Basic Information | |
---|---|
Family ID | F082783 |
Family Type | Metagenome / Metatranscriptome |
Number of Sequences | 113 |
Average Sequence Length | 43 residues |
Representative Sequence | PNSWFATMASQIYELAFGTEYYQLARGKPGSSLPEDDLFAGIS |
Number of Associated Samples | 102 |
Number of Associated Scaffolds | 113 |
Quality Assessment | |
---|---|
Transcriptomic Evidence | Yes |
Most common taxonomic group | Bacteria |
% of genes with valid RBS motifs | 0.00 % |
% of genes near scaffold ends (potentially truncated) | 99.12 % |
% of genes from short scaffolds (< 2000 bps) | 95.58 % |
Associated GOLD sequencing projects | 97 |
AlphaFold2 3D model prediction | Yes |
3D model pTM-score | 0.27 |
Hidden Markov Model |
---|
Powered by Skylign |
Most Common Taxonomy | |
---|---|
Group | Bacteria (100.000 % of family members) |
NCBI Taxonomy ID | 2 |
Taxonomy | All Organisms → cellular organisms → Bacteria |
Most Common Ecosystem | |
---|---|
GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil (26.549 % of family members) |
Environment Ontology (ENVO) | Unclassified (29.204 % of family members) |
Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (53.097 % of family members) |
⦗Top⦘ |
⦗Top⦘ |
Predicted Topology & Secondary Structure | |||||
---|---|---|---|---|---|
Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 30.99% β-sheet: 0.00% Coil/Unstructured: 69.01% | Feature Viewer |
|
|||||
Powered by Feature Viewer |
Structure Viewer | |
---|---|
| |
Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.27 |
Powered by PDBe Molstar |
⦗Top⦘ |
Pfam ID | Name | % Frequency in 113 Family Scaffolds |
---|---|---|
PF02401 | LYTB | 73.45 |
PF06271 | RDD | 8.85 |
PF07883 | Cupin_2 | 2.65 |
PF13185 | GAF_2 | 1.77 |
PF04014 | MazE_antitoxin | 0.88 |
PF00211 | Guanylate_cyc | 0.88 |
PF05226 | CHASE2 | 0.88 |
COG ID | Name | Functional Category | % Frequency in 113 Family Scaffolds |
---|---|---|---|
COG0761 | 4-Hydroxy-3-methylbut-2-enyl diphosphate reductase IspH | Lipid transport and metabolism [I] | 146.90 |
COG1714 | Uncharacterized membrane protein YckC, RDD family | Function unknown [S] | 8.85 |
COG2114 | Adenylate cyclase, class 3 | Signal transduction mechanisms [T] | 0.88 |
COG4252 | Extracytoplasmic sensor domain CHASE2 (specificity unknown) | Signal transduction mechanisms [T] | 0.88 |
⦗Top⦘ |
Name | Rank | Taxonomy | Distribution |
All Organisms | root | All Organisms | 100.00 % |
Unclassified | root | N/A | 0.00 % |
Visualization |
---|
Powered by ApexCharts |
Scaffold | Taxonomy | Length | IMG/M Link |
---|---|---|---|
2088090004|P1_DRAFT_NODE_244814_len_1211_cov_20_148638 | All Organisms → cellular organisms → Bacteria | 1261 | Open in IMG/M |
3300001536|A1565W1_10105599 | All Organisms → cellular organisms → Bacteria | 1057 | Open in IMG/M |
3300001537|A2065W1_10630701 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 539 | Open in IMG/M |
3300002853|draft_1014233 | All Organisms → cellular organisms → Bacteria | 715 | Open in IMG/M |
3300005171|Ga0066677_10078650 | All Organisms → cellular organisms → Bacteria | 1709 | Open in IMG/M |
3300005176|Ga0066679_10457747 | All Organisms → cellular organisms → Bacteria | 835 | Open in IMG/M |
3300005181|Ga0066678_11130680 | All Organisms → cellular organisms → Bacteria | 503 | Open in IMG/M |
3300005435|Ga0070714_101473401 | All Organisms → cellular organisms → Bacteria | 665 | Open in IMG/M |
3300005445|Ga0070708_101093260 | All Organisms → cellular organisms → Bacteria | 747 | Open in IMG/M |
3300005468|Ga0070707_101286902 | All Organisms → cellular organisms → Bacteria | 697 | Open in IMG/M |
3300005518|Ga0070699_101169762 | All Organisms → cellular organisms → Bacteria | 706 | Open in IMG/M |
3300005559|Ga0066700_10215742 | All Organisms → cellular organisms → Bacteria | 1330 | Open in IMG/M |
3300005560|Ga0066670_10238566 | All Organisms → cellular organisms → Bacteria | 1100 | Open in IMG/M |
3300005561|Ga0066699_10000648 | All Organisms → cellular organisms → Bacteria | 10638 | Open in IMG/M |
3300005575|Ga0066702_10953086 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 513 | Open in IMG/M |
3300005576|Ga0066708_10005307 | All Organisms → cellular organisms → Bacteria | 5533 | Open in IMG/M |
3300005586|Ga0066691_10072726 | All Organisms → cellular organisms → Bacteria | 1887 | Open in IMG/M |
3300006032|Ga0066696_11024280 | All Organisms → cellular organisms → Bacteria | 525 | Open in IMG/M |
3300006041|Ga0075023_100600764 | All Organisms → cellular organisms → Bacteria | 511 | Open in IMG/M |
3300006354|Ga0075021_10450084 | All Organisms → cellular organisms → Bacteria | 812 | Open in IMG/M |
3300006638|Ga0075522_10179279 | All Organisms → cellular organisms → Bacteria | 1083 | Open in IMG/M |
3300006797|Ga0066659_10621822 | All Organisms → cellular organisms → Bacteria | 878 | Open in IMG/M |
