COG1278Cold shock protein, CspA familyTranscription [K] 0.88
COG1943REP element-mobilizing transposase RayTMobilome: prophages, transposons [X] 0.88
COG4776Exoribonuclease IITranscription [K] 0.88
COG4856Cyclic di-AMP synthase regulator CdaR, YbbR domainSignal transduction mechanisms [T] 0.88

 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms83.19 %
UnclassifiedrootN/A16.81 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
3300001131|JGI12631J13338_1024900All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium626Open in IMG/M
3300002245|JGIcombinedJ26739_100043729All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis4044Open in IMG/M
3300002245|JGIcombinedJ26739_100147136All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter2226Open in IMG/M
3300004092|Ga0062389_100983523All Organisms → cellular organisms → Bacteria1028Open in IMG/M
3300005434|Ga0070709_10395634All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter1030Open in IMG/M
3300005534|Ga0070735_10333439All Organisms → cellular organisms → Bacteria912Open in IMG/M
3300005537|Ga0070730_10031758All Organisms → cellular organisms → Bacteria → Acidobacteria3979Open in IMG/M
3300005541|Ga0070733_10006183All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae7832Open in IMG/M
3300005541|Ga0070733_10123509All Organisms → cellular organisms → Bacteria1666Open in IMG/M
3300005577|Ga0068857_100825998All Organisms → cellular organisms → Bacteria886Open in IMG/M
3300006032|Ga0066696_10348591All Organisms → cellular organisms → Bacteria → Acidobacteria965Open in IMG/M
3300006034|Ga0066656_11093333All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium512Open in IMG/M
3300006046|Ga0066652_100571733All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Magnetococcales → unclassified Magnetococcales → Magnetococcales bacterium1062Open in IMG/M
3300006162|Ga0075030_100513047All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae953Open in IMG/M
3300006176|Ga0070765_101127136All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae741Open in IMG/M
3300006755|Ga0079222_11210409Not Available677Open in IMG/M
3300006806|Ga0079220_10053701All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter kueseliae1913Open in IMG/M
3300006893|Ga0073928_10936516All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium592Open in IMG/M
3300009029|Ga0066793_10416657All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter kueseliae771Open in IMG/M
3300009090|Ga0099827_11814877Not Available531Open in IMG/M
3300009522|Ga0116218_1136302All Organisms → cellular organisms → Bacteria1116Open in IMG/M
3300009524|Ga0116225_1015807All Organisms → cellular organisms → Bacteria3971Open in IMG/M
3300009623|Ga0116133_1117981All Organisms → cellular organisms → Bacteria682Open in IMG/M
3300009637|Ga0116118_1030737All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → unclassified Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter sp. SbA71972Open in IMG/M
3300009672|Ga0116215_1002730All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae10673Open in IMG/M
3300009698|Ga0116216_10845310All Organisms → cellular organisms → Bacteria548Open in IMG/M
3300009700|Ga0116217_10946097All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium528Open in IMG/M
3300010048|Ga0126373_10094144All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae2758Open in IMG/M
3300010048|Ga0126373_11801628Not Available676Open in IMG/M
3300010339|Ga0074046_10856952All Organisms → cellular organisms → Bacteria530Open in IMG/M
3300010360|Ga0126372_10426687All Organisms → cellular organisms → Bacteria1220Open in IMG/M
3300010362|Ga0126377_11471711All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium754Open in IMG/M
3300010375|Ga0105239_11657275All Organisms → cellular organisms → Bacteria740Open in IMG/M
3300010379|Ga0136449_103045496All Organisms → cellular organisms → Bacteria653Open in IMG/M
3300011271|Ga0137393_10356860Not Available1249Open in IMG/M
3300012004|Ga0120134_1075353All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Magnetococcales → unclassified Magnetococcales → Magnetococcales bacterium611Open in IMG/M
