NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome / Metatranscriptome Family F082730

Metagenome / Metatranscriptome Family F082730

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F082730
Family Type Metagenome / Metatranscriptome
Number of Sequences 113
Average Sequence Length 97 residues
Representative Sequence MPSIPKVKFKFKKGIHNIWLTNKEPIDLLKKTHKNKEITYDKQDTFKAIDFNNEFEAGTNNKKKVPINGNTKINTSKLDMFNKKKSNINIL
Number of Associated Samples 102
Number of Associated Scaffolds 113

Quality Assessment
Transcriptomic Evidence Yes
Most common taxonomic group Unclassified
% of genes with valid RBS motifs 9.17 %
% of genes near scaffold ends (potentially truncated) 45.13 %
% of genes from short scaffolds (< 2000 bps) 68.14 %
Associated GOLD sequencing projects 99
AlphaFold2 3D model prediction Yes
3D model pTM-score0.22

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Unclassified (52.212 % of family members)
NCBI Taxonomy ID N/A
Taxonomy N/A

Most Common Ecosystem
GOLD Ecosystem Environmental → Aquatic → Marine → Intertidal Zone → Estuary → Estuarine
(16.814 % of family members)
Environment Ontology (ENVO) Unclassified
(30.973 % of family members)
Earth Microbiome Project Ontology (EMPO) Free-living → Saline → Water (saline)
(65.487 % of family members)



 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      


 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Globular Signal Peptide: No Secondary Structure distribution: α-helix: 25.21%    β-sheet: 0.00%    Coil/Unstructured: 74.79%
Feature Viewer
Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer
Per-residue confidence (pLDDT):
  0-50   51-70   71-90   91-100  
pTM-score: 0.22
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.


 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 113 Family Scaffolds
PF00361Proton_antipo_M 38.94
PF02790COX2_TM 3.54
PF00116COX2 2.65
PF00416Ribosomal_S13 1.77
PF00338Ribosomal_S10 1.77
PF13631Cytochrom_B_N_2 0.88
PF00510COX3 0.88
PF00420Oxidored_q2 0.88
PF00252Ribosomal_L16 0.88
PF10588NADH-G_4Fe-4S_3 0.88
PF00253Ribosomal_S14 0.88
PF00902TatC 0.88
PF00137ATP-synt_C 0.88

Neighboring Clusters of Orthologous Genes (COGs)

COG IDNameFunctional Category % Frequency in 113 Family Scaffolds
COG1622Heme/copper-type cytochrome/quinol oxidase, subunit 2Energy production and conversion [C] 6.19
COG4263Nitrous oxide reductaseInorganic ion transport and metabolism [P] 2.65
COG0051Ribosomal protein S10Translation, ribosomal structure and biogenesis [J] 1.77
COG0099Ribosomal protein S13Translation, ribosomal structure and biogenesis [J] 1.77
COG0197Ribosomal protein L16/L10AETranslation, ribosomal structure and biogenesis [J] 0.88
COG0199Ribosomal protein S14Translation, ribosomal structure and biogenesis [J] 0.88
COG0636FoF1-type ATP synthase, membrane subunit c/Archaeal/vacuolar-type H+-ATPase, subunit KEnergy production and conversion [C] 0.88
COG0805Twin-arginine protein secretion pathway component TatCIntracellular trafficking, secretion, and vesicular transport [U] 0.88
COG1845Heme/copper-type cytochrome/quinol oxidase, subunit 3Energy production and conversion [C] 0.88