3300006804|Ga0079221_10152193 | All Organisms → cellular organisms → Bacteria | 1212 | Open in IMG/M |
3300006806|Ga0079220_11547314 | All Organisms → cellular organisms → Bacteria | 572 | Open in IMG/M |
3300006852|Ga0075433_10460591 | All Organisms → cellular organisms → Bacteria | 1120 | Open in IMG/M |
3300006903|Ga0075426_10707097 | All Organisms → cellular organisms → Bacteria | 756 | Open in IMG/M |
3300006903|Ga0075426_10714854 | All Organisms → cellular organisms → Bacteria | 751 | Open in IMG/M |
3300006914|Ga0075436_101155730 | All Organisms → cellular organisms → Bacteria | 584 | Open in IMG/M |
3300007258|Ga0099793_10610854 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 547 | Open in IMG/M |
3300007788|Ga0099795_10393022 | All Organisms → cellular organisms → Bacteria | 628 | Open in IMG/M |
3300009029|Ga0066793_10803064 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 534 | Open in IMG/M |
3300009088|Ga0099830_10046789 | All Organisms → cellular organisms → Bacteria | 3032 | Open in IMG/M |
3300009089|Ga0099828_10075397 | All Organisms → cellular organisms → Bacteria | 2867 | Open in IMG/M |
3300009089|Ga0099828_10443412 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 1170 | Open in IMG/M |
3300009137|Ga0066709_102408334 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 715 | Open in IMG/M |
3300009143|Ga0099792_10718718 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 648 | Open in IMG/M |
3300010099|Ga0127450_1119756 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 667 | Open in IMG/M |
3300010361|Ga0126378_11662354 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 725 | Open in IMG/M |
3300010399|Ga0134127_13499571 | All Organisms → cellular organisms → Bacteria | 514 | Open in IMG/M |
3300011269|Ga0137392_10181171 | All Organisms → cellular organisms → Bacteria | 1716 | Open in IMG/M |
3300011269|Ga0137392_10934672 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 713 | Open in IMG/M |
3300011270|Ga0137391_11036264 | All Organisms → cellular organisms → Bacteria | 666 | Open in IMG/M |
3300011271|Ga0137393_11247944 | All Organisms → cellular organisms → Bacteria | 630 | Open in IMG/M |
3300011987|Ga0120164_1059401 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 546 | Open in IMG/M |
3300011996|Ga0120156_1028682 | All Organisms → cellular organisms → Bacteria | 1036 | Open in IMG/M |
3300011998|Ga0120114_1006855 | All Organisms → cellular organisms → Bacteria | 2745 | Open in IMG/M |
3300011998|Ga0120114_1049398 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 826 | Open in IMG/M |
3300012010|Ga0120118_1023255 | All Organisms → cellular organisms → Bacteria | 1672 | Open in IMG/M |
3300012011|Ga0120152_1047371 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 1403 | Open in IMG/M |
3300012011|Ga0120152_1090172 | All Organisms → cellular organisms → Bacteria | 887 | Open in IMG/M |
3300012096|Ga0137389_11126947 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 672 | Open in IMG/M |
3300012200|Ga0137382_10586842 | All Organisms → cellular organisms → Bacteria | 795 | Open in IMG/M |
3300012202|Ga0137363_11093394 | All Organisms → cellular organisms → Bacteria | 678 | Open in IMG/M |
3300012207|Ga0137381_10280513 | All Organisms → cellular organisms → Bacteria | 1450 | Open in IMG/M |
3300012207|Ga0137381_10515898 | All Organisms → cellular organisms → Bacteria | 1043 | Open in IMG/M |
3300012211|Ga0137377_11024408 | All Organisms → cellular organisms → Bacteria | 756 | Open in IMG/M |
3300012211|Ga0137377_11614207 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 572 | Open in IMG/M |
3300012285|Ga0137370_10271791 | All Organisms → cellular organisms → Bacteria | 1007 | Open in IMG/M |
3300012349|Ga0137387_11263770 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 518 | Open in IMG/M |
3300012359|Ga0137385_10267021 | All Organisms → cellular organisms → Bacteria | 1478 | Open in IMG/M |
3300012360|Ga0137375_10389121 | All Organisms → cellular organisms → Bacteria | 1223 | Open in IMG/M |
3300012363|Ga0137390_11793551 | All Organisms → cellular organisms → Bacteria | 545 | Open in IMG/M |
3300012382|Ga0134038_1277237 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 682 | Open in IMG/M |
3300012396|Ga0134057_1145664 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 527 | Open in IMG/M |
3300012582|Ga0137358_11120907 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 500 | Open in IMG/M |
3300012922|Ga0137394_11334869 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 579 | Open in IMG/M |
3300012922|Ga0137394_11363201 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 571 | Open in IMG/M |
3300012925|Ga0137419_10639931 | All Organisms → cellular organisms → Bacteria | 858 | Open in IMG/M |
3300012961|Ga0164302_10715993 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 744 | Open in IMG/M |