3300012349|Ga0137387_10460208All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis923Open in IMG/M
3300012350|Ga0137372_10867787Not Available643Open in IMG/M
3300012917|Ga0137395_10871340All Organisms → cellular organisms → Bacteria652Open in IMG/M
3300012951|Ga0164300_10513461All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium688Open in IMG/M
3300012986|Ga0164304_10135233All Organisms → cellular organisms → Bacteria1530Open in IMG/M
3300013307|Ga0157372_12390842All Organisms → cellular organisms → Bacteria607Open in IMG/M
3300014164|Ga0181532_10152619All Organisms → cellular organisms → Bacteria1388Open in IMG/M
3300014165|Ga0181523_10063591Not Available2260Open in IMG/M
3300014168|Ga0181534_10853355All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis542Open in IMG/M
3300014169|Ga0181531_10289112All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1002Open in IMG/M
3300014169|Ga0181531_10302702All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium978Open in IMG/M
3300014497|Ga0182008_10017330All Organisms → cellular organisms → Bacteria3738Open in IMG/M
3300014657|Ga0181522_10449478All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium774Open in IMG/M
3300016319|Ga0182033_11905765Not Available540Open in IMG/M
3300016422|Ga0182039_11276256Not Available665Open in IMG/M
3300017924|Ga0187820_1301510All Organisms → cellular organisms → Bacteria527Open in IMG/M
3300017943|Ga0187819_10778581Not Available538Open in IMG/M
3300017946|Ga0187879_10156001All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1290Open in IMG/M
3300017998|Ga0187870_1165067Not Available800Open in IMG/M
3300018006|Ga0187804_10107334All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae1151Open in IMG/M
3300018007|Ga0187805_10450641All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium600Open in IMG/M
3300018009|Ga0187884_10234895All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium749Open in IMG/M
3300018035|Ga0187875_10181939All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1166Open in IMG/M
3300018035|Ga0187875_10393704All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis741Open in IMG/M
3300018040|Ga0187862_10757995All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium564Open in IMG/M
3300018086|Ga0187769_10567745Not Available857Open in IMG/M
3300018468|Ga0066662_10487667All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1118Open in IMG/M
3300019882|Ga0193713_1146425All Organisms → cellular organisms → Bacteria636Open in IMG/M
3300020004|Ga0193755_1158437Not Available681Open in IMG/M
3300020583|Ga0210401_11442252All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium546Open in IMG/M
3300021170|Ga0210400_11206198All Organisms → cellular organisms → Bacteria → Acidobacteria609Open in IMG/M
3300021170|Ga0210400_11227006All Organisms → cellular organisms → Bacteria → Acidobacteria603Open in IMG/M
3300021180|Ga0210396_10803309All Organisms → cellular organisms → Bacteria807Open in IMG/M
3300021420|Ga0210394_10076293All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis2899Open in IMG/M
3300021420|Ga0210394_10320714All Organisms → cellular organisms → Bacteria1360Open in IMG/M
3300021420|Ga0210394_11326496All Organisms → cellular organisms → Bacteria614Open in IMG/M
3300021475|Ga0210392_10724899All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis741Open in IMG/M
3300021479|Ga0210410_10076373All Organisms → cellular organisms → Bacteria2939Open in IMG/M
3300021479|Ga0210410_10495703All Organisms → cellular organisms → Bacteria1091Open in IMG/M
3300021559|Ga0210409_11149593All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium651Open in IMG/M
3300025944|Ga0207661_10735779All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium908Open in IMG/M
3300026542|Ga0209805_1178569All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium943Open in IMG/M
3300026552|Ga0209577_10067025All Organisms → cellular organisms → Bacteria → Acidobacteria2981Open in IMG/M
3300027502|Ga0209622_1035889All Organisms → cellular organisms → Bacteria890Open in IMG/M
3300027591|Ga0209733_1174506All Organisms → cellular organisms → Bacteria512Open in IMG/M
