NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome Family F082588

Metagenome Family F082588

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F082588
Family Type Metagenome
Number of Sequences 113
Average Sequence Length 44 residues
Representative Sequence MDLVAFQYDRSFVLDALRNGEIDYLEHVSEAAEADLFRHLIRRQ
Number of Associated Samples 104
Number of Associated Scaffolds 113

Quality Assessment
Transcriptomic Evidence No
Most common taxonomic group Bacteria
% of genes with valid RBS motifs 84.96 %
% of genes near scaffold ends (potentially truncated) 96.46 %
% of genes from short scaffolds (< 2000 bps) 96.46 %
Associated GOLD sequencing projects 101
AlphaFold2 3D model prediction Yes
3D model pTM-score0.34

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Bacteria (99.115 % of family members)
NCBI Taxonomy ID 2
Taxonomy All Organisms → cellular organisms → Bacteria

Most Common Ecosystem
GOLD Ecosystem Environmental → Aquatic → Freshwater → Lake → Sediment → Sediment
(12.389 % of family members)
Environment Ontology (ENVO) Unclassified
(23.894 % of family members)
Earth Microbiome Project Ontology (EMPO) Free-living → Non-saline → Soil (non-saline)
(31.858 % of family members)


 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      

 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Globular Signal Peptide: No Secondary Structure distribution: α-helix: 47.22%    β-sheet: 0.00%    Coil/Unstructured: 52.78%
Feature Viewer
Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer
Per-residue confidence (pLDDT):
  0-50   51-70   71-90   91-100  		pTM-score: 0.34
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.

 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 113 Family Scaffolds
PF01609DDE_Tnp_1 1.77
PF13619KTSC 1.77
PF13620CarboxypepD_reg 0.88
PF13701DDE_Tnp_1_4 0.88
PF03631Virul_fac_BrkB 0.88
PF08388GIIM 0.88
PF12802MarR_2 0.88
PF07676PD40 0.88
PF13358DDE_3 0.88
PF06271RDD 0.88
PF13411MerR_1 0.88
PF07592DDE_Tnp_ISAZ013 0.88

Neighboring Clusters of Orthologous Genes (COGs)

COG IDNameFunctional Category % Frequency in 113 Family Scaffolds
COG3039Transposase and inactivated derivatives, IS5 familyMobilome: prophages, transposons [X] 1.77
COG3293TransposaseMobilome: prophages, transposons [X] 1.77
COG3385IS4 transposase InsGMobilome: prophages, transposons [X] 1.77
COG5421TransposaseMobilome: prophages, transposons [X] 1.77
COG5433Predicted transposase YbfD/YdcC associated with H repeatsMobilome: prophages, transposons [X] 1.77
COG5659SRSO17 transposaseMobilome: prophages, transposons [X] 1.77
COG1295Uncharacterized membrane protein, BrkB/YihY/UPF0761 family (not an RNase)Function unknown [S] 0.88
COG1714Uncharacterized membrane protein YckC, RDD familyFunction unknown [S] 0.88