3300012972|Ga0134077_10203751 | All Organisms → cellular organisms → Bacteria | 807 | Open in IMG/M |
3300012975|Ga0134110_10355129 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 642 | Open in IMG/M |
3300012986|Ga0164304_11705484 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 526 | Open in IMG/M |
3300013770|Ga0120123_1022702 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 1274 | Open in IMG/M |
3300015359|Ga0134085_10518987 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 546 | Open in IMG/M |
3300017654|Ga0134069_1122585 | All Organisms → cellular organisms → Bacteria | 857 | Open in IMG/M |
3300017659|Ga0134083_10189229 | All Organisms → cellular organisms → Bacteria | 846 | Open in IMG/M |
3300018482|Ga0066669_11336574 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → unclassified Actinobacteria → Actinobacteria bacterium 13_2_20CM_2_66_6 | 649 | Open in IMG/M |
3300020002|Ga0193730_1039434 | All Organisms → cellular organisms → Bacteria | 1369 | Open in IMG/M |
3300020004|Ga0193755_1131358 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 774 | Open in IMG/M |
3300021178|Ga0210408_10753833 | All Organisms → cellular organisms → Bacteria | 764 | Open in IMG/M |
3300025922|Ga0207646_10262016 | All Organisms → cellular organisms → Bacteria | 1562 | Open in IMG/M |
3300025935|Ga0207709_11791355 | All Organisms → cellular organisms → Bacteria | 511 | Open in IMG/M |
3300025949|Ga0207667_12177733 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 512 | Open in IMG/M |
3300026310|Ga0209239_1207603 | All Organisms → cellular organisms → Bacteria | 697 | Open in IMG/M |
3300026317|Ga0209154_1095056 | All Organisms → cellular organisms → Bacteria | 1274 | Open in IMG/M |
3300026354|Ga0257180_1013122 | All Organisms → cellular organisms → Bacteria | 1016 | Open in IMG/M |
3300026530|Ga0209807_1314552 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 531 | Open in IMG/M |
3300026536|Ga0209058_1131615 | All Organisms → cellular organisms → Bacteria | 1216 | Open in IMG/M |
3300026538|Ga0209056_10736421 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 500 | Open in IMG/M |
3300026540|Ga0209376_1106664 | All Organisms → cellular organisms → Bacteria | 1421 | Open in IMG/M |
3300026551|Ga0209648_10210305 | All Organisms → cellular organisms → Bacteria | 1475 | Open in IMG/M |
3300027651|Ga0209217_1131245 | All Organisms → cellular organisms → Bacteria | 701 | Open in IMG/M |
3300027674|Ga0209118_1191232 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 555 | Open in IMG/M |
3300027678|Ga0209011_1051206 | All Organisms → cellular organisms → Bacteria | 1263 | Open in IMG/M |
3300027678|Ga0209011_1194291 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 555 | Open in IMG/M |
3300027765|Ga0209073_10165223 | All Organisms → cellular organisms → Bacteria | 825 | Open in IMG/M |
3300027846|Ga0209180_10356954 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 833 | Open in IMG/M |
3300027857|Ga0209166_10529069 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 604 | Open in IMG/M |
3300027862|Ga0209701_10368842 | All Organisms → cellular organisms → Bacteria | 808 | Open in IMG/M |
3300027875|Ga0209283_10663671 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 655 | Open in IMG/M |
3300027882|Ga0209590_10262349 | All Organisms → cellular organisms → Bacteria | 1104 | Open in IMG/M |
3300027910|Ga0209583_10097148 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 1129 | Open in IMG/M |
3300028673|Ga0257175_1036646 | All Organisms → cellular organisms → Bacteria | 869 | Open in IMG/M |
3300028768|Ga0307280_10390565 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 518 | Open in IMG/M |
3300028784|Ga0307282_10088507 | All Organisms → cellular organisms → Bacteria | 1426 | Open in IMG/M |
3300028791|Ga0307290_10388940 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 510 | Open in IMG/M |
3300031544|Ga0318534_10446338 | All Organisms → cellular organisms → Bacteria | 741 | Open in IMG/M |
3300032174|Ga0307470_10976108 | All Organisms → cellular organisms → Bacteria | 672 | Open in IMG/M |
3300032180|Ga0307471_101947438 | All Organisms → cellular organisms → Bacteria | 736 | Open in IMG/M |
3300032180|Ga0307471_103734905 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 538 | Open in IMG/M |
3300032180|Ga0307471_103874692 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 529 | Open in IMG/M |
3300032205|Ga0307472_100553481 | All Organisms → cellular organisms → Bacteria | 1005 | Open in IMG/M |
3300032261|Ga0306920_104296625 | All Organisms → cellular organisms → Bacteria | 512 | Open in IMG/M |
⦗Top⦘ |
Habitat | Taxonomy | Distribution |
Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 26.55% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 13.27% |
Permafrost | Environmental → Terrestrial → Soil → Unclassified → Permafrost → Permafrost | 8.85% |
Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 7.08% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 6.19% |
Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 4.42% |
Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 3.54% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 3.54% |
Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 3.54% |
Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 3.54% |
Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 3.54% |
Watersheds | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds | 2.65% |
Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 2.65% |
Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 0.89% |
Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 0.89% |
Surface Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil | 0.89% |
Hydrocarbon Resource Environments | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Hydrocarbon Resource Environments | 0.89% |
Arctic Peat Soil | Environmental → Terrestrial → Soil → Unclassified → Permafrost → Arctic Peat Soil | 0.89% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Permafrost → Soil | 0.89% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 0.89% |
Prmafrost Soil | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Prmafrost Soil | 0.89% |
Soil | Environmental → Terrestrial → Soil → Loam → Grasslands → Soil | 0.89% |
Agricultural Soil | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Agricultural Soil | 0.89% |
Corn Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere | 0.89% |
Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 0.89% |
Visualization |
---|
Powered by ApexCharts |
Taxon OID | Sample Name | Habitat Type | IMG/M Link |
---|---|---|---|
2088090004 | Permafrost microbial communities from permafrost in Bonanza Creek, Alaska - Permafrost Layer P1 | Environmental | Open in IMG/M |
3300001536 | Permafrost active layer microbial communities from McGill Arctic Research Station, Canada - (A15-65cm-8A)- 1 week illumina | Environmental | Open in IMG/M |
3300001537 | Permafrost active layer microbial communities from McGill Arctic Research Station, Canada - (A20-65 cm-11A)- 1 week illumina | Environmental | Open in IMG/M |
3300002853 | PDIso9.ppmwps2 | Environmental | Open in IMG/M |
3300005171 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_126 | Environmental | Open in IMG/M |
3300005176 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_128 | Environmental | Open in IMG/M |
3300005181 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_127 | Environmental | Open in IMG/M |
3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Environmental | Open in IMG/M |
3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Environmental | Open in IMG/M |
3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Environmental | Open in IMG/M |
3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Environmental | Open in IMG/M |
3300005559 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_149 | Environmental | Open in IMG/M |
3300005560 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_119 | Environmental | Open in IMG/M |
3300005561 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_148 | Environmental | Open in IMG/M |
3300005575 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_151 | Environmental | Open in IMG/M |
3300005576 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_157 | Environmental | Open in IMG/M |
3300005586 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_140 | Environmental | Open in IMG/M |
3300006032 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_145 | Environmental | Open in IMG/M |
3300006041 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Straight Creek_MetaG_SC_2014 | Environmental | Open in IMG/M |
3300006354 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Cold Stream Run_MetaG_CSR_2012 | Environmental | Open in IMG/M |
3300006638 | Arctic peat soil microbial communities from the Barrow Environmental Observatory site, Barrow, Alaska, USA - NGEE PermafrostL2-A | Environmental | Open in IMG/M |
3300006797 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_108 | Environmental | Open in IMG/M |
3300006804 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS200 | Environmental | Open in IMG/M |
3300006806 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS100 | Environmental | Open in IMG/M |
3300006852 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Host-Associated | Open in IMG/M |
3300006903 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD5 | Host-Associated | Open in IMG/M |
3300006914 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Host-Associated | Open in IMG/M |
3300007258 | Vadose zone soil and rhizosphere microbial communities from the Eel River Critical Zone Observatory, Northern California to study diel carbon cycling - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_3 | Environmental | Open in IMG/M |