3300027604|Ga0208324_1115199All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis745Open in IMG/M
3300027662|Ga0208565_1237721All Organisms → cellular organisms → Bacteria510Open in IMG/M
3300027854|Ga0209517_10106781All Organisms → cellular organisms → Bacteria1872Open in IMG/M
3300027862|Ga0209701_10141511All Organisms → cellular organisms → Bacteria1475Open in IMG/M
3300027867|Ga0209167_10659732All Organisms → cellular organisms → Bacteria572Open in IMG/M
3300027894|Ga0209068_10403080All Organisms → cellular organisms → Bacteria → Acidobacteria780Open in IMG/M
3300027986|Ga0209168_10445470Not Available628Open in IMG/M
3300028759|Ga0302224_10130000All Organisms → cellular organisms → Bacteria980Open in IMG/M
3300030707|Ga0310038_10160597All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis1107Open in IMG/M
3300031573|Ga0310915_11285723Not Available504Open in IMG/M
3300031708|Ga0310686_109306053All Organisms → cellular organisms → Bacteria859Open in IMG/M
3300031715|Ga0307476_10816513All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis689Open in IMG/M
3300031715|Ga0307476_11223199All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium549Open in IMG/M
3300031833|Ga0310917_10645057All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium718Open in IMG/M
3300031893|Ga0318536_10416819All Organisms → cellular organisms → Bacteria → Acidobacteria678Open in IMG/M
3300031942|Ga0310916_10334563All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae1285Open in IMG/M
3300031996|Ga0308176_10480023All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1258Open in IMG/M
3300031996|Ga0308176_12972277All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium502Open in IMG/M
3300032035|Ga0310911_10116629All Organisms → cellular organisms → Bacteria → Acidobacteria1479Open in IMG/M
3300032074|Ga0308173_10531445All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1057Open in IMG/M
3300032160|Ga0311301_12219118All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis629Open in IMG/M
3300032828|Ga0335080_12142332All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium538Open in IMG/M
3300032892|Ga0335081_10449562All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1639Open in IMG/M
3300032893|Ga0335069_10186259All Organisms → cellular organisms → Bacteria → Acidobacteria2541Open in IMG/M
3300032955|Ga0335076_10218368All Organisms → cellular organisms → Bacteria1806Open in IMG/M
3300033004|Ga0335084_10252381All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae1827Open in IMG/M
3300033004|Ga0335084_10576078Not Available1153Open in IMG/M
3300033004|Ga0335084_10579011Not Available1150Open in IMG/M
3300033158|Ga0335077_10460159All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1353Open in IMG/M


 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil14.16%
Peatlands SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil9.73%
SoilEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Soil7.08%
Vadose Zone SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil6.19%
PeatlandEnvironmental → Aquatic → Freshwater → Wetlands → Bog → Peatland5.31%
BogEnvironmental → Aquatic → Freshwater → Wetlands → Bog → Bog5.31%
Surface SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil5.31%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil4.42%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Soil4.42%
Forest SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil4.42%
Freshwater SedimentEnvironmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment3.54%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil3.54%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural → Soil2.65%
PeatlandEnvironmental → Aquatic → Freshwater → Wetlands → Unclassified → Peatland1.77%
WatershedsEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds1.77%
Agricultural SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil1.77%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil1.77%
Hardwood Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil1.77%
Bog Forest SoilEnvironmental → Aquatic → Freshwater → Wetlands → Bog → Bog Forest Soil0.89%