 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
UnclassifiedrootN/A52.21 %
All OrganismsrootAll Organisms47.79 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
2199352005|2199955366All Organisms → cellular organisms → Eukaryota4110Open in IMG/M
3300000120|SA_S2_NOR13_50mDRAFT_c1043528Not Available587Open in IMG/M
3300000124|BS_KBA_SWE12_21mDRAFT_c10004290All Organisms → cellular organisms → Eukaryota4959Open in IMG/M
3300000241|BS_KBA_SWE21_205mDRAFT_10107646Not Available599Open in IMG/M
3300000422|BB_Man_A_Liq_inBBDRAFT_1027326Not Available525Open in IMG/M
3300001282|B570J14230_10000228All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Ochrophyta → Bacillariophyta → Coscinodiscophyceae21407Open in IMG/M
3300002154|JGI24538J26636_10084128Not Available759Open in IMG/M
3300003346|JGI26081J50195_1000140All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Ochrophyta → Bacillariophyta30420Open in IMG/M
3300003682|Ga0008456_1006343All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Ochrophyta → Bacillariophyta → Coscinodiscophyceae → Rhizosoleniophycidae → Rhizosoleniales → Rhizosoleniaceae → Proboscia → Proboscia inermis1439Open in IMG/M
3300003683|Ga0008459J53047_1006416All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Ochrophyta → Bacillariophyta → Coscinodiscophyceae → Rhizosoleniophycidae → Rhizosoleniales → Rhizosoleniaceae → Proboscia → Proboscia inermis1531Open in IMG/M
3300003683|Ga0008459J53047_1028726All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Ochrophyta → Bacillariophyta → Coscinodiscophyceae → Rhizosoleniophycidae → Rhizosoleniales → Rhizosoleniaceae → Proboscia → Proboscia inermis1452Open in IMG/M
3300003860|Ga0031658_1000089All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Ochrophyta → Bacillariophyta → Coscinodiscophyceae13766Open in IMG/M
3300003860|Ga0031658_1020449All Organisms → cellular organisms → Eukaryota → Sar1112Open in IMG/M
3300004097|Ga0055584_100150866All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Ochrophyta → Bacillariophyta → Coscinodiscophyceae → Rhizosoleniophycidae → Rhizosoleniales → Rhizosoleniaceae → Proboscia → Proboscia inermis2343Open in IMG/M
3300005758|Ga0078117_1022198All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Ochrophyta → Bacillariophyta6234Open in IMG/M
3300005805|Ga0079957_1137936All Organisms → cellular organisms → Eukaryota1260Open in IMG/M
3300005955|Ga0073922_1036863Not Available609Open in IMG/M
3300006014|Ga0073919_1002009All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Ochrophyta → Bacillariophyta2044Open in IMG/M
3300006384|Ga0075516_1395801Not Available789Open in IMG/M
3300006384|Ga0075516_1421896All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Ochrophyta → Bacillariophyta → Coscinodiscophyceae → Rhizosoleniophycidae → Rhizosoleniales → Rhizosoleniaceae → Proboscia → Proboscia inermis1400Open in IMG/M
3300006390|Ga0075509_1513330Not Available619Open in IMG/M
3300006396|Ga0075493_1057380All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Ochrophyta → Bacillariophyta3625Open in IMG/M
3300006484|Ga0070744_10014429All Organisms → cellular organisms → Eukaryota2343Open in IMG/M
3300006868|Ga0075481_10267690Not Available600Open in IMG/M
3300006875|Ga0075473_10283217Not Available671Open in IMG/M
3300007177|Ga0102978_1148797All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Ochrophyta → Bacillariophyta4340Open in IMG/M
3300007600|Ga0102920_1170107Not Available699Open in IMG/M
3300007706|Ga0102899_1012089All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Ochrophyta → Bacillariophyta → Coscinodiscophyceae → Rhizosoleniophycidae → Rhizosoleniales → Rhizosoleniaceae → Proboscia → Proboscia inermis2005Open in IMG/M
3300007716|Ga0102867_1139353Not Available654Open in IMG/M
3300007725|Ga0102951_1113907Not Available765Open in IMG/M
3300007955|Ga0105740_1076686Not Available564Open in IMG/M
3300008115|Ga0114348_1000091All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Ochrophyta → Bacillariophyta42116Open in IMG/M
3300008116|Ga0114350_1013562All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Ochrophyta → Bacillariophyta9302Open in IMG/M
3300008930|Ga0103733_1036232Not Available778Open in IMG/M
3300008996|Ga0102831_1021633All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Ochrophyta → Bacillariophyta → Coscinodiscophyceae2199Open in IMG/M
3300009024|Ga0102811_1337374Not Available567Open in IMG/M
3300009432|Ga0115005_10520435Not Available949Open in IMG/M
3300009436|Ga0115008_10132659Not Available1825Open in IMG/M
3300009436|Ga0115008_10170621Not Available1573Open in IMG/M
3300009544|Ga0115006_10981497Not Available749Open in IMG/M
3300009608|Ga0115100_10464887All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Ochrophyta → Bacillariophyta → Coscinodiscophyceae → Rhizosoleniophycidae → Rhizosoleniales → Rhizosoleniaceae → Proboscia → Proboscia inermis1566Open in IMG/M
3300010885|Ga0133913_10622675All Organisms → cellular organisms → Eukaryota2831Open in IMG/M
3300012408|Ga0138265_1029156All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Ochrophyta → Bacillariophyta → Coscinodiscophyceae → Rhizosoleniophycidae → Rhizosoleniales → Rhizosoleniaceae → Proboscia → Proboscia inermis1558Open in IMG/M
3300012408|Ga0138265_1102164All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria3427Open in IMG/M
3300012412|Ga0138266_1116375All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria3420Open in IMG/M
3300012416|Ga0138259_1728737All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → malvids → Brassicales → Brassicaceae → Camelineae → Arabidopsis → Arabidopsis thaliana1485Open in IMG/M
3300012777|Ga0138292_1021374Not Available509Open in IMG/M
3300012935|Ga0138257_1531028All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → malvids → Brassicales → Brassicaceae → Camelineae → Arabidopsis → Arabidopsis thaliana1472Open in IMG/M
3300012963|Ga0129340_1121353Not Available533Open in IMG/M
3300013295|Ga0170791_14169396Not Available531Open in IMG/M
3300018515|Ga0192960_100547Not Available1501Open in IMG/M
3300018873|Ga0193553_1119411Not Available645Open in IMG/M
3300018981|Ga0192968_10006457All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Ochrophyta → Bacillariophyta2798Open in IMG/M
3300018981|Ga0192968_10051896All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Ochrophyta → Bacillariophyta1127Open in IMG/M
3300019191|Ga0180035_1105834All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Ochrophyta → Bacillariophyta → Coscinodiscophyceae → Rhizosoleniophycidae → Rhizosoleniales → Rhizosoleniaceae → Proboscia → Proboscia inermis2833Open in IMG/M
3300019200|Ga0180036_1094310All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Ochrophyta → Bacillariophyta3246Open in IMG/M
3300019207|Ga0180034_1079843Not Available709Open in IMG/M
3300019707|Ga0193989_1031351Not Available617Open in IMG/M
3300019717|Ga0193972_1001049Not Available1928Open in IMG/M
3300019721|Ga0194011_1000400Not Available2538Open in IMG/M
3300019722|Ga0193971_1008428All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Ochrophyta → Bacillariophyta → Coscinodiscophyceae → Rhizosoleniophycidae → Rhizosoleniales → Rhizosoleniaceae → Proboscia → Proboscia inermis1087Open in IMG/M
3300019729|Ga0193968_1056561Not Available549Open in IMG/M
3300019730|Ga0194001_1027522Not Available680Open in IMG/M
3300019731|Ga0193982_1060360Not Available530Open in IMG/M
3300019737|Ga0193973_1000246Not Available3744Open in IMG/M
3300019737|Ga0193973_1002785Not Available1453Open in IMG/M
3300020205|Ga0211731_11697698All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Ochrophyta → Bacillariophyta → Coscinodiscophyceae → Rhizosoleniophycidae → Rhizosoleniales → Rhizosoleniaceae → Proboscia → Proboscia inermis1197Open in IMG/M
3300020496|Ga0208230_1000004All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Ochrophyta → Bacillariophyta45386Open in IMG/M
3300021323|Ga0210295_1050156Not Available512Open in IMG/M
3300021368|Ga0213860_10074673All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Ochrophyta → Bacillariophyta1466Open in IMG/M
3300021424|Ga0194117_10159367All Organisms → cellular organisms → Eukaryota1143Open in IMG/M
3300021425|Ga0213866_10131371Not Available1341Open in IMG/M
3300021497|Ga0193945_1044232Not Available568Open in IMG/M
3300021849|Ga0210304_1017008All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Ochrophyta → Bacillariophyta → Coscinodiscophyceae → Rhizosoleniophycidae → Rhizosoleniales → Rhizosoleniaceae → Proboscia → Proboscia inermis1560Open in IMG/M
3300021957|Ga0222717_10000527All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Ochrophyta → Bacillariophyta32819Open in IMG/M
3300021957|Ga0222717_10313556Not Available891Open in IMG/M
3300021959|Ga0222716_10046972All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Ochrophyta → Bacillariophyta3073Open in IMG/M
3300021960|Ga0222715_10417874Not Available729Open in IMG/M
3300021960|Ga0222715_10499506Not Available646Open in IMG/M
3300021964|Ga0222719_10794947Not Available521Open in IMG/M
3300022206|Ga0224499_10025453All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Ochrophyta → Bacillariophyta → Coscinodiscophyceae → Rhizosoleniophycidae → Rhizosoleniales → Rhizosoleniaceae → Proboscia → Proboscia inermis1866Open in IMG/M
3300022217|Ga0224514_10000604All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Ochrophyta → Bacillariophyta10147Open in IMG/M
3300022308|Ga0224504_10000429All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Ochrophyta → Bacillariophyta18765Open in IMG/M
3300022308|Ga0224504_10082530Not Available1295Open in IMG/M
3300022375|Ga0210313_1013455Not Available949Open in IMG/M
(restricted) 3300022913|Ga0233404_10101766All Organisms → cellular organisms → Eukaryota → Sar679Open in IMG/M
(restricted) 3300024059|Ga0255040_10094786Not Available1157Open in IMG/M
(restricted) 3300024062|Ga0255039_10097219Not Available1171Open in IMG/M
3300024346|Ga0244775_10268205All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Ochrophyta → Bacillariophyta1420Open in IMG/M
3300025653|Ga0208428_1157222Not Available605Open in IMG/M
3300025684|Ga0209652_1117530Not Available741Open in IMG/M
3300025767|Ga0209137_1029918All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Ochrophyta → Bacillariophyta2924Open in IMG/M
3300027159|Ga0208020_1024493Not Available1177Open in IMG/M
3300027193|Ga0208800_1043953Not Available605Open in IMG/M
3300027198|Ga0208163_1044682Not Available722Open in IMG/M
3300027254|Ga0208177_1000136All Organisms → cellular organisms → Eukaryota7962Open in IMG/M
3300027315|Ga0208949_1014451Not Available1683Open in IMG/M
3300027406|Ga0208965_1051070Not Available918Open in IMG/M
3300027501|Ga0208948_1022310All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Ochrophyta → Bacillariophyta → Coscinodiscophyceae → Rhizosoleniophycidae → Rhizosoleniales → Rhizosoleniaceae → Proboscia → Proboscia inermis1453Open in IMG/M
3300027553|Ga0208947_1026380Not Available1537Open in IMG/M
3300027753|Ga0208305_10101615All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Ochrophyta → Bacillariophyta1076Open in IMG/M
3300027753|Ga0208305_10252801Not Available625Open in IMG/M
3300027757|Ga0208671_10043851All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Ochrophyta → Bacillariophyta1669Open in IMG/M
3300027806|Ga0209985_10053512All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Ochrophyta → Bacillariophyta → Coscinodiscophyceae → Thalassiosirophycidae → Thalassiosirales → Thalassiosiraceae → Thalassiosira2234Open in IMG/M
3300027833|Ga0209092_10049369All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Ochrophyta → Bacillariophyta → Coscinodiscophyceae2614Open in IMG/M
3300027836|Ga0209230_10142297All Organisms → cellular organisms → Eukaryota1362Open in IMG/M
3300028329|Ga0210315_1019284Not Available846Open in IMG/M
3300031786|Ga0315908_10177867All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Ochrophyta → Bacillariophyta1758Open in IMG/M
3300034105|Ga0335035_0712117Not Available513Open in IMG/M

Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).