3300007788 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 | Environmental | Open in IMG/M |
3300009029 | Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Permafrost soil replicate 1 DNA2013-189 | Environmental | Open in IMG/M |
3300009088 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H3.8 metaG | Environmental | Open in IMG/M |
3300009089 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H1.8 metaG | Environmental | Open in IMG/M |
3300009137 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_158 | Environmental | Open in IMG/M |
3300009143 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_2 | Environmental | Open in IMG/M |
3300010099 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Wat_40_2_16_2 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300010361 | Tropical forest soil microbial communities from Panama - MetaG Plot_23 | Environmental | Open in IMG/M |
3300010399 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-3 | Environmental | Open in IMG/M |
3300011269 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h3.4A metaG | Environmental | Open in IMG/M |
3300011270 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h2.4B metaG | Environmental | Open in IMG/M |
3300011271 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h3.4B metaG | Environmental | Open in IMG/M |
3300011987 | Permafrost microbial communities from Nunavut, Canada - A20_80cm_0M | Environmental | Open in IMG/M |
3300011996 | Permafrost microbial communities from Nunavut, Canada - A39_65cm_12M | Environmental | Open in IMG/M |
3300011998 | Permafrost microbial communities from Nunavut, Canada - A30_35cm_6M | Environmental | Open in IMG/M |
3300012010 | Permafrost microbial communities from Nunavut, Canada - A7_35cm_12M | Environmental | Open in IMG/M |
3300012011 | Permafrost microbial communities from Nunavut, Canada - A30_65cm_6M | Environmental | Open in IMG/M |
3300012096 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h1.4B metaG | Environmental | Open in IMG/M |
3300012200 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_20_16 metaG | Environmental | Open in IMG/M |
3300012202 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_115_16 metaG | Environmental | Open in IMG/M |
3300012207 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_115_16 metaG | Environmental | Open in IMG/M |
3300012211 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_40_16 metaG | Environmental | Open in IMG/M |
3300012285 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_20_16 metaG | Environmental | Open in IMG/M |
3300012349 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Sage2_R_115_16 metaG | Environmental | Open in IMG/M |
3300012359 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_80_16 metaG | Environmental | Open in IMG/M |
3300012360 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_113_16 metaG | Environmental | Open in IMG/M |
3300012363 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h2.4A metaG | Environmental | Open in IMG/M |
3300012382 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Glu_20cm_5_4_2 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300012396 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Glu_40cm_5_0_2 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300012582 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_20_16 metaG | Environmental | Open in IMG/M |
3300012922 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czobulk1.16 metaG | Environmental | Open in IMG/M |
3300012925 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_2_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
3300012961 | Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_202_MG | Environmental | Open in IMG/M |
3300012972 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_40cm_5_24_1 metaG | Environmental | Open in IMG/M |
3300012975 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_5_11112015 | Environmental | Open in IMG/M |
3300012986 | Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_217_MG | Environmental | Open in IMG/M |
3300013770 | Permafrost microbial communities from Nunavut, Canada - A15_5cm_18M | Environmental | Open in IMG/M |
3300015359 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_2_09182015 | Environmental | Open in IMG/M |
3300017654 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_40cm_2_24_1 metaG | Environmental | Open in IMG/M |
3300017659 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Met_40cm_5_24_1 metaG | Environmental | Open in IMG/M |
3300018482 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_118 | Environmental | Open in IMG/M |
3300020002 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U1a1 | Environmental | Open in IMG/M |