Iron-Sulfur Acid SpringEnvironmental → Aquatic → Thermal Springs → Hot (42-90C) → Acidic → Iron-Sulfur Acid Spring0.89%
PermafrostEnvironmental → Terrestrial → Soil → Unclassified → Permafrost → Permafrost0.89%
Grasslands SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil0.89%
Tropical PeatlandEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland0.89%
Bog Forest SoilEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Bog Forest Soil0.89%
Prmafrost SoilEnvironmental → Terrestrial → Soil → Wetlands → Permafrost → Prmafrost Soil0.89%
SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Soil0.89%
Corn, Switchgrass And Miscanthus RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere0.89%
Corn RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere0.89%
PalsaEnvironmental → Terrestrial → Peat → Unclassified → Unclassified → Palsa0.89%
Corn RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere0.89%
Populus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere0.89%
Corn RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere0.89%
Corn RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere0.89%
RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere0.89%
Arabidopsis RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Arabidopsis Rhizosphere0.89%

Visualization
Powered by ApexCharts



Associated Samples

Taxon OIDSample NameHabitat TypeIMG/M Link
3300001131Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_Ref_O1EnvironmentalOpen in IMG/M
3300002245Jack Pine, Ontario site 1_JW_OM2H0_M3 (Jack Pine, Ontario combined, ASSEMBLY_DATE=20131027)EnvironmentalOpen in IMG/M
3300004092Coassembly of ECP03_0M1, ECP03_OM2, ECP03_OM3, ECP04_OM1, ECP04_OM2, ECP04_OM3, ECP14_OM1, ECP14_OM2, ECP14_OM3EnvironmentalOpen in IMG/M
3300005434Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaGEnvironmentalOpen in IMG/M
3300005534Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen07_05102014_R1EnvironmentalOpen in IMG/M
3300005537Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen01_05102014_R1EnvironmentalOpen in IMG/M
3300005541Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen05_05102014_R1EnvironmentalOpen in IMG/M
3300005577Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2Host-AssociatedOpen in IMG/M
3300006032Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_145EnvironmentalOpen in IMG/M
3300006034Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_105EnvironmentalOpen in IMG/M
3300006046Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_101EnvironmentalOpen in IMG/M
3300006162Freshwater sediment microbial communities from Pennsylvania, USA - Little Laurel Run_MetaG_LLR_2012EnvironmentalOpen in IMG/M
3300006176Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 5EnvironmentalOpen in IMG/M
3300006755Agricultural soil microbial communities from Georgia to study Nitrogen management - GA PlitterEnvironmentalOpen in IMG/M
3300006806Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS100EnvironmentalOpen in IMG/M
3300006893Iron sulfur acid spring bacterial and archeal communities from Banff, Canada, to study Microbial Dark Matter (Phase II) - Paint Pots PPA 5.5 metaGEnvironmentalOpen in IMG/M
3300006903Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD5Host-AssociatedOpen in IMG/M
3300009029Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Permafrost soil replicate 1 DNA2013-189EnvironmentalOpen in IMG/M
3300009090Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con1.8 metaGEnvironmentalOpen in IMG/M
3300009522Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_5_LS metaGEnvironmentalOpen in IMG/M
3300009524Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_c_BC metaGEnvironmentalOpen in IMG/M
3300009623Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_19_10EnvironmentalOpen in IMG/M
3300009637Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_11_40EnvironmentalOpen in IMG/M
3300009672Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_2_FS metaGEnvironmentalOpen in IMG/M
3300009698Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_3_AS metaGEnvironmentalOpen in IMG/M
3300009700Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_4_PS metaGEnvironmentalOpen in IMG/M