 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
EstuarineEnvironmental → Aquatic → Marine → Intertidal Zone → Estuary → Estuarine16.81%
SedimentEnvironmental → Aquatic → Freshwater → Sediment → Unclassified → Sediment8.85%
AqueousEnvironmental → Aquatic → Marine → Coastal → Unclassified → Aqueous7.08%
MarineEnvironmental → Aquatic → Marine → Intertidal Zone → Unclassified → Marine6.19%
MarineEnvironmental → Aquatic → Marine → Oceanic → Unclassified → Marine5.31%
MarineEnvironmental → Aquatic → Marine → Unclassified → Unclassified → Marine5.31%
Estuarine WaterEnvironmental → Aquatic → Marine → Unclassified → Unclassified → Estuarine Water5.31%
SeawaterEnvironmental → Aquatic → Marine → Oceanic → Unclassified → Seawater4.42%
Polar MarineEnvironmental → Aquatic → Marine → Unclassified → Unclassified → Polar Marine4.42%
SedimentEnvironmental → Aquatic → Marine → Sediment → Unclassified → Sediment3.54%
FreshwaterEnvironmental → Aquatic → Freshwater → Lentic → Epilimnion → Freshwater1.77%
Freshwater Lake SedimentEnvironmental → Aquatic → Freshwater → Lentic → Sediment → Freshwater Lake Sediment1.77%
Freshwater, PlanktonEnvironmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater, Plankton1.77%
Freshwater LakeEnvironmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake1.77%
Freshwater LakeEnvironmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake1.77%
FreshwaterEnvironmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater1.77%
SeawaterEnvironmental → Aquatic → Marine → Coastal → Unclassified → Seawater1.77%
MarineEnvironmental → Aquatic → Marine → Wetlands → Sediment → Marine1.77%
EstuarineEnvironmental → Aquatic → Marine → Unclassified → Unclassified → Estuarine1.77%
SeawaterEnvironmental → Aquatic → Marine → Strait → Unclassified → Seawater1.77%
SandEnvironmental → Terrestrial → Soil → Sand → Unclassified → Sand1.77%
FreshwaterEnvironmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater0.89%
Freshwater LakeEnvironmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lake0.89%
Freshwater And SedimentEnvironmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater And Sediment0.89%
FreshwaterEnvironmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater0.89%
Lake WaterEnvironmental → Aquatic → Freshwater → Lake → Unclassified → Lake Water0.89%
LakeEnvironmental → Aquatic → Freshwater → Lake → Unclassified → Lake0.89%
FreshwaterEnvironmental → Aquatic → Freshwater → Unclassified → Unclassified → Freshwater0.89%
SeawaterEnvironmental → Aquatic → Marine → Inlet → Unclassified → Seawater0.89%
Estuary WaterEnvironmental → Aquatic → Marine → Coastal → Unclassified → Estuary Water0.89%
SeawaterEnvironmental → Aquatic → Marine → Intertidal Zone → Unclassified → Seawater0.89%
MarineEnvironmental → Aquatic → Marine → Intertidal Zone → Sediment → Marine0.89%
Pelagic MarineEnvironmental → Aquatic → Marine → Neritic Zone → Unclassified → Pelagic Marine0.89%
WaterEnvironmental → Aquatic → Non-Marine Saline And Alkaline → Saline → Unclassified → Water0.89%
Bioluminescent BayEnvironmental → Aquatic → Non-Marine Saline And Alkaline → Saline → Sediment → Bioluminescent Bay0.89%
Ice Edge, Mcmurdo Sound, AntarcticaEnvironmental → Aquatic → Marine → Oceanic → Unclassified → Ice Edge, Mcmurdo Sound, Antarctica0.89%

Visualization
Powered by ApexCharts



Associated Samples

Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).