 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms99.12 %
UnclassifiedrootN/A0.88 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
2140918007|ConsensusfromContig125499All Organisms → cellular organisms → Bacteria849Open in IMG/M
3300005164|Ga0066815_10043871All Organisms → cellular organisms → Bacteria717Open in IMG/M
3300005181|Ga0066678_10804593All Organisms → cellular organisms → Bacteria621Open in IMG/M
3300005186|Ga0066676_10614803All Organisms → cellular organisms → Bacteria737Open in IMG/M
3300005555|Ga0066692_10910408All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium539Open in IMG/M
3300005556|Ga0066707_10806894All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium580Open in IMG/M
3300005598|Ga0066706_10373845All Organisms → cellular organisms → Bacteria1133Open in IMG/M
3300005947|Ga0066794_10120488All Organisms → cellular organisms → Bacteria786Open in IMG/M
3300006640|Ga0075527_10109149All Organisms → cellular organisms → Bacteria768Open in IMG/M
3300006755|Ga0079222_10507893All Organisms → cellular organisms → Bacteria886Open in IMG/M
3300006796|Ga0066665_11538897All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium521Open in IMG/M
3300006845|Ga0075421_101032339All Organisms → cellular organisms → Bacteria928Open in IMG/M
3300006864|Ga0066797_1365301All Organisms → cellular organisms → Bacteria506Open in IMG/M
3300009012|Ga0066710_101426923All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1072Open in IMG/M
3300009039|Ga0105152_10498534All Organisms → cellular organisms → Bacteria519Open in IMG/M
3300009053|Ga0105095_10328151All Organisms → cellular organisms → Bacteria842Open in IMG/M
3300009089|Ga0099828_11126413All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium697Open in IMG/M
3300009091|Ga0102851_10937803All Organisms → cellular organisms → Bacteria937Open in IMG/M
3300009137|Ga0066709_101582029All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium940Open in IMG/M
3300009162|Ga0075423_10440321All Organisms → cellular organisms → Bacteria → Acidobacteria1369Open in IMG/M
3300009169|Ga0105097_10109597All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → unclassified Terriglobales → Terriglobales bacterium1511Open in IMG/M
3300009523|Ga0116221_1112623All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1197Open in IMG/M
3300009548|Ga0116107_1077028All Organisms → cellular organisms → Bacteria1045Open in IMG/M
3300009629|Ga0116119_1116124All Organisms → cellular organisms → Bacteria670Open in IMG/M
3300009630|Ga0116114_1132181All Organisms → cellular organisms → Bacteria646Open in IMG/M
3300009634|Ga0116124_1217642All Organisms → cellular organisms → Bacteria530Open in IMG/M
3300009672|Ga0116215_1503652All Organisms → cellular organisms → Bacteria524Open in IMG/M
3300009700|Ga0116217_10422368All Organisms → cellular organisms → Bacteria844Open in IMG/M
3300009760|Ga0116131_1213551All Organisms → cellular organisms → Bacteria536Open in IMG/M
3300009762|Ga0116130_1273257All Organisms → cellular organisms → Bacteria539Open in IMG/M
3300009821|Ga0105064_1049803All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium807Open in IMG/M
3300009824|Ga0116219_10766921All Organisms → cellular organisms → Bacteria526Open in IMG/M
3300010304|Ga0134088_10639986All Organisms → cellular organisms → Bacteria531Open in IMG/M
3300010391|Ga0136847_10786809All Organisms → cellular organisms → Bacteria707Open in IMG/M
3300011118|Ga0114922_10839469All Organisms → cellular organisms → Bacteria750Open in IMG/M
3300012171|Ga0137342_1066902All Organisms → cellular organisms → Bacteria744Open in IMG/M
3300012207|Ga0137381_11095999All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium685Open in IMG/M
3300012355|Ga0137369_10483875All Organisms → cellular organisms → Bacteria877Open in IMG/M
3300012363|Ga0137390_10848798All Organisms → cellular organisms → Bacteria870Open in IMG/M
3300012930|Ga0137407_11506059All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium640Open in IMG/M
3300012930|Ga0137407_11864323All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium573Open in IMG/M
3300014155|Ga0181524_10462665Not Available544Open in IMG/M
3300014502|Ga0182021_10122650All Organisms → cellular organisms → Bacteria3019Open in IMG/M
3300014502|Ga0182021_11441806All Organisms → cellular organisms → Bacteria829Open in IMG/M
3300014839|Ga0182027_10428829All Organisms → cellular organisms → Bacteria1461Open in IMG/M
3300014839|Ga0182027_10869746All Organisms → cellular organisms → Bacteria936Open in IMG/M
3300014875|Ga0180083_1113153All Organisms → cellular organisms → Bacteria597Open in IMG/M
3300016341|Ga0182035_10625253All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium932Open in IMG/M
3300016422|Ga0182039_11254131All Organisms → cellular organisms → Bacteria671Open in IMG/M
3300017924|Ga0187820_1314213All Organisms → cellular organisms → Bacteria518Open in IMG/M
3300017943|Ga0187819_10355871All Organisms → cellular organisms → Bacteria845Open in IMG/M
3300017994|Ga0187822_10233078All Organisms → cellular organisms → Bacteria626Open in IMG/M
3300018006|Ga0187804_10399966All Organisms → cellular organisms → Bacteria608Open in IMG/M
3300018016|Ga0187880_1210363All Organisms → cellular organisms → Bacteria877Open in IMG/M
3300018021|Ga0187882_1103085All Organisms → cellular organisms → Bacteria1215Open in IMG/M
3300018022|Ga0187864_10168295All Organisms → cellular organisms → Bacteria1066Open in IMG/M