3300010048Tropical forest soil microbial communities from Panama - MetaG Plot_11EnvironmentalOpen in IMG/M
3300010339Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - Bog Forest MetaG ECP23OM3EnvironmentalOpen in IMG/M
3300010360Tropical forest soil microbial communities from Panama - MetaG Plot_6EnvironmentalOpen in IMG/M
3300010362Tropical forest soil microbial communities from Panama - MetaG Plot_22EnvironmentalOpen in IMG/M
3300010375Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaGHost-AssociatedOpen in IMG/M
3300010379Sb_50d combined assemblyEnvironmentalOpen in IMG/M
3300011271Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h3.4B metaGEnvironmentalOpen in IMG/M
3300012004Permafrost microbial communities from Nunavut, Canada - A30_5cm_6MEnvironmentalOpen in IMG/M
3300012211Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_40_16 metaGEnvironmentalOpen in IMG/M
3300012349Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Sage2_R_115_16 metaGEnvironmentalOpen in IMG/M
3300012350Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_60_16 metaGEnvironmentalOpen in IMG/M
3300012917Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czobulk2.16 metaGEnvironmentalOpen in IMG/M
3300012951Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_226_MGEnvironmentalOpen in IMG/M
3300012986Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_217_MGEnvironmentalOpen in IMG/M
3300013307Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaGHost-AssociatedOpen in IMG/M
3300014164Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin11_30_metaGEnvironmentalOpen in IMG/M
3300014165Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin05_30_metaGEnvironmentalOpen in IMG/M
3300014168Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin17_10_metaGEnvironmentalOpen in IMG/M
3300014169Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin11_10_metaGEnvironmentalOpen in IMG/M
3300014497Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaGHost-AssociatedOpen in IMG/M
3300014657Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin05_10_metaGEnvironmentalOpen in IMG/M
3300015372Soil combined assemblyHost-AssociatedOpen in IMG/M
3300016319Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.00HEnvironmentalOpen in IMG/M
3300016422Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.111EnvironmentalOpen in IMG/M
3300017924Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_5EnvironmentalOpen in IMG/M
3300017943Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_4EnvironmentalOpen in IMG/M
3300017946Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_19_10EnvironmentalOpen in IMG/M
3300017998Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_13_150EnvironmentalOpen in IMG/M
3300018006Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - Control_4EnvironmentalOpen in IMG/M
3300018007Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - Control_5EnvironmentalOpen in IMG/M
3300018009Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_20_40EnvironmentalOpen in IMG/M
3300018035Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_17_10EnvironmentalOpen in IMG/M
3300018040Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_10_150EnvironmentalOpen in IMG/M
3300018086Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP02_10_MGEnvironmentalOpen in IMG/M
3300018468Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_111EnvironmentalOpen in IMG/M
3300019882Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? H3a2EnvironmentalOpen in IMG/M
3300020004Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? H1a2EnvironmentalOpen in IMG/M
3300020583Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-32-MEnvironmentalOpen in IMG/M
3300021170Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-26-MEnvironmentalOpen in IMG/M
3300021180Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-17-OEnvironmentalOpen in IMG/M
3300021420Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-12-MEnvironmentalOpen in IMG/M
3300021475Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-30-OEnvironmentalOpen in IMG/M
3300021479Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-4-MEnvironmentalOpen in IMG/M