Taxon OIDSample NameHabitat TypeIMG/M Link
2199352005Freshwater microbial communities from Lake Mendota, WI - Practice 29OCT2010 epilimnionEnvironmentalOpen in IMG/M
3300000120Marine microbial communities from chronically polluted sediments in Adventfjord, Norway - Svalbard Archipelago station 2 sample NOR 13_50mEnvironmentalOpen in IMG/M
3300000124Marine microbial communities from chronically polluted sediments in the Baltic Sea - site KBA sample SWE 12_21mEnvironmentalOpen in IMG/M
3300000241Marine microbial communities from chronically polluted sediments in the Baltic Sea - site KBB sample SWE 21_20.5mEnvironmentalOpen in IMG/M
3300000422Marine sediment microbial community from La Parguera, Puerto Rico - BB Mangrove A SedimentEnvironmentalOpen in IMG/M
3300001282Freshwater microbial communities from Lake Mendota, WI - Practice 20APR2010 epilimnionEnvironmentalOpen in IMG/M
3300002154Marine eukaryotic phytoplankton communities from the South Atlantic Ocean - 30m ANT-15 MetagenomeEnvironmentalOpen in IMG/M
3300003346Marine microbial communities from expanding oxygen minimum zones in the Saanich Inlet - ESP_74LU_5_DNAEnvironmentalOpen in IMG/M
3300003554Ammonia-oxidizing marine microbial communities from Monterey Bay, California, USA - Metatranscriptome CAN11_04_M0_20 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300003682Ammonia-oxidizing marine microbial communities from Monterey Bay, California, USA - Metatranscriptome CAN11_03_M0_10 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300003683Ammonia-oxidizing marine microbial communities from Monterey Bay, California, USA - Metatranscriptome CAN11_54_BLW_10 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300003860Freshwater lake sediment microbial communities from the University of Notre Dame, USA, for methane emissions studies - PLP11 PLEnvironmentalOpen in IMG/M
3300004097Pelagic marine sediment microbial communities from the LTER site Helgoland, North Sea, for post-phytoplankton bloom and carbon turnover studies - OSD3 (Helgoland) metaGEnvironmentalOpen in IMG/M
3300005758Cyanobacteria communities in tropical freswater systems - freshwater lake in SingaporeEnvironmentalOpen in IMG/M
3300005805Microbial and algae communities from Cheney Reservoir in Wichita, Kansas, USAEnvironmentalOpen in IMG/M
3300005955Groundwater microbial communities from the Columbia River, Washington, USA, for microbe roles in carbon and contaminant biogeochemistry - GW-RW metaG T2_23-Sept-14EnvironmentalOpen in IMG/M
3300006014Groundwater microbial communities from the Columbia River, Washington, USA, for microbe roles in carbon and contaminant biogeochemistry - GW-RW metaG T3_25-Nov-14EnvironmentalOpen in IMG/M
3300006384Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_29_N_>0.8_RNA1 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300006390Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_22_N_>0.8_RNA2 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300006396Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Spr_20_>0.8_RNA2 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300006484Estuarine microbial communities from the Columbia River estuary, USA - metaG S.535EnvironmentalOpen in IMG/M
3300006868Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_29_N_>0.8_DNAEnvironmentalOpen in IMG/M
3300006875Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_0.19_N_>0.8_DNAEnvironmentalOpen in IMG/M
3300007177Combined Assembly of cyanobacterial bloom in Marina Bay water reservoir, Singapore (Diel cycle-Surface and Bottom layers) 16 sequencing projectsEnvironmentalOpen in IMG/M
3300007600Estuarine microbial communities from the Columbia River estuary - metaG 1568A-3EnvironmentalOpen in IMG/M
3300007706Estuarine microbial communities from the Columbia River estuary - metaG 1555B-3EnvironmentalOpen in IMG/M
3300007716Estuarine microbial communities from the Columbia River estuary - metaG 1546B-3EnvironmentalOpen in IMG/M
3300007725Water microbial communities from South San Francisco under conditions of wetland restoration - Salt Pond MetaG R2A_B_H2O_MGEnvironmentalOpen in IMG/M
3300007955Coastal water column microbial communities from Columbia River Estuary, Oregon, USA - CMOP_DNA_1373B_3.0umEnvironmentalOpen in IMG/M
3300008115Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE2, Sample E2014-0106-100-LTREnvironmentalOpen in IMG/M
3300008116Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE2, Sample E2014-0106-3-NAEnvironmentalOpen in IMG/M
3300008930Eukaryotic and microbial communities from ice edge, McMurdo Sound, Antarctica - 1BEnvironmentalOpen in IMG/M
3300008996Estuarine microbial communities from the Columbia River estuary - Freshwater metaG S.747EnvironmentalOpen in IMG/M
3300009024Estuarine microbial communities from the Columbia River estuary - Flood tide ETM metaG S.705EnvironmentalOpen in IMG/M
3300009432Marine eukaryotic phytoplankton communities from Arctic Ocean - Arctic Ocean - Greenland ARC118M MetagenomeEnvironmentalOpen in IMG/M
3300009436Marine eukaryotic phytoplankton communities from Arctic Ocean - Fram Strait ARC3M MetagenomeEnvironmentalOpen in IMG/M
3300009544Marine eukaryotic phytoplankton communities from Arctic Ocean - Arctic Ocean- Svalbard ARC20M MetagenomeEnvironmentalOpen in IMG/M
3300009599Marine eukaryotic communities from Pacific Ocean to study complex ecological interactions - MBTS_5May14_M1_3um Metatranscriptome (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300009608Marine eukaryotic communities from Pacific Ocean to study complex ecological interactions - MBTS_2Apr14_M1_3um Metatranscriptome (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300010885northern Canada Lakes Co-assemblyEnvironmentalOpen in IMG/M
3300012408Metatranscriptomics of polar marine prokaryotic and eukaryotic communities from Palmer Station, Antarctica after 192hr light incubation - RNA23.A_192.20151118 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300012412Metatranscriptomics of polar marine prokaryotic and eukaryotic communities from Palmer Station, Antarctica after 192hr light incubation - RNA24.B_192.20151118 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300012416Metatranscriptomics of polar marine prokaryotic and eukaryotic communities from Palmer Station, Antarctica after 24hr light incubation - RNA9.A_24.20151111 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300012777Freshwater microbial communities from Lake Simoncouche, Canada - S_140709_E_mt (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300012935Metatranscriptomics of polar marine prokaryotic and eukaryotic communities from Arthur Harbor ice station, Antarctica - RNA5.ICE_1m.20151110 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300012963Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Sum_15_0.8_RNA1 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300013295northern Canada Lakes metatranscriptome co-assemblyEnvironmentalOpen in IMG/M
3300018515Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_083 - TARA_N000001372 (ERX1782216-ERR1712231)EnvironmentalOpen in IMG/M
3300018873Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_093 - TARA_N000001098EnvironmentalOpen in IMG/M
3300018981Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_084 - TARA_N000001440 (ERX1782157-ERR1712238)EnvironmentalOpen in IMG/M
3300019191Estuarine microbial communities from the Columbia River estuary - R.880 metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300019200Estuarine microbial communities from the Columbia River estuary - R.1175 metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300019207Estuarine microbial communities from the Columbia River estuary - R.871 metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300019707Sediment microbial communities from the Broadkill River, Lewes, Delaware, United States ? BLC_0-1_MGEnvironmentalOpen in IMG/M
3300019717Sediment microbial communities from the Broadkill River, Lewes, Delaware, United States ? BRT_8-9_MGEnvironmentalOpen in IMG/M
3300019721Sediment microbial communities from the Broadkill River, Lewes, Delaware, United States ? FLC_7-8_MGEnvironmentalOpen in IMG/M
3300019722Sediment microbial communities from the Broadkill River, Lewes, Delaware, United States ? BRT_7-8_MGEnvironmentalOpen in IMG/M
3300019729Sediment microbial communities from the Broadkill River, Lewes, Delaware, United States ? BRT_4-5_MGEnvironmentalOpen in IMG/M
3300019730Sediment microbial communities from the Broadkill River, Lewes, Delaware, United States ? FLT_7-8_MGEnvironmentalOpen in IMG/M
3300019731Sediment microbial communities from the Broadkill River, Lewes, Delaware, United States ? BLT_3-4_MGEnvironmentalOpen in IMG/M
3300019737Sediment microbial communities from the Broadkill River, Lewes, Delaware, United States ? BRT_9-10_MGEnvironmentalOpen in IMG/M
3300020205Freshwater lake microbial communities from Lake Erken, Sweden - P4710_103 megahit1EnvironmentalOpen in IMG/M
3300020496Freshwater microbial communities from Lake Mendota, WI - 01NOV2011 deep hole epilimnion (SPAdes)EnvironmentalOpen in IMG/M
3300021323Metatranscriptome of estuarine water microbial communities from the Columbia River estuary, Oregon, United States ? R9.63AS (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300021353Metatranscriptome of ammonia-oxidizing marine archaeal communities from Monterey Bay, California, United States - M2 80m 12015 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300021368Coastal seawater microbial communities near Pivers Island, North Carolina, United States - PICO550EnvironmentalOpen in IMG/M
3300021424Freshwater microbial communities from Lake Tanganyika, Tanzania - TA2015009 Mahale N1 surfaceEnvironmentalOpen in IMG/M
3300021425Coastal seawater microbial communities near Pivers Island, North Carolina, United States - PICO284EnvironmentalOpen in IMG/M
3300021497Sediment microbial communities from the Broadkill River, Lewes, Delaware, United States ? BRT_0-1_MGEnvironmentalOpen in IMG/M
3300021849Metatranscriptome of estuarine water microbial communities from the Columbia River estuary, Oregon, United States ? R1037 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300021957Estuarine water microbial communities from San Francisco Bay, California, United States - C33_18DEnvironmentalOpen in IMG/M
3300021959Estuarine water microbial communities from San Francisco Bay, California, United States - C33_13DEnvironmentalOpen in IMG/M
3300021960Estuarine water microbial communities from San Francisco Bay, California, United States - C33_9DEnvironmentalOpen in IMG/M
3300021964Estuarine water microbial communities from San Francisco Bay, California, United States - C33_34DEnvironmentalOpen in IMG/M
3300022206Sediment microbial communities from San Francisco Bay, California, United States - SF_Jul11_sed_USGS_24EnvironmentalOpen in IMG/M
3300022217Sediment microbial communities from San Francisco Bay, California, United States - SF_May12_sed_USGS_24EnvironmentalOpen in IMG/M
3300022308Sediment microbial communities from San Francisco Bay, California, United States - SF_Oct11_sed_USGS_24EnvironmentalOpen in IMG/M
3300022375Metatranscriptome of estuarine water microbial communities from the Columbia River estuary, Oregon, United States ? R1183 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300022913 (restricted)Seawater microbial communities from Saanich Inlet, British Columbia, Canada - Na_oxic_2_MGEnvironmentalOpen in IMG/M
3300024059 (restricted)Seawater microbial communities from Strait of Georgia, British Columbia, Canada - BC1_12_2EnvironmentalOpen in IMG/M
3300024062 (restricted)Seawater microbial communities from Strait of Georgia, British Columbia, Canada - BC1_12_1EnvironmentalOpen in IMG/M
3300024346Whole water sample coassemblyEnvironmentalOpen in IMG/M
3300025653Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_29_N_>0.8_DNA (SPAdes)EnvironmentalOpen in IMG/M
3300025684Marine microbial communities from expanding oxygen minimum zones in the Saanich Inlet - ESP_74LU_5_DNA (SPAdes)EnvironmentalOpen in IMG/M
3300025767Marine microbial communities from expanding oxygen minimum zones in the Saanich Inlet - ESP_105LU_22_DNA (SPAdes)EnvironmentalOpen in IMG/M
3300027159Estuarine microbial communities from the Columbia River estuary - Ebb tide ETM metaG S.573 (SPAdes)EnvironmentalOpen in IMG/M
3300027193Estuarine microbial communities from the Columbia River estuary - Freshwater metaG S.541 (SPAdes)EnvironmentalOpen in IMG/M
3300027198Estuarine microbial communities from the Columbia River estuary - Ebb tide non-ETM metaG S.753 (SPAdes)EnvironmentalOpen in IMG/M
3300027254Estuarine microbial communities from the Columbia River estuary - metaG 1561A-3 (SPAdes)EnvironmentalOpen in IMG/M
3300027315Ammonia-oxidizing marine microbial communities from Monterey Bay, California, USA - CAN11_03_M0_10 (SPAdes)EnvironmentalOpen in IMG/M
3300027406Ammonia-oxidizing marine microbial communities from Monterey Bay, California, USA - CAN11_07_M0_10 (SPAdes)EnvironmentalOpen in IMG/M
3300027501Ammonia-oxidizing marine microbial communities from Monterey Bay, California, USA - CAN11_17_M020 (SPAdes)EnvironmentalOpen in IMG/M
3300027553Ammonia-oxidizing marine microbial communities from Monterey Bay, California, USA - CAN11_04_M0_20 (SPAdes)EnvironmentalOpen in IMG/M
3300027753Estuarine microbial communities from the Columbia River estuary - Flood tide ETM metaG S.741 (SPAdes)EnvironmentalOpen in IMG/M
3300027757Estuarine microbial communities from the Columbia River estuary - Ebb tide ETM metaG S.759 (SPAdes)EnvironmentalOpen in IMG/M
3300027806Freshwater lake microbial communities from Lake Erie, under a cyanobacterial bloom - NOAA_Erie_Diel6S_1000h metaG (SPAdes)EnvironmentalOpen in IMG/M
3300027833Marine eukaryotic phytoplankton communities from Arctic Ocean - Fram Strait ARC3M Metagenome (SPAdes)EnvironmentalOpen in IMG/M
3300027836Freshwater and sediment microbial communities from Lake Ontario - Sta 18 epilimnion Metagenome (SPAdes)EnvironmentalOpen in IMG/M
3300028329Metatranscriptome of estuarine water microbial communities from the Columbia River estuary, Washington, United States ? R1276 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300031786Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 4 MA124EnvironmentalOpen in IMG/M
3300032011Ammonia-oxidizing marine archaeal communities from Monterey Bay, California, United States - M1 60m 3416EnvironmentalOpen in IMG/M
3300034105Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME15May2014-rr0127EnvironmentalOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap



 ⦗Top⦘

Family Sequences

Note: Some of these sequences are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).