3300020004 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? H1a2 | Environmental | Open in IMG/M |
3300021178 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-4-M | Environmental | Open in IMG/M |
3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) | Environmental | Open in IMG/M |
3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) | Host-Associated | Open in IMG/M |
3300026310 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 10_02_2013_2_20cm (SPAdes) | Environmental | Open in IMG/M |
3300026317 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_121 (SPAdes) | Environmental | Open in IMG/M |
3300026354 | Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - NR-04-B | Environmental | Open in IMG/M |
3300026530 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_154 (SPAdes) | Environmental | Open in IMG/M |
3300026536 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_147 (SPAdes) | Environmental | Open in IMG/M |
3300026538 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_114 (SPAdes) | Environmental | Open in IMG/M |
3300026540 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_134 (SPAdes) | Environmental | Open in IMG/M |
3300026551 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_115cm (SPAdes) | Environmental | Open in IMG/M |
3300027651 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM3H0_M2 (SPAdes) | Environmental | Open in IMG/M |
3300027674 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_Ref_M1 (SPAdes) | Environmental | Open in IMG/M |
3300027678 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM1_M3 (SPAdes) | Environmental | Open in IMG/M |
3300027765 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS100 (SPAdes) | Environmental | Open in IMG/M |
3300027846 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H2.8 metaG (SPAdes) | Environmental | Open in IMG/M |
3300027857 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen01_05102014_R1 (SPAdes) | Environmental | Open in IMG/M |
3300027862 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H3.8 metaG (SPAdes) | Environmental | Open in IMG/M |
3300027875 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H1.8 metaG (SPAdes) | Environmental | Open in IMG/M |
3300027882 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con1.8 metaG (SPAdes) | Environmental | Open in IMG/M |
3300027910 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Straight Creek_MetaG_SC_2014 (SPAdes) | Environmental | Open in IMG/M |
3300028673 | Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - NI-69-B | Environmental | Open in IMG/M |
3300028768 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_119 | Environmental | Open in IMG/M |
3300028784 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_121 | Environmental | Open in IMG/M |
3300028791 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_144 | Environmental | Open in IMG/M |
3300031544 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.117b4f26 | Environmental | Open in IMG/M |
3300032174 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_05 | Environmental | Open in IMG/M |
3300032180 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_515 | Environmental | Open in IMG/M |
3300032205 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_05 | Environmental | Open in IMG/M |
3300032261 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170 (v2) | Environmental | Open in IMG/M |
Geographical Distribution | |
---|---|
Zoom: | Powered by OpenStreetMap |
⦗Top⦘ |
Protein ID | Sample Taxon ID | Habitat | Sequence |
P1_DRAFT_00549340 | 2088090004 | Soil | NDPNSWFATMASQIYELAFGTEYYQLARGKPGSDLPEDDLFAGIT |
A1565W1_101055991 | 3300001536 | Permafrost | DPNSWFTTMADQIYRLAFGTEYYRLARGKPGSKLPENDLFAGIS* |
A2065W1_106307012 | 3300001537 | Permafrost | QNDPNSWFTTMADQIYRLAFGTEYYRLARGKPGSKLPENDLFAGIS* |
draft_10142331 | 3300002853 | Hydrocarbon Resource Environments | DPNSWFTTMASQIYELTFGTEYYQLARGKPGSSLPEDDLFAGIS* |
Ga0066677_100786501 | 3300005171 | Soil | SQNDPNSWFTTMASQVYELAFGTEYYQLARGKPGSSLPEDDLFAGID* |
Ga0066679_104577472 | 3300005176 | Soil | NDPNSWFATMQDQVYELAFGTEFYQLVRGELGSEPPEQDLFAGVDS* |
Ga0066678_111306801 | 3300005181 | Soil | VSQNDPNSWFATMASQIYELAFGTEYYQLVRGKAGSDLPEPDLFAGIS* |
Ga0070714_1014734012 | 3300005435 | Agricultural Soil | QNDPNSWFSTMQDQIYELAFGTEYYQLARGKPGSELPEPDLFAGIS* |
Ga0070708_1010932602 | 3300005445 | Corn, Switchgrass And Miscanthus Rhizosphere | QNDPNSWFTTMASQVYELAFGTEYYQLVRGDPGSSLPEDDLFAGIS* |
Ga0070707_1012869022 | 3300005468 | Corn, Switchgrass And Miscanthus Rhizosphere | SWFANMADQIYRLAFGTEHYQLARGKPGSELPESDLFAGIG* |
Ga0070699_1011697622 | 3300005518 | Corn, Switchgrass And Miscanthus Rhizosphere | RKRQAFAAHVSQNDPNSWFATMADQIYELAFGAEYYELARGKPGSALPENDLFVGI* |
Ga0066700_102157421 | 3300005559 | Soil | DQVYRLAFGTEYYQLARGKPGSALPENDLFLGIN* |
Ga0066670_102385662 | 3300005560 | Soil | SQVYELAFGTEYYQLARGKPGPSLPEDDLFAGIE* |