3300021559Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-17-MEnvironmentalOpen in IMG/M
3300025944Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes)EnvironmentalOpen in IMG/M
3300026542Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_148 (SPAdes)EnvironmentalOpen in IMG/M
3300026552Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_109 (SPAdes)EnvironmentalOpen in IMG/M
3300027502Forest soil microbial communities from Davy Crockett National Forest, Groveton, Texas, USA - Texas A ecozone_OM3H0_M2 (SPAdes)EnvironmentalOpen in IMG/M
3300027591Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM2_M1 (SPAdes)EnvironmentalOpen in IMG/M
3300027604Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_5_LS metaG (SPAdes)EnvironmentalOpen in IMG/M
3300027662Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_2_FS metaG (SPAdes)EnvironmentalOpen in IMG/M
3300027854Peat soil microbial communities from Weissenstadt, Germany - SII-2010 (SPAdes)EnvironmentalOpen in IMG/M
3300027862Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H3.8 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300027867Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen05_05102014_R1 (SPAdes)EnvironmentalOpen in IMG/M
3300027894Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Cold Stream Run_MetaG_CSR_2012 (SPAdes)EnvironmentalOpen in IMG/M
3300027986Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen07_05102014_R1 (SPAdes)EnvironmentalOpen in IMG/M
3300028759Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Palsa_E3_1EnvironmentalOpen in IMG/M
3300030707Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_4_PS metaG (v2)EnvironmentalOpen in IMG/M
3300031573Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.AN111EnvironmentalOpen in IMG/M
3300031708FICUS49499 Metagenome Czech Republic combined assemblyEnvironmentalOpen in IMG/M
3300031715Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM2C_05EnvironmentalOpen in IMG/M
3300031833Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.LF178EnvironmentalOpen in IMG/M
3300031893Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.117b4f28EnvironmentalOpen in IMG/M
3300031942Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.LF176EnvironmentalOpen in IMG/M
3300031996Soil microbial communities from UC Gill Tract Community Farm, Albany, California, United States - DLSLS.C.R2EnvironmentalOpen in IMG/M
3300032035Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.HF170EnvironmentalOpen in IMG/M
3300032074Soil microbial communities from UC Gill Tract Community Farm, Albany, California, United States - DLSLS.P.R1EnvironmentalOpen in IMG/M
3300032160Sb_50d combined assembly (MetaSPAdes)EnvironmentalOpen in IMG/M
3300032828Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.4EnvironmentalOpen in IMG/M
3300032892Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.5EnvironmentalOpen in IMG/M
3300032893Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_1.1EnvironmentalOpen in IMG/M
3300032955Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_2.5EnvironmentalOpen in IMG/M
3300033004Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.4EnvironmentalOpen in IMG/M
3300033158Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.1EnvironmentalOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap


 ⦗Top⦘

Family Sequences

Protein ID Sample Taxon ID Habitat Sequence
JGI12631J13338_102490013300001131Forest SoilRIRVLVDRIDPVEKKIQFGILEEKPPLKRKRKKG*
JGIcombinedJ26739_10004372913300002245Forest SoilGQRIRVLVDRIDPVEKKIQFAVFEEAPPRVTGKRRKRK*
JGIcombinedJ26739_10014713613300002245Forest SoilYHLGQKIRVLVDRIDPVEKKIQFAVLEEAPGRTAGKKRKR*
Ga0062389_10098352333300004092Bog Forest SoilKIYSLGDRVRVLVDRIDPVEKKIQFALLEEEKRPKPWGKSRRKGS*
Ga0070709_1039563413300005434Corn, Switchgrass And Miscanthus RhizosphereRKIYGLGQKIRVLVDRIDPMEKKIQFAILQEKPVPKRKKRQG*
Ga0070735_1033343913300005534Surface SoilRIGDRLRVIVDRIDPVEKKINFAVMEEARPKREKRRKKK*
Ga0070730_1003175813300005537Surface SoilIFRIGDRLKVLVDRIDPVEKKINFAVFEEAPPRREGKHRKRK*
Ga0070733_1000618363300005541Surface SoilLGQRVRVLVDRIDPVEKKIQFALLEEEKPQAPKRKKKR*