Protein ID Sample Taxon ID Habitat Sequence
22001607922199352005FreshwaterMPSIPKLKFKFKKGIHNNLLTNWKEPTDLLKKTHKNKEMEYKKQDTFKAMDFNNK*FEAGTNNRRKTPSKGNTIINTSKLVILNKKKSNINIL
SA_S2_NOR13_50mDRAFT_104352823300000120MarineMKKSEIPSIPKVKFKFEKGIHNNLLTN*KEPVDLLKKTHKNKEITYKKQDTFKAKDFNSE*FDAGTNNKKKVPIKGNTIMKTSKLVTFNEKKSNINIL*
BS_KBA_SWE12_21mDRAFT_1000429023300000124MarineMKNNEMPSIPKLKLRFKKGIHNNLLTNWKEPIDLLKNTHKNKEITYKKQEVFKAIAFNAE*FEEGTNNNKKVPIKGNTKIRINKFVTFNKKKSNINIL*
BS_KBA_SWE21_205mDRAFT_1010764633300000241MarineKVVKRIKNSEIPSMPKLKLKFKKGIHNSLLTN*KEPMDLLKKTHKNKEITYNKQDTFKAIDFSKE*FEEGTNNNKNVPIKGKTKTKINKFVTFNKKKFNIYIL*
BB_Man_A_Liq_inBBDRAFT_102732633300000422Bioluminescent BayPILKLKFKKGIHNSLFTN*KEPTDLLKKTHKNKEITYSKQDTFNAIDFNKK*FEEGTKSKKNVPIKGNTKITINKFAAFNKKKSNIHIL*
B570J14230_10000228383300001282FreshwaterMPSIPKLKFKFKKGIHNNLLTNWKEPTDLLKKTHKNKEMEYKKQDTFKAMDFNNK*FEAGTNNRRKTPSKGNTIINTSKLVILNKKKSNINIL*
JGI24538J26636_1008412823300002154MarineMKKSETPSIPKLKFKFKKGIHNNLLTN*KEPIDLLKKNHKNKETTYKKQDVFKAISFNKE*FEVGTNNNKKIPIKGNTIRKTNKFDTSNHEKFNIKNLEVI
JGI26081J50195_1000140543300003346MarineMHRKINKVVKSIKNSEIPSTPKLKLKFKKGIHNNLLTN*KEPIDLLKKTHKNKETTYNRQDTFKAIDFNKEWFEEGINNSKNVPIKGNTKTKINKFVTFNKKKSNIYIL*
Ga0008451J51688_10820423300003554SeawaterMPSIPKVKFKFKKSIHNIWLTN*KEPIDLLKKTHKNKEITYDKQDTFKATNFNNE*FEAGTNNKKKVPVNGNTKNNTE*IEFWLRMIIKELLSI*
Ga0008456_100634313300003682SeawaterMHKKISKVVKRIKKSEMPSIPKVKFKFKKGIHNIWLTN*KEPIDLLKKTHKNKEITYDKQDTFKAIDFNNE*FEAGTNNKKKVPINGNTKIN
Ga0008459J53047_100641613300003683SeawaterMHKKISKVVKRIKKSEMPSIPKVKFKFKKGIHNIWLTN*KEPIDLLKKTHKNKEITYDKQDTFKAIDFNNE*FEAGTNNKKKVPINGNTKINTSKLDMFNKKKSNINIL*
Ga0008459J53047_102872613300003683SeawaterMKKREIPSIPKLKFKFKNGIHNNLFTN*KDPMDLLKKTHKSIELKYTQQETFKAKDFNSE*LDVGTNNNNKVPAKGKIMIKINRFV
Ga0031658_1000089263300003860Freshwater Lake SedimentMFVSTLVQLINIHKKINKVVKRIKKSEIPSTPKLKFKFKKGIHQNLLTN*KEPIDLLKKIHKNKETINTKQDIFRAIDFNNE*FEAGTNSKRKTPIKGSVKLNTSKLVIFNKKKSNINIL
Ga0031658_102044933300003860Freshwater Lake SedimentMHKKINNVVKRIKKSEIPSTPKLKFKFRKGIHQNLLTN*KEPIDLLKKTHKNRETTYEKQDIFRAIDFNNEWLEAETNNRRKTPIKGNINRITSKLVIFNKKKSNINIL*
Ga0055584_10015086643300004097Pelagic MarineMPSIPKLKFKFKKGTHHSLLTN*KEPTDLLKKTHKNNEITYKKQDTFKAIDFNKE*FEAGTNNRKKILIIGNTIIKTSKFVTLKKKKSNINIL*
Ga0078117_102219883300005758Lake WaterVVKRIKNNEIPSIPKLKLKFKKGIHNSLLTN*KEPMDLLKKTHKNKEITYNKQDTFKAIDFSKE*FEEGTNNNKNVPIKGNTKTKINKFVTFNKKKFNIHIL*
Ga0079957_113793633300005805LakeKLKFKFKKGIHNNLLTNWKEPTDLLKKTHKNKEMEYKKQDTFKAMDFNNK*FEAGTNNRRKTPTKGNTIINTSKLVIFNKKKSNINIL*
Ga0073922_103686313300005955SandKINNVVKRIKKSEIPSTPKLKFKFRKGIHQNLLTN*KEPIDLLKKTHKNKETTYEKQDTFKAIDFNNEWLEAGTNNRRKTPIKGNIKMITSKLVIFNKKKSNINIL*
Ga0073919_100200923300006014SandMHKKINNVVKRIKKSEIPSTPKLKFKFRKGIHQNLLTN*KEPIDLLKKTHKNKETTYEKQDTFKAIDFNNEWLEAGTNNRRKTPIKGNIKMITSKLVIFNKKKSNINIL*
Ga0075516_139580123300006384AqueousMHKKISNVVKRIKNNEMPSTPMLKLRFKRGIHNILLTN*KEPVDLLKKTHKNKEITYTTQEIFKAMAFNIEKLKEGVHNSIKTPIKGNINKRISKFEVF
Ga0075516_142189613300006384AqueousMPSTPTLKLRFKKGTHNILLTN*KEPLDLLKKTHKNKEITYTTQEIFKAMAFNIEMLEDGVHNSIKTPIKGNINKRISKFE
Ga0075509_151333043300006390AqueousHKKINKVVKRTKNSDIPSTPMLKFKFKKGIHNSLLTN*KEPIDLLKKTHKSNDITYVKQDTFNAIDFNNEWFEEGAHNKKKVPIKGNTVIKTNKLAIFNKKKFNINTL*
Ga0075493_105738023300006396AqueousMFDLTLVQLINMHRKINKVVKSIKNSEIPSTPKLKLKFKKGIHNNLLTN*KEPIDLLKKTHKNKETTYNRQDTFKATDFNKEWFEEGINNSKNVPIKGNTKTKINKFVTFNKKKSNIYIL
Ga0070744_1001442943300006484EstuarineMPSIPKLKFKFKKGIHNNLLTN*KEPTDLLKKTHKNKEIEYKKQDTFKAMDFNNK*FEAGTNNRRKTPTKGNTIIKTSKLVIFNKKKSNINIL*
Ga0075481_1026769013300006868AqueousSIPKLKLKFKKGIHSSLLTN*KELIDLLKKTHKNKEIIYKKQDTFKAIDFSNE*FEAGTNSKRKVPIKGNNMIKTNKLGTSNNNKSNINTL*
Ga0075473_1028321723300006875AqueousMPSTPRLKLKFKKGIHNSLLTNWKEPTDLLKKTHKNNETTYNKQDTFKAIDFNKK*FEEGTSNRKNVPIKGNTKTKINKFVTFNKKKSNIHIL*
Ga0102978_114879723300007177Freshwater LakeMFKKGIQNSLLTN*KEPIDLLKKTHKNKEIIYTIQEIFKATVFNIEQLEEGIHNNKKVPIKGTIKIQISKFVAFNKKRSNINIL*
Ga0102920_117010743300007600EstuarineFRKGIHQNLLTN*KEPIDLLKKTHKNRETTYEKQDIFRAIDFNNEWLEAETNNRRKTPIKGNINRITSKLVIFNKKKSNINIL*