3300018022|Ga0187864_10286816All Organisms → cellular organisms → Bacteria740Open in IMG/M
3300018023|Ga0187889_10127707All Organisms → cellular organisms → Bacteria1227Open in IMG/M
3300018054|Ga0184621_10096199All Organisms → cellular organisms → Bacteria1043Open in IMG/M
3300018057|Ga0187858_10396983All Organisms → cellular organisms → Bacteria858Open in IMG/M
3300018068|Ga0184636_1319011All Organisms → cellular organisms → Bacteria545Open in IMG/M
3300018085|Ga0187772_10515681All Organisms → cellular organisms → Bacteria844Open in IMG/M
3300018090|Ga0187770_10523167All Organisms → cellular organisms → Bacteria939Open in IMG/M
3300018090|Ga0187770_10992068All Organisms → cellular organisms → Bacteria675Open in IMG/M
3300019785|Ga0182022_1010151All Organisms → cellular organisms → Bacteria781Open in IMG/M
3300021086|Ga0179596_10257883All Organisms → cellular organisms → Bacteria862Open in IMG/M
3300021086|Ga0179596_10528637All Organisms → cellular organisms → Bacteria598Open in IMG/M
3300025409|Ga0208321_1038461All Organisms → cellular organisms → Bacteria766Open in IMG/M
3300025500|Ga0208686_1068923All Organisms → cellular organisms → Bacteria791Open in IMG/M
3300025836|Ga0209748_1049829All Organisms → cellular organisms → Bacteria1740Open in IMG/M
3300025843|Ga0209182_10202772All Organisms → cellular organisms → Bacteria556Open in IMG/M
3300025854|Ga0209176_10075848All Organisms → cellular organisms → Bacteria774Open in IMG/M
3300026007|Ga0210124_1142052All Organisms → cellular organisms → Bacteria764Open in IMG/M
3300026497|Ga0257164_1019498All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium952Open in IMG/M
3300026557|Ga0179587_10736467All Organisms → cellular organisms → Bacteria650Open in IMG/M
3300026959|Ga0207852_1024001All Organisms → cellular organisms → Bacteria629Open in IMG/M
3300027605|Ga0209329_1013740All Organisms → cellular organisms → Bacteria → Proteobacteria1575Open in IMG/M
(restricted) 3300027799|Ga0233416_10301703All Organisms → cellular organisms → Bacteria551Open in IMG/M
3300027842|Ga0209580_10022587All Organisms → cellular organisms → Bacteria2810Open in IMG/M
3300027882|Ga0209590_10917421All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium550Open in IMG/M
(restricted) 3300027995|Ga0233418_10303551All Organisms → cellular organisms → Bacteria557Open in IMG/M
3300031232|Ga0302323_102835408All Organisms → cellular organisms → Bacteria554Open in IMG/M
3300031545|Ga0318541_10609938All Organisms → cellular organisms → Bacteria610Open in IMG/M
3300031713|Ga0318496_10792845All Organisms → cellular organisms → Bacteria522Open in IMG/M
3300031746|Ga0315293_11149763All Organisms → cellular organisms → Bacteria542Open in IMG/M
3300031746|Ga0315293_11240438All Organisms → cellular organisms → Bacteria516Open in IMG/M
3300031765|Ga0318554_10768059All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → unclassified Terriglobales → Terriglobales bacterium539Open in IMG/M
3300031772|Ga0315288_11322621All Organisms → cellular organisms → Bacteria610Open in IMG/M
3300031819|Ga0318568_10510830All Organisms → cellular organisms → Bacteria749Open in IMG/M
3300031833|Ga0310917_10043296All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium2730Open in IMG/M
3300031834|Ga0315290_10875789All Organisms → cellular organisms → Bacteria763Open in IMG/M
3300031860|Ga0318495_10232860All Organisms → cellular organisms → Bacteria826Open in IMG/M
3300031879|Ga0306919_10159658All Organisms → cellular organisms → Bacteria → Acidobacteria1651Open in IMG/M
3300032046|Ga0315289_10654231All Organisms → cellular organisms → Bacteria964Open in IMG/M
3300032052|Ga0318506_10418661All Organisms → cellular organisms → Bacteria594Open in IMG/M
3300032052|Ga0318506_10418764All Organisms → cellular organisms → Bacteria594Open in IMG/M
3300032053|Ga0315284_12257857All Organisms → cellular organisms → Bacteria540Open in IMG/M
3300032069|Ga0315282_10593084All Organisms → cellular organisms → Bacteria601Open in IMG/M
3300032089|Ga0318525_10321870All Organisms → cellular organisms → Bacteria794Open in IMG/M
3300032118|Ga0315277_10986266All Organisms → cellular organisms → Bacteria771Open in IMG/M
3300032143|Ga0315292_11223896All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium617Open in IMG/M
3300032143|Ga0315292_11593133All Organisms → cellular organisms → Bacteria526Open in IMG/M
3300032275|Ga0315270_10526657All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium764Open in IMG/M
3300032397|Ga0315287_10960780All Organisms → cellular organisms → Bacteria997Open in IMG/M
3300032955|Ga0335076_10107929All Organisms → cellular organisms → Bacteria2711Open in IMG/M
3300033414|Ga0316619_11784046All Organisms → cellular organisms → Bacteria557Open in IMG/M
3300033418|Ga0316625_101786301All Organisms → cellular organisms → Bacteria596Open in IMG/M
3300033557|Ga0316617_100604820All Organisms → cellular organisms → Bacteria1018Open in IMG/M
3300033813|Ga0364928_0088670All Organisms → cellular organisms → Bacteria719Open in IMG/M
3300033820|Ga0334817_060979All Organisms → cellular organisms → Bacteria734Open in IMG/M
3300034125|Ga0370484_0022553All Organisms → cellular organisms → Bacteria1455Open in IMG/M
3300034191|Ga0373909_0279512All Organisms → cellular organisms → Bacteria538Open in IMG/M
3300034419|Ga0373914_0167022All Organisms → cellular organisms → Bacteria567Open in IMG/M

Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).


 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
SedimentEnvironmental → Aquatic → Freshwater → Lake → Sediment → Sediment12.39%
Vadose Zone SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil8.85%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil8.85%
PeatlandEnvironmental → Aquatic → Freshwater → Wetlands → Unclassified → Peatland7.08%
PeatlandEnvironmental → Aquatic → Freshwater → Wetlands → Bog → Peatland5.31%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Soil5.31%
FenEnvironmental → Terrestrial → Soil → Wetlands → Permafrost → Fen4.42%
Freshwater SedimentEnvironmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment3.54%
Peatlands SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil3.54%
SoilEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Soil3.54%
Arctic Peat SoilEnvironmental → Terrestrial → Soil → Unclassified → Permafrost → Arctic Peat Soil2.65%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil2.65%
Tropical PeatlandEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland2.65%
Freshwater SedimentEnvironmental → Aquatic → Freshwater → Sediment → Unclassified → Freshwater Sediment1.77%
Lake SedimentEnvironmental → Aquatic → Freshwater → Lake → Sediment → Lake Sediment1.77%
SoilEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Soil1.77%
Groundwater SedimentEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment1.77%
Grasslands SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil1.77%
SoilEnvironmental → Terrestrial → Soil → Wetlands → Permafrost → Soil1.77%
Populus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere1.77%
Sediment SlurryEngineered → Bioremediation → Metal → Unclassified → Unclassified → Sediment Slurry1.77%
Freshwater SedimentEnvironmental → Aquatic → Freshwater → Lake → Sediment → Freshwater Sediment0.89%
BogEnvironmental → Aquatic → Freshwater → Wetlands → Bog → Bog0.89%
Freshwater WetlandsEnvironmental → Aquatic → Freshwater → Wetlands → Unclassified → Freshwater Wetlands0.89%
Deep SubsurfaceEnvironmental → Aquatic → Marine → Oceanic → Sediment → Deep Subsurface0.89%
Natural And Restored WetlandsEnvironmental → Aquatic → Marine → Wetlands → Unclassified → Natural And Restored Wetlands0.89%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil0.89%
Grasslands SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil0.89%
Surface SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil0.89%
Agricultural SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil0.89%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Permafrost → Soil0.89%
Untreated Peat SoilEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Untreated Peat Soil0.89%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil0.89%
Forest SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil0.89%
Groundwater SandEnvironmental → Terrestrial → Soil → Sand → Unclassified → Groundwater Sand0.89%
SoilEnvironmental → Terrestrial → Peat → Unclassified → Unclassified → Soil0.89%
FenEnvironmental → Terrestrial → Peat → Unclassified → Unclassified → Fen0.89%
SedimentEnvironmental → Terrestrial → Floodplain → Sediment → Unclassified → Sediment0.89%

Visualization
Powered by ApexCharts



Associated Samples

Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).