Ga0066699_1000064814 | 3300005561 | Soil | HVSQNDPNSWFATMQDQVYELAFGTEFYQLVRGELGSEPPEQDLFAGVDS* |
Ga0066702_109530861 | 3300005575 | Soil | SQNDPNSWFATMASQIYELAFGTEYYQLARGKPGADLPEPDLFVGIS* |
Ga0066708_100053071 | 3300005576 | Soil | WFATMADQIYELAFGTEYYQLARGKPGSALPEDDLFVGT* |
Ga0066691_100727261 | 3300005586 | Soil | WFTTMASQVYELAFGTEHYQLARGKPGASLPEDDLFAGIS* |
Ga0066696_110242802 | 3300006032 | Soil | DQIYEMAFGTEYYQLVRGKPGSEVPEPDLFAGIS* |
Ga0075023_1006007642 | 3300006041 | Watersheds | TQNDPNSWFATMADQIYRLAFGTEYFQLARGKVGSPLPEPDVFSGISQEAS* |
Ga0075021_104500842 | 3300006354 | Watersheds | QNDPNSWFATMADQIYRLAFSVEHFQLARGKPGSQLPEADVFAGIS* |
Ga0075522_101792793 | 3300006638 | Arctic Peat Soil | TMADQIYRMAFGTEYYRLARGKVGSKVPENDLFVGVD* |
Ga0066659_106218221 | 3300006797 | Soil | SWFMTMASQVYELAFGTEYYQLARGKPGPSLPEDDLFAGIE* |
Ga0079221_101521931 | 3300006804 | Agricultural Soil | NDPKSWFATMQDQIYELAFGTEYYQLARGKLGSEPPEPDLFAGIS* |
Ga0079220_115473141 | 3300006806 | Agricultural Soil | FRAHVSQNDPKSWFATMQDQIYELAFGTEYYQLARGKLGPEVPERDLFAGIT* |
Ga0075433_104605913 | 3300006852 | Populus Rhizosphere | KMQDQVYELAFGTEYYQLARGKAGSELPEEDLFAGIS* |
Ga0075426_107070972 | 3300006903 | Populus Rhizosphere | SQNDPNSWFATMQDQMYELAFGTEFYQLARGEPGSERPERDLFAGVDS* |
Ga0075426_107148542 | 3300006903 | Populus Rhizosphere | QNDPNSWFATMQDQVYELAFGTEYYQLARGKPGSELPEPDLFAGID* |
Ga0075436_1011557302 | 3300006914 | Populus Rhizosphere | AHVSQNDPNSWFATMADQIYELAFGTEYYQLARGKPGSALPENDLFSGIA* |
Ga0099793_106108541 | 3300007258 | Vadose Zone Soil | NDPNSLFTTMASQIYELAFGTEYYQLVRGHPGSELPESDLFAGIK* |
Ga0099795_103930221 | 3300007788 | Vadose Zone Soil | PNSWFTTMASQIYELAFGTEYYQLVRGNPGSELPEADLFAGIK* |
Ga0066793_108030641 | 3300009029 | Prmafrost Soil | PNSWFATMASQIYELAFGTEYYQLARGKPGSSLPEDDLFAGIS* |
Ga0099830_100467894 | 3300009088 | Vadose Zone Soil | EFIDRKRAAFAAHVSQNDPNSWFANMADQIYRLAFGTEYYRLARGKPGSALPEPDLFVGID* |
Ga0099828_100753971 | 3300009089 | Vadose Zone Soil | ANMADQIYRLAFGTEYYQLARGKAGSELPESDLFAGVD* |
Ga0099828_104434123 | 3300009089 | Vadose Zone Soil | ATMQDQIFRVAFGTEHYQLARGKPGMALPENDLFAGV* |
Ga0066709_1024083341 | 3300009137 | Grasslands Soil | DPNSWFATMQDQIYELAFGTEYYQLVRGKRGSELPEPDLFAGIG* |
Ga0099792_107187181 | 3300009143 | Vadose Zone Soil | TMASQIYELAFGTEYYQLVRGKPGSELPEPDLFVGID* |
Ga0127450_11197562 | 3300010099 | Grasslands Soil | VSQNDPNSWFMTMASQVYELAFGTEYYQLARGKPGLSLPEDDLFAGIE* |
Ga0126378_116623541 | 3300010361 | Tropical Forest Soil | PNSWMQSMQRQILELAFGTEYFRLVRGKLGPGSPEPDLFAGIS* |
Ga0134127_134995711 | 3300010399 | Terrestrial Soil | PDSWFSTMQDSIYRMLFGTEYYELARGKPGSALPESDVFAGIGTHLT* |
Ga0137392_101811711 | 3300011269 | Vadose Zone Soil | HVSQNDPNSWFANMADQIYRLAFGTEYYQLARGKPGSALPEPDLFVGID* |
Ga0137392_109346722 | 3300011269 | Vadose Zone Soil | DPNSWFASMASQIYELAFGTEYYQLVRGEPGSDPPEPDLFAGIS* |
Ga0137391_110362642 | 3300011270 | Vadose Zone Soil | FANMADQIYRLAFGTEYYQLARGKPGSELPESDLFAGID* |
Ga0137393_112479441 | 3300011271 | Vadose Zone Soil | AHVSQNDPNSWFANMADQIYRLAFGTEYYQLARGKPGSALPEPDLFVGID* |
Ga0120164_10594012 | 3300011987 | Permafrost | TQNDPNSWFTTMADQIYRLAFGTEYYRLARGKPGSELPENDLFVGVPDK* |
Ga0120156_10286821 | 3300011996 | Permafrost | NDTNSWFTTMASQIYELAFGTEYYQLARGKLGAEPPEPDLFAGIS* |
Ga0120114_10068551 | 3300011998 | Permafrost | IYRLAFGTEYYRLARGKPGSELPENDLFVGVPDK* |
Ga0120114_10493982 | 3300011998 | Permafrost | TMASQIYELAFGTEYYQLARGKLGAEPPEPDLFAGIS* |
Ga0120118_10232553 | 3300012010 | Permafrost | PNSWFTTMADQIYRLAFGTEYYRLARGKPGSKLPENDLFVGVADK* |
Ga0120152_10473711 | 3300012011 | Permafrost | PNSWFTTMADQMYRMAFGTEYYRLAHGKPGSEVPEGDLFAGT* |
Ga0120152_10901722 | 3300012011 | Permafrost | FTTMADQIYRLAFGTEYYRLARGKPGSKLPENDLFAGIADK* |
Ga0137389_111269471 | 3300012096 | Vadose Zone Soil | SQIYELAFGTEYYRLARGKPGSDLPEPDLFAGIS* |
Ga0137382_105868422 | 3300012200 | Vadose Zone Soil | DQVYELAFGTEYYQRVRGKACSEVPENDVFAGIS* |
Ga0137363_110933942 | 3300012202 | Vadose Zone Soil | PNSWFANMADQIYRLAFGTEYYQLARGKPGSALPEPDLFVGID* |
Ga0137381_102805132 | 3300012207 | Vadose Zone Soil | SWFATMQDQILRVAFGTEYYELARGKAGMALPEDDLFAGIT* |
Ga0137381_105158982 | 3300012207 | Vadose Zone Soil | SQNDPNSWFSTMQDQVYELAFGTEYYQLARGKPGSELPEDDLFAGIA* |
Ga0137377_110244081 | 3300012211 | Vadose Zone Soil | PNSWFATMASQVYELAFGTEHYRLARGKPGSELPEPDLFVGIE* |
Ga0137377_116142071 | 3300012211 | Vadose Zone Soil | MADQIYRLAFGTEYYQLARGKPGSALPESDLFAGIS* |
Ga0137370_102717911 | 3300012285 | Vadose Zone Soil | STMQDQVYELAFGTEYYQLARGKAGPELPEPDLFVGIDS* |
Ga0137387_112637702 | 3300012349 | Vadose Zone Soil | TMADQIYELAFGTEYHQLARGKPGSALPEDDLFSGI* |
Ga0137385_102670212 | 3300012359 | Vadose Zone Soil | DQILRVAFGTEYYELARGKAGMALPEDDLFAGIT* |
Ga0137375_103891212 | 3300012360 | Vadose Zone Soil | FTTMADQIYRIAFGTEYYALSRGEPGSELPENDLFAGIG* |
Ga0137390_117935512 | 3300012363 | Vadose Zone Soil | SQNDPNSWFANMADQIYRLAFGTEYYQLARGKPGSALPEPDLFVGID* |
Ga0134038_12772372 | 3300012382 | Grasslands Soil | QNDPNSWFTTMASQVYELAFGTEHYQLARGKPGASLPEDDLFAGIS* |