Ga0102899_101208923300007706EstuarineMHKKINNVVKRIKKSEIPSTPKLKFKFRKGIHQNLLTN*KEPMDLLKKTHKNKEITYNKQDTFKAIDFSKE*FEEGTNNNKNVPIKGNTKTKINKFVTFNKKKFNIHIL*
Ga0102867_113935333300007716EstuarinePKLKFKFRKGIHQNLLTN*KEPIDLLKKTHKNRETTYEKQDIFRAIDFNNK*FEEGTNNKRKTPIKGNTIMNTSKLVIFNKKKSNINIL*
Ga0102951_111390723300007725WaterMFILTLVQLINIHKKINKVVKRIKNNEIPSIPILKLKFKKGIHNSLLTN*KEPTDLLKKTHKNKEITYSKQDTFNAIDFNKK*FEEGTKSKKNVPIKGNTKITINKFAAFNKKKSNIHIL
Ga0105740_107668633300007955Estuary WaterIKKSEMPSIPKLKFKFKKGIHNNLLTN*KEPTDLLKKTHKNKEIEYKKQDTFKAMDFNNK*FEAGTNNRRKTPTKGNTIINTSKLVIFNKKKSNINIL*
Ga0114348_1000091423300008115Freshwater, PlanktonMPSIPKLKFKFKKGIHNNLLTN*KEPTDLLKKTHKNKEIEYKKQDTFKAMDFNNK*FEAGTNNRRKTPTKGNTIINTSKLVIFNKKKSNINIL*
Ga0114350_1013562113300008116Freshwater, PlanktonIPSIPKLKLKFKKGIHNSLLTN*KEPMDLLKKTHKNKEITYNKQDTFKAIDFSKE*FEEGTNNNKNVPIKGKTKTKINKFVTFNKKKFNIYIL*
Ga0103733_103623213300008930Ice Edge, Mcmurdo Sound, AntarcticaMFVLTLVQLINIHKKINNVVKRMKKSDMPSIPRLKFKFKKGIHNNLLTN*KEPIELLKKNHKNKEITYKKQDVFKAISFNKE*FEVGTNNNKKVPIKGSTIRKTNKFDISNHEKFNINTL
Ga0102831_102163343300008996EstuarineVVKRIKNNEIPSIPKLKLKFKKGIHNSLLTN*KEPMDLLKKTHKNKEITYNKQDTFKAIDFSKE*FEEGTNNNKNVPIKGNTKTKINKFVTFNKKK
Ga0102811_133737433300009024EstuarineKFKKGIHNNLLTN*KEPTDLLKKTHKNREIEYKKQETFKAIDFNNK*FEAGTNNIRKTPIKGNTNINTSKLVIFKKKKSNINIL*
Ga0115005_1052043523300009432MarineMKKSEIPSIPTLKFKFEKGIHSNLLTN*KEPVDLLKKTHKNKEITYKKQDTFKARDFNNE*FDADTNNKQKVPIKGNTIMKISKLVTFNEKKSNINIL*
Ga0115008_1013265913300009436MarineMKKSEIPSIPKLKFKFKNGIHNNLFTN*KEPIDLLKKTHKNTEIIYTKQETFKAKSFKNE*LEAGTHNKKKVPTKGKIMIKTNKFVQLNKQKSNINIL*
Ga0115008_1017062113300009436MarineMKKSETPSIPKLKFKFKKGIHNNLLTN*KEPIDLLKKNHKNKETTYKKQDVFKAISFNKE*FEVGTNNNKKIPIKGNTIRKTNKFDTSNHEK
Ga0115006_1098149733300009544MarineMKKREIPSIPKLKFKFKNGIHNNLFTN*KDPMDLLKKTHKSIELKYTQQETFKAKDFNSE*LDVGTNNNNKVPAKGKIMIKINRFVTLNKKRSNINIL*
Ga0115103_140146413300009599MarineMPRVKLKFKKGIHNNLLTN*KEPIDLLKKTQKNKEATYNRQDTFKAIDFNKKEFREGTNNKKNVPIKGNIKTKINKF
Ga0115100_1046488733300009608MarineMHKKISKVVKRIKKSEMPSIPKVKFKFKKGIHNIWLTN*KEPIDLLKKTHKNKEITYDKQDTFKAIDFNNE*FEEGTNNKKKVPINGNTKINTSKLDMFNKKKSNINIL*
Ga0133913_1062267563300010885Freshwater LakeFRFKKGIHNNLLTS*KDPTDLLKKTHKNKETEYKKHDTFKAMDFSNE*FEAGTNNRKKTPIKGSTSINTSKLDIFNKKKSNINIL*
Ga0138265_102915623300012408Polar MarineMPSIPKVKFKFKKGIHNIWLTN*KEPIDLLKKTHKNKEITYDKQDTFKAIDFNNE*FEAGTNNKKKVPINGNTKINTSKLDMFNKKKSNINIL*
Ga0138265_110216453300012408Polar MarineMPSIPKLKFKFKKGIHNSLLTNWKEPIDLLKKNHKNKEITYKKQDTFKAMSFNKEWFEAGTKNSEKVPIKGSIIRKTSKFDTSNHKKFNINTL*
Ga0138266_111637553300012412Polar MarineMPSIPKLKFKFKKGIHNSLLTNWKEPIDLLKKNHRNKEITYKKQDTFKAMSFNKEWFEAGTKNSEKVPIKGSIIRKTSKFDTSNHKKFNINTL*
Ga0138259_172873733300012416Polar MarineMPSIPKVKFKFKKGIHNIWLTN*KEPIDLLKKTHKNKEITYDKQDTFKAIDFNNE*FEAGTNNKKKVPINGNTKINTSKLDMFNKKKSNIN
Ga0138292_102137413300012777Freshwater LakeMPSTPKLKFRFKKGIHNNLLTS*KDPTDLLKKTHKNKETEYKKHDTFKAMDFSNE*FEAGTNNRKKTPIKGSTSINTSK
Ga0138257_153102813300012935Polar MarineMPSIPKVKFKFKKGIHNIWLTN*KEPIDLLKKTHKNKEITYDKQDTFKAIDFNNE*FEAGTNNKKKVPINGNTKINTSKLDMFNKKK
Ga0129340_112135323300012963AqueousMFIFTLVQLINIHKKINKVVKRIKNNEIPSIPILKLKFKKGIHNSLLTN*KEPTDLLKKTHKNKESTYSKQDTFNAIDFNKK*FEEGTKSKKNVPIKGNIKIKINKFA
Ga0170791_1416939613300013295FreshwaterMPSTPKLKFRFKKGIHNNLLTS*KDPTDLLKKTHKNKETEYKKHDTFKAMDFSNE*FEAGTNNRKKTPIKGSTSINTSKLDIF
Ga0192960_10054743300018515MarineLILTLVQLIKIHRKINKVVKRIKKREIPSIPRLKLKFKKGIHNNLLTNXKELTDLLKKTHKNKEIIYIKQDAFKAINFNSEXFEAGTNNKQKILIKGNTIRKTNKFDTSNTNKSNINTL
Ga0193553_111941123300018873MarineMKKIEIPSIPILKLKFKKGIHNNLFTNXKELIDLLKKTHKNREVRYKKQDIFNAIDFSNKXFEAGLSNKKRIPIKGNNNIKTNKFEMSNNKSNIPM
Ga0192968_1000645733300018981MarineMKKSDMPSIPRLKFKFKKGIHNNLLTNXKEPIDLLKKNHKNKEITYKKQDVFKAISFNKEXFEVGTNNNKKVPIKGSTIRKTNKFDISNHEKFNINTL
Ga0192968_1005189623300018981MarineMKNKEIPSIPIVKLKFKKGIQANLLTNXKELVDLLKKTHKSRDITYKLPEIFKAIAFSSEXFQVGTKKIINVPNKGNIKIRISKFVTFNKEKSNINIL