Taxon OIDSample NameHabitat TypeIMG/M Link
2140918007Permafrost microbial communities from permafrost in Bonanza Creek, Alaska - Active_allEnvironmentalOpen in IMG/M
3300005164Soil and rhizosphere microbial communities from Laval, Canada - mgLACEnvironmentalOpen in IMG/M
3300005181Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_127EnvironmentalOpen in IMG/M
3300005186Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_125EnvironmentalOpen in IMG/M
3300005555Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_141EnvironmentalOpen in IMG/M
3300005556Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_156EnvironmentalOpen in IMG/M
3300005598Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_155EnvironmentalOpen in IMG/M
3300005947Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Permafrost soil replicate 2 DNA2013-190EnvironmentalOpen in IMG/M
3300006640Arctic peat soil microbial communities from the Barrow Environmental Observatory site, Barrow, Alaska, USA - NGEE Permafrost305-11BEnvironmentalOpen in IMG/M
3300006755Agricultural soil microbial communities from Georgia to study Nitrogen management - GA PlitterEnvironmentalOpen in IMG/M
3300006796Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_114EnvironmentalOpen in IMG/M
3300006845Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD5Host-AssociatedOpen in IMG/M
3300006864Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Permafrost soil replicate 3 DNA2013-193EnvironmentalOpen in IMG/M
3300009012Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_159EnvironmentalOpen in IMG/M
3300009039Lake sediment microbial communities from Lake Baikal, Russia to study Microbial Dark Matter (Phase II) - Lake Baikal sediment 0-5 cmEnvironmentalOpen in IMG/M
3300009053Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P8 Core (3) Depth 19-21cm March2015EnvironmentalOpen in IMG/M
3300009089Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H1.8 metaGEnvironmentalOpen in IMG/M
3300009091Freshwater wetland microbial communities from Ohio, USA, analyzing the effect of biotic and abiotic controls - Mud 3 Core 4 Depth 3 metaG (Illumina Assembly)EnvironmentalOpen in IMG/M
3300009137Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_158EnvironmentalOpen in IMG/M
3300009162Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD2Host-AssociatedOpen in IMG/M
3300009169Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (1) Depth 10-12cm May2015EnvironmentalOpen in IMG/M
3300009523Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_8_FC metaGEnvironmentalOpen in IMG/M
3300009548Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_6_100EnvironmentalOpen in IMG/M
3300009629Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_11_100EnvironmentalOpen in IMG/M
3300009630Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_10_40EnvironmentalOpen in IMG/M
3300009634Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_13_150EnvironmentalOpen in IMG/M
3300009672Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_2_FS metaGEnvironmentalOpen in IMG/M
3300009700Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_4_PS metaGEnvironmentalOpen in IMG/M
3300009760Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_17_100EnvironmentalOpen in IMG/M
3300009762Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_17_40EnvironmentalOpen in IMG/M
3300009821Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW S1_20_30EnvironmentalOpen in IMG/M
3300009824Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_6_BS metaGEnvironmentalOpen in IMG/M
3300010304Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_5_09182015EnvironmentalOpen in IMG/M
3300010391Freshwater sediment microbial communities from Lake Superior, USA - Station SU-17. Combined Assembly of Gp0155404, Gp0155335, Gp0155336, Gp0155336, Gp0155403, Gp0155406EnvironmentalOpen in IMG/M
3300011118Deep subsurface microbial communities from Aarhus Bay to uncover new lineages of life (NeLLi) - Aarhus_00045 metaGEnvironmentalOpen in IMG/M
3300012171Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMLT466_2EnvironmentalOpen in IMG/M
3300012207Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_115_16 metaGEnvironmentalOpen in IMG/M
3300012355Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_113_16 metaGEnvironmentalOpen in IMG/M
3300012363Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h2.4A metaGEnvironmentalOpen in IMG/M
3300012930Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_2_16fungal (Illumina Assembly)EnvironmentalOpen in IMG/M
3300014155Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin05_60_metaGEnvironmentalOpen in IMG/M
3300014502Permafrost microbial communities from Stordalen Mire, Sweden - 612E3M metaG (Illumina Assembly)EnvironmentalOpen in IMG/M
3300014839Permafrost microbial communities from Stordalen Mire, Sweden - 712E1D metaG (Illumina Assembly)EnvironmentalOpen in IMG/M
3300014875Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River metaG ERMLT660_1_16_10DEnvironmentalOpen in IMG/M
3300016341Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170EnvironmentalOpen in IMG/M
3300016422Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.111EnvironmentalOpen in IMG/M
3300017924Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_5EnvironmentalOpen in IMG/M
3300017943Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_4EnvironmentalOpen in IMG/M
3300017994Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SourceSoil_2EnvironmentalOpen in IMG/M
3300018006Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - Control_4EnvironmentalOpen in IMG/M
3300018016Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_19_40EnvironmentalOpen in IMG/M
3300018021Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_19_150EnvironmentalOpen in IMG/M