Ga0070733_1012350933300005541Surface SoilGGRVRVLVDRIDPVEKKIQFAVFEEKPVPKRKNR*
Ga0068857_10082599823300005577Corn RhizosphereYRIGDRLRVLVDRIDPVEKKINFAVLEEEPKPRRGKRRKK*
Ga0066696_1034859113300006032SoilGQRVRVLVDRIDPVEKKIQFALIEERPPRGVKARHKSK*
Ga0066656_1109333313300006034SoilLGQRIRVLVDRIDPVEKKIQFAIVEEQDQHAAKRKRR*
Ga0066652_10057173313300006046SoilRLGQKVRVIVDRIDPVEKKIQFALLEEVKPRAAKRKRR*
Ga0075030_10051304713300006162WatershedsYHLGQKIRVLVDRIDPVEKKIQFAVFEEQPVRAAGKRRKRK*
Ga0070765_10112713613300006176SoilGDRVRVLVDRIDPVEKKIQFALIEEERVRVKRKR*
Ga0079222_1121040913300006755Agricultural SoilVIVDRIDPVEKKINFAIVEEEPKRRDKKRKKSSK*
Ga0079220_1005370113300006806Agricultural SoilKTYRLGQKVHVLVDRIDPVEKKIQFALLEEKPARGTHGRRKRH*
Ga0073928_1093651623300006893Iron-Sulfur Acid SpringHVLVDRIDPVEKKIQFALLEEEEAPPNLRARSRKKR*
Ga0075426_1002153773300006903Populus RhizosphereQVRVLVDRIDPVQKKIQFALLQERPARGQRKQKKH*
Ga0066793_1041665713300009029Prmafrost SoilNRVRVLVDRIDPVEKKIQFAVFEEEAQRPTPRRRK*
Ga0099827_1181487723300009090Vadose Zone SoilRLGQKVRVIVDRIDPVEKKIQFAFLEEVKPPRVKRKKRK*
Ga0116218_113630223300009522Peatlands SoilGQKIRVLVDRIDPVEKKIQFAVLEEEPVRAKGKRKKRK*
Ga0116225_101580733300009524Peatlands SoilLGQKIRVLVDRIDPVEKKIQFAVFEEAPAPLRHKASGKCKR*
Ga0116133_111798123300009623PeatlandGQKIRVLVDRIDPVEKKIQFAVLEEEPVRARGKRKKM*
Ga0116118_103073713300009637PeatlandRLRVLVDRIDPVEKKIQFAVLEEQPKPSAKSRRK*
Ga0116215_100273013300009672Peatlands SoilRLGQRIRVLVDRIDPVEKKIQFAVWEEEPVRTTGRRKRR*
Ga0116216_1084531013300009698Peatlands SoilLGQKIRVLVDRIDPVEKKIQFAVFEEAPARPAKRSKRKA*
Ga0116217_1094609733300009700Peatlands SoilLGDRVRVLVDRIDPVEKKIQFAMIEEQPKPSGKSRRK*
Ga0126373_1009414413300010048Tropical Forest SoilIYHMGDRMKVIVDRIDPVEKKINFAVLEEETAKPAKRRKRK*
Ga0126373_1180162813300010048Tropical Forest SoilRLRVIVDRIDPVEKKINFAVMEEERPKPLKKRKRR*
Ga0074046_1085695223300010339Bog Forest SoilQKIRVLVDRIDPVEKKLQFAVLEEEPVRSVGKRRKRK*
Ga0126372_1042668713300010360Tropical Forest SoilLKVIVDRIDPVEKKINFAVLDKEHAKPAKRRKRR*
Ga0126377_1147171113300010362Tropical Forest SoilRRTYRLGQRIRVIVDRIDPVEKKIQFAVLEEKPKTKGRKKSGLRI*
Ga0105239_1165727513300010375Corn RhizosphereLGQRIRVLVDRIDPVEKKIQFAVLEEKPAPKRKKR*
Ga0136449_10304549623300010379Peatlands SoilHLGQKIRVLVDRIDPVEKKIQFAVLEEEKRRSEGKRKKRK*
Ga0137393_1035686013300011271Vadose Zone SoilRVRVLVDRIDPVEKKIQFAVVDEQPKPSGKSRRK*
Ga0120134_107535313300012004PermafrostMGQKLRVLVDRIDPVEKKIQFALLEEEKPRVTKRKRK*
Ga0137377_1070997323300012211Vadose Zone SoilQKIRVLVDRIDPVEKKIQFVLLEERPQKGPKKPRRN*
Ga0137387_1046020813300012349Vadose Zone SoilLGQKIRVLVDRIDPVEKKIQFAVFEEEPVRTKAKRKKH*
Ga0137372_1086778713300012350Vadose Zone SoilIGQQLKVIVDRIDPVEKEINFAVVEEERPKPAKRRKKR*
Ga0137395_1087134033300012917Vadose Zone SoilSRKTCRLGRKVRVLVDRVDPVEKKIQFALLEEIKPRQPNRKRRGLV*
Ga0164300_1051346113300012951SoilSRRTFRLGQRIRVIVDRIDPVEKKIQFALLEEAKPRSAKRKRR*
Ga0164304_1013523343300012986SoilYSLGQRIRVLVDRIDPVEKKIQFALLEEKPAPKRKNR*
Ga0157372_1239084213300013307Corn RhizosphereTYRIGDRLRVLVDRIDPVEKKINFAVLDEEPKPRPRKRRKK*
Ga0181532_1015261913300014164BogRIRVLVDRIDPVEKKIQFAVIEEQPQRSRSQRRR*
Ga0181523_1006359143300014165BogYGLGNRVRVLVDRIDPVEKKIQFAILEEQPKPSAKSRRK*
Ga0181534_1085335513300014168BogSLGQKIRVLVDRIDPVEKKIQFAVLEEEPVRARGKRKKM*
Ga0181531_1028911233300014169BogRSRIRVLVDRIDPVEKKIQFAILEEKPLPKRKRKKS*
Ga0181531_1030270213300014169BogGQTIRVLVDRIDPVEKKIQFAILEETPLPKRRRKKS*
Ga0182008_1001733073300014497RhizosphereFRLGDKVRVLVDRIDPVEKKIQFALLQDRPRQKSRGRRS*
Ga0181522_1044947813300014657BogRIRVLVDRIDPVEKKIQFAVFEEEPKPLGKRRRK*
Ga0132256_10183599623300015372Arabidopsis RhizosphereGQRTRKTYRLGQRLRVIVDRIDPVEKKIQFAVLEEKPKARSGRKKIRL*
Ga0182033_1190576513300016319SoilGQRTGKTYGLGQKIRVLVDRIDPVEKKIQFAMFEQPKSRKKRS
Ga0182039_1127625613300016422SoilTRKIYHIGDRVKVIVDRIDPVEKKINFAVLDDEPAKPAKRRKRK
Ga0187820_130151013300017924Freshwater SedimentYRLGQKIRVLVDRIDPVEKKIQFAVFEEQPVPATGKRRRRK
Ga0187819_1077858113300017943Freshwater SedimentGDRIRVLVDRIDPVEKKIQFAVIEEKTQKLTSHRRK
Ga0187879_1015600113300017946PeatlandYSLGQRIRVLVDRIDPVEKKIQFAILEEKAPLKRKRKKG
Ga0187870_116506713300017998PeatlandYSLGNRVRVLVDRIDPVEKKIQFAVLEEQPKPSAKSRRK
Ga0187804_1010733413300018006Freshwater SedimentRSRKIYRIGDRLGVILDRIDPVEKKINFAVFEEAPPRQARRRKRK