Ga0134057_11456641 | 3300012396 | Grasslands Soil | NDLNSWFSTMQDQVYELAFGTEYYQLARGKPRSELPEPDLFAGIE* |
Ga0137358_111209071 | 3300012582 | Vadose Zone Soil | NSWFSTMQDQVYELAFGTEYYQLARGKPGSELPEDDLFAGIA* |
Ga0137394_113348692 | 3300012922 | Vadose Zone Soil | ASQIYELAFGTEYYQLARGKPGASLPEDDLFAGIS* |
Ga0137394_113632011 | 3300012922 | Vadose Zone Soil | VSQNDPNSWFTTMASQIYELAFGTEYYQLARGKLGVEPPEPDLFAGIS* |
Ga0137419_106399311 | 3300012925 | Vadose Zone Soil | QNDPNSWFTTMADQIYRLAFGTEYYRLGQGEPGSDLPENDLFAGIV* |
Ga0164302_107159931 | 3300012961 | Soil | QNDPNSWFATMQDQIYELAFGTEYYQLARGKPGSELPEDDLFAGIS* |
Ga0134077_102037511 | 3300012972 | Grasslands Soil | NDPKSWFATMQDQVYELAFGTEYYQLARGKPGSELPEKDLFAGIS* |
Ga0134110_103551291 | 3300012975 | Grasslands Soil | QNDPNSWFATMQDQIYELAFGTEYYQLVRGKAGSELPEPDLFEGIA* |
Ga0164304_117054842 | 3300012986 | Soil | TAHVTQNDPNSWFTTMADQIYRLAFGTEYYRLARGKPGSELPESDLFVGIADK* |
Ga0120123_10227022 | 3300013770 | Permafrost | ADQIYRLAFGTEYYRLARGKPGSELPENDLFAGIAGT* |
Ga0134085_105189872 | 3300015359 | Grasslands Soil | MQDQVYELAFGTEYYQLARGKAGPELPEPDLFVGIDS* |
Ga0134069_11225851 | 3300017654 | Grasslands Soil | SWFSTMQDQVYELALGTEYYQLARGKAGPELPEPDLFVGIDS |
Ga0134083_101892291 | 3300017659 | Grasslands Soil | NDPNSWFTTMQDQVYELAFGTEYYQLARGKVGSSLPERDLFAGIS |
Ga0066669_113365741 | 3300018482 | Grasslands Soil | QNDPNSWFSTMQDQVYELAFGTEYYQLARGKPGSELPEPDLFAGIS |
Ga0193730_10394343 | 3300020002 | Soil | KAFAAHVTQNDPNSWFTTMADQIYELAFGTEYYALERGKAGSELPEPDVFVGVAPS |
Ga0193755_11313581 | 3300020004 | Soil | WFTTMADQIYELAFGTEYYALERGKAGSELPEPDVFVGIAPS |
Ga0210408_107538332 | 3300021178 | Soil | FATMASQIYELAFGTEYYQLVRGKPGSELPENDLFAGIK |
Ga0207646_102620161 | 3300025922 | Corn, Switchgrass And Miscanthus Rhizosphere | HVSQNDPNSWFNKIPEQVYETAFGTEFYQLARGELGSERPERDLFAGVDS |
Ga0207709_117913552 | 3300025935 | Miscanthus Rhizosphere | SIYRMLFGTEYYELARGKPGSALPESDVFAGIGTHLT |
Ga0207667_121777331 | 3300025949 | Corn Rhizosphere | NDPNSWFATMQDQIYELAFGTEYYQLARGKPGSELPEADLFAGVTD |
Ga0209239_12076031 | 3300026310 | Grasslands Soil | ASQIYELAFGTEYYQLARGRPGSSLPEDDLFAGID |
Ga0209154_10950562 | 3300026317 | Soil | VSQNDPNSWFTTMASQVYELAFGTEHYQLARGKPGASLPEDDLFAGIS |
Ga0257180_10131222 | 3300026354 | Soil | ANMADQIYRLAFGTEYYQLARGKPGSALPEPDLFVGID |
Ga0209807_13145522 | 3300026530 | Soil | SQNDPNSWFATMQDQIFRVAFGTEHYQLARGKPGMALPEDDLFAGV |
Ga0209058_11316153 | 3300026536 | Soil | SWFATMQDQIFRVAFGTEHYQLARGKPGMALPEDDLFAGV |
Ga0209056_107364211 | 3300026538 | Soil | NSWFTTMASQVYELAFGTEYYQLARGKPGSSLPEDDLFTGIE |
Ga0209376_11066641 | 3300026540 | Soil | SWFATMADQIYELAFGTEYYQLARGKPGSALPEDDLFVGT |
Ga0209648_102103053 | 3300026551 | Grasslands Soil | WFANMADQIYRLAFGTEYYQLARGKPGSPLPEPDLFVGVN |
Ga0209217_11312451 | 3300027651 | Forest Soil | QNDPNSWFATMASQIYELAFGTEYYQLARGRLGTEPPEPDLFAGLS |
Ga0209118_11912322 | 3300027674 | Forest Soil | SWFTTMADQLYKLAFGTEYYRLARGKPGSELPEPDLFEGIAEK |
Ga0209011_10512061 | 3300027678 | Forest Soil | FTTMADQIYQMVFGTEYYQLARGKPGSALPEDAVFAGID |
Ga0209011_11942912 | 3300027678 | Forest Soil | SQNDPNSWFATMASQIYELAFGTEYYQLARGKLVTEPPEPDLFAGIS |
Ga0209073_101652231 | 3300027765 | Agricultural Soil | ATMQDQIYELAFGTEYYQLARGKLGPEVPERDLFAGIT |
Ga0209180_103569541 | 3300027846 | Vadose Zone Soil | FANMADQIYRLAFGTEYYQLARGKPGSPLPEPDLFVGVN |
Ga0209166_105290691 | 3300027857 | Surface Soil | FATMADQIYELAFGTEYYQLARGKPGSALPENDLFSGIA |
Ga0209701_103688422 | 3300027862 | Vadose Zone Soil | NSWFANMADQIYRLAFGTEYYQLARGKPGSALPEPDLFVGID |
Ga0209283_106636711 | 3300027875 | Vadose Zone Soil | DPNSWFATMQDQIFRVAFGTEHYQLARGKPGMALPEDDLFSGIA |
Ga0209590_102623491 | 3300027882 | Vadose Zone Soil | FRAHVSQNDPNSWFATMQDQVYELAFGTEFYQLARGELGSERPELDLFAGVDS |
Ga0209583_100971483 | 3300027910 | Watersheds | NSWFATMADQIYELAFGTEYYALERGQAGFELPEPDLFVGVAPS |
Ga0257175_10366461 | 3300028673 | Soil | DPNSWFATMASQIYELAFGTEYYQLVRGKPGSDLPEPDLFAGIS |
Ga0307280_103905651 | 3300028768 | Soil | HVTQNDPNSWFTTMADQIYELAFGTEYYALERGKPGSEIPEPDVFVGIAPS |
Ga0307282_100885072 | 3300028784 | Soil | NSWFTTMASQIYELAFGTEYYQLVRGNPGSSLPEDDLFAGIT |
Ga0307290_103889401 | 3300028791 | Soil | VTQNDPNSWFTTMADQMYRMAFGTEYYRLARGKPGSDTPEPDLFAGVR |
Ga0318534_104463382 | 3300031544 | Soil | SQNDPNSWFASIPDDMAQLAFGTEYYQLARGKPGSSLPESDLFAGIS |
Ga0307470_109761082 | 3300032174 | Hardwood Forest Soil | ANMADQIYRLAFGTEYYQLARGKPGSPLPEPDLFAGIA |
Ga0307471_1019474382 | 3300032180 | Hardwood Forest Soil | HVSQNDPNSWFATMQDQVYESAFGTEFYQLARGELGSERPERDLFAGVDS |
Ga0307471_1037349051 | 3300032180 | Hardwood Forest Soil | PNSWFATMQDQIFRVAFGTEYYQLARGKPGTALPENDLFAGIS |
Ga0307471_1038746922 | 3300032180 | Hardwood Forest Soil | SQNDPNSWFATMQDQIYELAFGTEYYQLARGKPGSELPEPDLFVGIDS |
Ga0307472_1005534812 | 3300032205 | Hardwood Forest Soil | MQDQIFRVAFGTEYYQLARGKPGTALPENDLFAGV |
Ga0306920_1042966251 | 3300032261 | Soil | WPETMQRQILELALGTEYYQLVRGVPGSSLPESDLFAGIS |
⦗Top⦘ |