Ga0180035_110583423300019191EstuarineMKKSEIPSIPKLKFKFKKGIHNNLLTNWKEPTDLLKKTHKNKEMMYKKQDIFKAIDFNNKXFEAGTNNKRKTPIKGNTSINTSKLVVFNKKKSNINIL
Ga0180036_109431043300019200EstuarineVVKRIKNNEIPSIPKLKLKFKKGIHNSLLTNXKEPMDLLKKTHKNKEITYNKQDTFKAIDFSKEXFEEGTNNNKNVPIKGNTKTKINKFVTFNKKKFNIHIL
Ga0180034_107984333300019207EstuarineMPSIPKLKFKFKKGIHNNLLTNXKEPTDLLKKTHKNKEIEYKKQDTFKAMDFNNKXFEAGTNNRRKTPTKGNTIINTSKLVIFNKKKSNINIL
Ga0193989_103135113300019707SedimentSDIPSIPKLKFKFKKGIHSNLLTNXKEPTDLLKKTHKNKEIIYKKQDTFKAKDFNSEXFEAGTNNKKKVPIKGNTIINISKFDMFNKKKSNINIL
Ga0193972_100104923300019717SedimentMHKKISKVVKRIKKSEMPSIPKVKFKFKKGIHNIXLTNXKEPIDLLKKTHKNREVTYDIQDTFKAMDFNNEXFEAGTNNKKKVPINGNTRINTSELDMFNKKKSNINIL
Ga0194011_100040083300019721SedimentMPSIPKVKFKFKKGIHNIXLTNXKEPIDLLKKTHKNREVTYDIQDTFKAMDFNNEXFEAGTNNKKKVPINGNTRINTSELDMFNKKKSNINIL
Ga0193971_100842813300019722SedimentMHKKISKVVKRIKKSEMPSIPKVKFKFKKGIHNMXLTNXKEPIDLLKKTHKNREVTYDIQDTFKAMDFNNEXFEAGTNNKKKVPINGNTRINTSKLDM
Ga0193968_105656113300019729SedimentKSMKKSEIPSTPKLKFKFKKGIHNNLLTNXKELIDLLKKTHKNNESTYMIQDIFKAMFFNNEQLDAGTSNKKKTPSKGNSNIKTSKLVTVGGEKSNINTL
Ga0194001_102752213300019730SedimentMHKKISKVVKRIKKSEMPSIPKVKFKFKKGIHNIXLTNXKEPIDLLKKTHKNREVTYDIQDTFKAMDFNNEXFEAGTNNKKKVPINGNTRINTSKLDMFNKKKSNINIL
Ga0193982_106036043300019731SedimentMLKFKFKKGIHNSLLTNXKEPIDLLKKTHKSNDITYVKQDTFNAIDFNNEWFEEGAHNKKKVPIKGNTVIKTNKLAIFNKKKFNINTL
Ga0193973_100024633300019737SedimentMPSIPKVKFKFKKGIHNIXLTNXKEPIDLLKKTHKNREVTYDIQDTFKAMDFNNEXFEAGTNNKKKVPINGNTRINTSKLDMFNKKKSNINIL
Ga0193973_100278513300019737SedimentEIPSIPTLKFRFKKGIHNNXSTNXKEPMDLLKKTHKNKEITYDKQDTFKVIDFNNKXLEAGTNNKKKVPIKGNTIISTNKLEMFNKKKSNINIL
Ga0211731_1169769833300020205FreshwaterMPSIPKLKFKFKKGIHNNLLTNWKEPTDLLKKTHKNKEIEYRKQDTFKAMDFNNKXFEAGTNNRRKTPTKGNTIIKTSKLVIFNKKKSNINIL
Ga0208230_1000004383300020496FreshwaterMPSIPKLKFKFKKGIHNNLLTNWKEPTDLLKKTHKNKEMEYKKQDTFKAMDFNNKXFEAGTNNRRKTPSKGNTIINTSKLVILNKKKSNINIL
Ga0210295_105015613300021323EstuarineMPSTPRLKLKFKKGIHNSLLTNWKEPTDLLKKTHKNNETTYNKQDTFKAIDFNKKXFEEGTSNRKNVPIKGNTKTKINKFVTFNKKKSNIHIL
Ga0206693_182720923300021353SeawaterMPSIPKVKFKFKKGIHNIWLTNXKEPIDLLKKTHKNKEITYDKQDTFKAIDFNNEXFEAGTNNKKKVPVNGNTKNNTEXIEFWLRMIIKELLSI
Ga0213860_1007467323300021368SeawaterMHKKISNVVKRIKNNEMPSTPTLKLRFKKGTHNILLTNXKEPLDLLKKTHKNKEITYTTQEIFKAMAFNIEMLEDGVHNSIKTPIKGNINKRISKFEVFNNKISNINIL
Ga0194117_1015936713300021424Freshwater LakeTPKLKFRFKKGIHNDLLTNWKEPTDLLKKTHKNKETEYKKQETFKAIDFNNKXFEAGTNNIRKTPIKGNTSIKTSKLVMFKKKKSNINIL
Ga0213866_1013137113300021425SeawaterRFKKGIHNNXSTNXKEPMDLLKKTHKNKEITYDKQDTFKVIDFNNKXLEAGTNNKKKVPIKGNTIISTNKLEMFNKKKSNINIL
Ga0193945_104423213300021497SedimentMHKKISKVVKRIKKSEMPSIPKVKFKFKKGIHNIXLTNXKEPIDLLKKTHKNREVTYDIQDTFKAMDFNNEXFEAGTNNKKKVPINGNTRINTSKLD
Ga0210304_101700823300021849EstuarineMPSIPKLKFKFKKGIHNNLLTNWKEPTDLLKKTHKNKEMMYKKQDIFKAIDFNNKXFEAGTNNKRKTPIKGNTSINTSKLVVFNKKKSNINIL
Ga0222717_10000527103300021957Estuarine WaterMFILTLVQLINIHKKINKVVKRIKNNEIPSIPILKLKFKKGIHNSLLTNXKEPTDLLKKTHKNKEITYSKQDTFNAIDFNKKXFEEGTKSKKNVPIKGNTKITINKFAAFNKKKSNIHIL
Ga0222717_1031355633300021957Estuarine WaterEVKRIKKSEMPSIPKVKFKFKKGIHNIWLTNXKEPIDLLKKTHKNKEITYDKQDTFKAIDFNNEXFEAGTNNKKKVPINGNTKINTSKLDMFNKKKSNINIL
Ga0222716_1004697263300021959Estuarine WaterLTLVQLIRIHKKINNVVKRTKNNEIPSIPMLKFKFKKGIHNTLFTNXKEPIDLLKKTHKNKEIMYTLHEVFKATAFNIDELEDGMSNNIKVPNKGTSKIKRSKFVGFNNKTSNIHIL
Ga0222715_1041787423300021960Estuarine WaterMFDLTLVQLINIHRKINKVVKSIKNSEIPSTPKLKLKFKKGIHNNLLTNXKEPIDLLKKTHKNKETTYNRQDTFKAIDFNKEWFEEGINNSKNVPIKGNTKTKINKFVTFNKKKSNIYIL
Ga0222715_1049950643300021960Estuarine WaterSIHKKINKVVKRRKNNDIPSTPTLKFKFRKGIHNSLLTNXKEPIDLLKKIHKNNDITYVKQDTFNAIDFNNGWFEEGTHNKRKVPTKGNTVIKTNKLDIFSKKKFNINTL
Ga0222719_1079494733300021964Estuarine WaterRIKKSEMPSIPKVKFKFKKGIHNIXLTNXKEPIDLLKKTHKNREVTYDIQDTFKAMDFNNEXFEAGTNNKKKVPINGNTRINTSELDMFNKKKSNINIL
Ga0224499_1002545313300022206SedimentMPSIPKLKFKFKKGTHHSLLTNXKEPTDLLKKTHKNNEITYKKQDTFKAIDFNKEXFEAGTNNRKKVLIIGNTIIKTSKFVT
Ga0224514_10000604133300022217SedimentMPSIPKLKFKFKKGTHHSLLTNXKEPTDLLKKTHKNNEITYKKQDTFKAIDFNKEXFEAGTNNRKKVLIIGNTIIKTSKFVTLKKKKSNINIL