Ga0187805_1045064113300018007Freshwater SedimentIRVLVDRIDPVEKKIQFAILADKEKPLPKRKRKKS
Ga0187884_1023489523300018009PeatlandGQRIRVLVDRIDPVEKKIQFAVLEERPVPKRKRKK
Ga0187875_1018193933300018035PeatlandLGQRIRVLVDRIDPVEKKIQFAILEEKALPKRKRKKS
Ga0187875_1039370413300018035PeatlandQKIRVLVDRIDPVEKKIQFAVLEEEPVRARGKRKKM
Ga0187862_1075799523300018040PeatlandKTYGLGQKIRVILDRIDPVEKKIQFAVLEEKLLPKRKRKKR
Ga0187769_1056774513300018086Tropical PeatlandDRVRVLVDRIDPVEKKIQFAVLEEQPRRSGKDRVK
Ga0066662_1048766723300018468Grasslands SoilGDRLRVLVDRIDPVEKKINFAVLEEEPKPRRGKRRKK
Ga0193713_114642523300019882SoilRVQVIVDRIDPVEKKIQFALWEEPPVRSNKRSKRR
Ga0193755_115843713300020004SoilKVRVIVDRIDPVEKKIQFALLEEEPQRGRKRAGRK
Ga0210401_1144225213300020583SoilSRKTYSLGQRIRVLVDRIDSVEKKIQFALFVEQPAPKRKRSRK
Ga0210400_1120619813300021170SoilLGQKVRVIVDRIDPVEKKIQFALLEERPPRRPKVRHKGK
Ga0210400_1122700613300021170SoilRKTYHLGQKIRVLVDRIDPVEKKIQFAVFEKEPVRAEGKKRKRK
Ga0210396_1080330913300021180SoilIRVLVDRIDPVEKKIQFAVVEEEPVRAGGKRKKRK
Ga0210394_1007629313300021420SoilIRVLVDRIDPVEKKIQFAVLAEESVRTLGRRRKRSRER
Ga0210394_1032071413300021420SoilRMGQRIRVLVDRIDPVEKKIQFAVFEEKPQRSPKRKRK
Ga0210394_1132649613300021420SoilKIRVLVDRIDPVEKKIQFAVLEEAPVRTAGKKRKR
Ga0210392_1072489913300021475SoilKIRVLVDRIDPVEKKIQFAVLEEEPVRAKGKERKRKKR
Ga0210410_1007637313300021479SoilSMGQRVRVLVDRIDPVEKKIQFAVLEEKPVPKRKKR
Ga0210410_1049570323300021479SoilVLVDRIDPVEKKIQFAVLEEEPVRAKGKERKRKKR
Ga0210409_1114959313300021559SoilYSLGQRVRVLVDRIDPVEKKIQFALFEEKPALKRKNR
Ga0207661_1073577933300025944Corn RhizosphereDRLRVLVDRIDPVEKKINFAVLEEEPKPRRGKRRKK
Ga0209805_117856933300026542SoilGQRIRVLVDRIDPVEKKIQFAIVEEQKRQTAKRKRR
Ga0209577_1006702543300026552SoilYRIGQTIRVLVDRIDPVERKINFAVIEEEPPHRKSRRKRR
Ga0209622_103588923300027502Forest SoilLVDRIDPVEKKIQFAVFEEEPVRAKGKRRKRAAEH
Ga0209733_117450613300027591Forest SoilHLGQKIRVLVDRIDPVEKKIQFAVLEEAPVRTAGKKRKR
Ga0208324_111519913300027604Peatlands SoilGQKIRVLVDRIDPVEKKIQFAVLEEEPVRAKGKRKKRK
Ga0208565_123772113300027662Peatlands SoilRLGQRIRVLVDRIDPVEKKIQFAVWEEEPVRTTGRRKRR
Ga0209517_1010678143300027854Peatlands SoilTYSLGNRVRVLVDRIDPVEKKIQFAVLEAQPKPSGKSRRN
Ga0209701_1014151113300027862Vadose Zone SoilSRKTFRLGQKVRVLVDRIDPVEKKIQFALLEEIKPRQPKRKRRGLV
Ga0209167_1065973223300027867Surface SoilRVLVDRIDPVEKKIQFAVVEEEPVRAKGKERKRKKR
Ga0209068_1040308033300027894WatershedsIYSLGQRVRVIVDRIDPVEKKIQFALLEEKPTPKRKNR
Ga0209168_1044547013300027986Surface SoilRIGDRLRVIVDRIDPVEKKINFAVMEEARPKREKRRKKK
Ga0302224_1013000013300028759PalsaHIGDRLKVLVDRIDPVEKKIQFAVFEEEPPRSGRRKKRTG
Ga0310038_1016059713300030707Peatlands SoilYSLGQKIRVLVDRIDPVEKKIQFAVFEEAPVPAQGKRRKKR
Ga0310915_1128572323300031573SoilQRTRKIYHIGDRVKVIVDRIDPVEKKINFAVLDDEPAKPAKRRKRK
Ga0310686_10930605323300031708SoilQRIRVLVDRIDPVEKKIQFAVFEEKPQRSPKRKRK
Ga0307476_1081651333300031715Hardwood Forest SoilGQHTRKTYGLGDGVRVLVDRIDPVEKKIQFAVLEEEGQPKRSGKSRKK
Ga0307476_1122319913300031715Hardwood Forest SoilYSLGQRIRVLVDRIDPVEKKIQFALSVEQPAPKRKRSRN
Ga0310917_1064505723300031833SoilQLRVLVDRIDPVEKKVNFAVVEEERPKPAKAKRHKRK
Ga0318536_1041681913300031893SoilRRTFRLGQPVQVLVDRIDPVEKKIQFAFYEEAPPTRKRAKRR
Ga0310916_1033456313300031942SoilRMKVIVDRIDPVEKKINFAVLEEQPAPSAKRRKRR
Ga0308176_1048002323300031996SoilSYRIGDRLRVLVDRIDPVEKKINFAVLEEEPKPRWGKRRKK
Ga0308176_1297227723300031996SoilSRRAFRLGEKVHVLVDRIDPVEKKIQFALLYEKRPTAHHRRK
Ga0310911_1011662923300032035SoilLGQPVQVLVDRIDPVEKKIQFAFYEEAPPTRKRAKRR
Ga0308173_1053144513300032074SoilYRIGDRLRVLIDRIDPVEKKINFAVLEEEPKPRRGKRRKK
Ga0311301_1221911813300032160Peatlands SoilTYRLGQKIRVLIDRIDPVEKKIQFAVFEEEPVRAAGRRRKR
Ga0335080_1214233223300032828SoilYALGQKVHVLLDRIDPVEKKLQFALVEEVEQRPGKRKRK
Ga0335081_1044956233300032892SoilKTYRLGQKVRVIVDRIDPVEKKIQFALLEEEKPRSGTRKRR
Ga0335069_1018625913300032893SoilGQQIRVLVDRIDPVEKKIQFALVEERPVRKVGGKKRKK
Ga0335076_1021836813300032955SoilYSLGDRVRVLVDRIDPVEKKIQFALYEPPPPLRRPK
Ga0335084_1025238133300033004SoilDRVRVLVDRIDPVEKKIQFAVFEEPVVRPAGRCRK
Ga0335084_1057607813300033004SoilGDRLRVIVDRIDPVEKKINFAVMEEERPKPAKRRKRR
Ga0335084_1057901113300033004SoilIYRIGQQLRVLVDRIDPVEKKINFAVVEEEPPKPARRRKQR
Ga0335077_1046015943300033158SoilTFRLGQRVHVLVDRIDPVEKKIQFALMEGVRPAPRRR

 ⦗Top⦘


Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.