Ga0224504_10000429233300022308SedimentVVKRIKKSEIPSIPTLKFRFKKGIHNNXFTNXKEPMDLLKKTHKNKEITYDKQDAFKVIDFNNRXLEAGTNNKKKVPIKGNIIISTNKLEMFNKKKSNINIL
Ga0224504_1008253043300022308SedimentMHKKISKVVKRIKKSEMPSIPKVKFKFKKGIHNIXLTNXKEPIDLLKKTHKNREVTYDIQDTFKAIDFNNEXFEAGTNNKKKVPINGNTKINISKLDMFNKKKSNINIL
Ga0210313_101345513300022375EstuarineIIKKSEMPSIPKIKFKFKKGIHNNLLTNWKEPTDLLKKTHKNKEMEYKKQDTFKAMDFNNKXFEAGTNNRRKTPTKGNTIINTSKLVIFNKKKSNINIL
(restricted) Ga0233404_1010176613300022913SeawaterMHRKINKVVKSIKNSEIPSTPKLKLKFKKGIHNNLLTNXKEPIDLLKKTHKNKETTYNRQDTFKAIDFNKEWFEEGINNSKNVPIKGNTKT
(restricted) Ga0255040_1009478623300024059SeawaterMHKKISKVVKRIKKSEMPSIPKVKFKFKKSIHNIWLTNXKEPIDLLKKTHKNKEITYDKQDTFKAINFNNEXFEAGTNNKKKVPVNSNTKNNTE
(restricted) Ga0255039_1009721933300024062SeawaterMHKKISKVVKRIKKSEMPSIPKVKLKFKKGIHNIWLTNXKEPIDLLKKTHKNKEITYDKQDTFKAIDFNNEXFEAGTNNKKKVPIKGNTIINISKFDMFNKKKSNINIL
Ga0244775_1026820553300024346EstuarineMHKKINNVVKRIKKSEIPSTPKLKFKFRKGIHQNLLTNXKEPIDLLKKTHKNKETTYEKQDTFKAIDFNNEWLEAGTNNRRKTPIKGNIKMITSKLVIFNKKKSNINIL
Ga0208428_115722213300025653AqueousIPSIPKLKLKFKKGIHSSLLTNXKELIDLLKKTHKNKEIIYKKQDTFKAIDFSNEXFEAGTNSKRKVPIKGNNMIKTNKLGTSNNNKSNINTL
Ga0209652_111753033300025684MarineMKNNEIPSIPKLKLRFKKGIHNNLLTNXKEPIDLLKNTHKNKEITYKKQEVFKAIAFNAEXFEEGTNNNKKVPIKGNTKIKINKFVTFNKKKSNINIL
Ga0209137_102991843300025767MarineMHRKINKVVKSIKNSEIPSTPKLKLKFKKGIHNNLLTNXKEPIDLLKKTHKNKETTYNRQDTFKAIDFNKEWFEEGINNSKNVPIKGNTKTKINKFVTFNKKKSNIYIL
Ga0208020_102449333300027159EstuarineSEMPSIPKLKFKFKKGIHNNLLTNWKEPTDLLKKTHKNKEMEYKKQDTFKAMDFNNKXFEAGTNNRRKTPSKGNTIINTSKLVILNKKKSNINIL
Ga0208800_104395333300027193EstuarineKFKFRKGIHQNLLTNXKEPIDLLKKTHKNKETTYEKQDTFKAIDFNNEWLEAGTNNRRKTPIKGNIKMITSKLVIFNKKKSNINIL
Ga0208163_104468233300027198EstuarineKFKKGIHNNLLTNXKEPTDLLKKTHKNREIEYKKQETFKAIDFNNKXFEAGTNNIRKTPIKGNTNINTSKLVIFKKKKSNINIL
Ga0208177_100013653300027254EstuarineMPSIPKLKFKFKKGIHSNLLTNWKEPRDLLKKTHKNKEIEYKKQDTFKAIDFNNKXFEAGTNNKKKTPIKGNTIMNTSKLVIFNKKKSNINIL
Ga0208949_101445123300027315MarineMPSIPKVKFKFKKSIHNIWLTNXKEPIDLLKKTHKNKEITYDKQDTFKAIDFNNEXFEAGTNNKKKVPINGNTKINTSKLDMFNKKKSNINIL
Ga0208965_105107033300027406MarineMHKKISKVVKRIKKSEMPSIPKVKFKFKKGIHNIWLTNXKEPIDLLKKTHKNKEITYDKQDTFKAIDFNNEXFEAGTNNKKKVPINGNTKINTSKLDMFNKKKSNINIL
Ga0208948_102231013300027501MarineMHKKISKVVKRIKKSEMPSIPKVKFKFKKGIHNIWLTNXKEPIDLLKKTHKNKEITYDKQDTFKAIDFNNEXFEAGTNNKKKVPINGNTKINTSKLDMFN
Ga0208947_102638013300027553MarineRVVKRIKKSEMPSIPKVKFKFKKGIHNIWLTNXKEPIDLLKKTHKNKEITYDKQDTFKAIDFNNEXFEAGTNNKKKVPINGNTKINTSKLDMFNKKKSNINIL
Ga0208305_1010161543300027753EstuarineKRIKNNEIPSIPKLKLKFKKGIHNSLLTNXKEPMDLLKKTHKNKEITYNKQDTFKAIDFSKEXFEEGTNNNKNVPIKGNTKTKINKFVTFNKKKFNIHIL
Ga0208305_1025280113300027753EstuarineIKKSEIPSTPKLKFKFRKGIHQNLLTNXKEPIDLLKKTHKNRETTYEKQDIFRAIDFNNEWLEAETNNRRKTPIKGNINRITSKLVIFNKKKSNINIL
Ga0208671_1004385153300027757EstuarineMHKKINNVVKRIKKSEIPSTPKLKFKFRKGIHQNLLTNXKEPIDLLKKTHKNRETTYEKQDIFRAIDFNNEWLEAETNNRRKTPIKGNINRITSKLVIFNKKKSNINIL
Ga0209985_1005351243300027806Freshwater LakeMPSIPKLKFKFKKGIHNNLLTNWKEPTDLLKKTHKNKEMEYKKQDTFKAMDFNNKXFEAGTNNRRKTPTKGNTIINTSKLVIFNKKKSNINIL
Ga0209092_1004936933300027833MarineMKKSEIPSIPKLKFKFKNGIHNNLFTNXKEPIDLLKKTHKNTEIIYTKQETFKAKSFKNEXLEAGTHNKKKVPTKGKIMIKTNKFVQLNKQKSNINIL
Ga0209230_1014229743300027836Freshwater And SedimentKFKFKKGIHNNLLTNXKEPTDLLKKTHKNKEIEYKKQDTFKAMDFNNKXFEAGTNNRRKTPTKGNTIINTSKLVIFNKKKSNINIL
Ga0210315_101928433300028329EstuarineGIHDDLLTNXKEPTDLLKKTHKNKEIEYKKQETFKAIDFNNKXFEAGTNNIRKTPIKGNTSIKTSKLVMFKKKKSNINIL
Ga0315908_1017786743300031786FreshwaterMKNNEMPSIPKLKLRFKKGIHNNLLTNWKEPIDLLKNTHKNKEITYKKQEVFKAIAFNAEXFEEGTNNNKKVPIKGNTKIRINKFVTFNKKKSNINIL
Ga0315316_1149418513300032011SeawaterMPSIPKVKFKFKKGIHNIWLTNXKEPIDLLKKTHKNKEITYDKQDTFKAINFNNEXFEAGTNNKKKVPVNGNTKNNTEXIEFWLRMIIKEL
Ga0335035_0712117_276_5123300034105FreshwaterMPSIPKLKFKFKKGIHNNLLTNWKEPTDLLKKTHKNKEIEYKKQDTFKAMDFNNKWFEAGTNNRRKTPTKGNTIINTSK


 ⦗Top⦘


© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.