3300018022Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_11_40EnvironmentalOpen in IMG/M
3300018023Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_7_100EnvironmentalOpen in IMG/M
3300018054Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_30_b1EnvironmentalOpen in IMG/M
3300018057Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_8_150EnvironmentalOpen in IMG/M
3300018068Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM4_90_b2EnvironmentalOpen in IMG/M
3300018085Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP15_20_MGEnvironmentalOpen in IMG/M
3300018090Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP02_20_MGEnvironmentalOpen in IMG/M
3300019785Permafrost microbial communities from Stordalen Mire, Sweden - 612E3M metaG (PacBio error correction)EnvironmentalOpen in IMG/M
3300021086Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug1_1_08_16fungal (Illumina Assembly)EnvironmentalOpen in IMG/M
3300025409Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_4_150 (SPAdes)EnvironmentalOpen in IMG/M
3300025500Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_6_40 (SPAdes)EnvironmentalOpen in IMG/M
3300025836Arctic peat soil from Barrow, Alaska - Barrow Graham LP Incubations 004-21A (SPAdes)EnvironmentalOpen in IMG/M
3300025843Lake sediment microbial communities from Lake Baikal, Russia to study Microbial Dark Matter (Phase II) - Lake Baikal sediment 0-5 cm (SPAdes)EnvironmentalOpen in IMG/M
3300025854Arctic peat soil microbial communities from the Barrow Environmental Observatory site, Barrow, Alaska, USA - NGEE Permafrost305-11B (SPAdes)EnvironmentalOpen in IMG/M
3300026007Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - Muzzi_PWC_D2 (SPAdes)EnvironmentalOpen in IMG/M
3300026497Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - CO-08-BEnvironmentalOpen in IMG/M
3300026557Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_08_16fungalEnvironmentalOpen in IMG/M
3300026959Tropical forest soil microbial communities from Luquillo Experimental Forest, Puerto Rico - Sample 3 (SPAdes)EnvironmentalOpen in IMG/M
3300027605Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_Ref_M3 (SPAdes)EnvironmentalOpen in IMG/M
3300027799 (restricted)Sediment microbial communities from Lake Towuti, South Sulawesi, Indonesia - Sediment_Towuti_2014_0_MGEnvironmentalOpen in IMG/M
3300027842Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen04_05102014_R1 (SPAdes)EnvironmentalOpen in IMG/M
3300027882Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con1.8 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300027995 (restricted)Sediment microbial communities from Lake Towuti, South Sulawesi, Indonesia - Sediment_Towuti_2014_1_MGEnvironmentalOpen in IMG/M
3300031232Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Fen_T0_3EnvironmentalOpen in IMG/M
3300031545Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.166b4f26EnvironmentalOpen in IMG/M
3300031713Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.109b1f22EnvironmentalOpen in IMG/M
3300031746Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G13_20EnvironmentalOpen in IMG/M
3300031765Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f22EnvironmentalOpen in IMG/M
3300031772Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G11_20EnvironmentalOpen in IMG/M
3300031819Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.088b5f21EnvironmentalOpen in IMG/M
3300031833Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.LF178EnvironmentalOpen in IMG/M
3300031834Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G12_0EnvironmentalOpen in IMG/M
3300031860Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.108b1f25EnvironmentalOpen in IMG/M
3300031879Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.172 (v2)EnvironmentalOpen in IMG/M
3300032046Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G11_40EnvironmentalOpen in IMG/M
3300032052Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.084b2f19EnvironmentalOpen in IMG/M
3300032053Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G09_16EnvironmentalOpen in IMG/M
3300032069Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G07_20EnvironmentalOpen in IMG/M
3300032089Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.052b4f23EnvironmentalOpen in IMG/M
3300032118Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G05_15EnvironmentalOpen in IMG/M
3300032143Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G13_0EnvironmentalOpen in IMG/M
3300032275Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - C1_bottomEnvironmentalOpen in IMG/M
3300032397Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G11_0EnvironmentalOpen in IMG/M
3300032955Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_2.5EnvironmentalOpen in IMG/M
3300033414Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_Aug_M1_C1_D4_BEnvironmentalOpen in IMG/M
3300033418Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_Aug_T1_C1_D1_AEnvironmentalOpen in IMG/M
3300033557Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_Aug_M1_C1_D2_BEnvironmentalOpen in IMG/M
3300033813Sediment microbial communities from East River floodplain, Colorado, United States - 30_j17EnvironmentalOpen in IMG/M
3300033820Peat soil microbial communities from Stordalen Mire, Sweden - 713 E-2-DEnvironmentalOpen in IMG/M
3300034125Peat soil microbial communities from wetlands in Alaska, United States - Sheep_creek_tus_01_15EnvironmentalOpen in IMG/M
3300034191Uranium-contaminated sediment microbial communities from bioreactor in Oak Ridge, Tennessee, United States - B4A4.1EngineeredOpen in IMG/M
3300034419Uranium-contaminated sediment microbial communities from bioreactor in Oak Ridge, Tennessee, United States - B5A4.3EngineeredOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap


 ⦗Top⦘

Family Sequences

Note: Some of these sequences are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).

Protein ID Sample Taxon ID Habitat Sequence
A_all_C_015748302140918007SoilMDLISFQYDRSFVLEALRQGDIDYLEHVSEAAEADLFRH
Ga0066815_1004387123300005164SoilMDLAAFQYDRSFVLDALRHGNLDYLEHVSEAAEADLFRHLIRR
Ga0066678_1080459323300005181SoilVDLLAFQYDRSFVLDALRQGEIDCLEHVSEAAEADLFRHLIRRQVIQ
Ga0066676_1061480323300005186SoilMDLISFPYDRSFVLEALRHGDIDYLEPVSEAAEADLFRHL
Ga0066692_1091040813300005555SoilMDLVAFENDRKFVLEGLRQGQVDYVEHVSEAAEADLFRHLV
Ga0066707_1080689413300005556SoilMDFAAFEYDRTFVIEALRRGAIDYLENISEAEEADLFRHLLGRDVWERLAEHYPTP
Ga0066706_1037384533300005598SoilMDLLGFQYDRSFVLAALRQGNIDYLEHVSEAAEADLFRHLIRRQ
Ga0066794_1012048833300005947SoilMDLVAFHFDRSFVLDALRQGEIDYLEHVSEAAEADLFRHLIGRQ
Ga0075527_1010914923300006640Arctic Peat SoilMDLVAFHFDRSFVLEALRQGEIDYLEHVSEAAEADLFRH
Ga0079222_1050789323300006755Agricultural SoilMDLISFHYDRSFALEALRNGDIDYLEHVSEAAEADLFRHL
Ga0066665_1153889713300006796SoilMDFVAFEHDRPLVIEALRRGEVDYLEHVSEAAEAD
Ga0075421_10103233923300006845Populus RhizosphereMHLVTFQYDRSFVLEALRQGNIDYLEHVSEAAEADLFRHLFRRQVI
Ga0066797_136530113300006864SoilMDLVAFHYDRSFVLDALRQGEIDYLEHVSEAAEADLFRHLIGRQ
Ga0066710_10142692323300009012Grasslands SoilMDFDAFEYDRKFVIEALRCGEIDYLENVSEAEEADLFRHLLGRDVLERLAEHYP
Ga0105152_1049853413300009039Lake SedimentMNAILFDHDRPFVIDALRRGEVDYLENVGQAVEAD
Ga0105095_1032815123300009053Freshwater SedimentMDLISFQYDRSFVLNALRNGDIDYLEHVSEAAEADLFRHLI
Ga0099828_1112641323300009089Vadose Zone SoilMDLAAFEHDRQFVIEALRRGEIDYLENVSEAAEADLFRHL
Ga0102851_1093780313300009091Freshwater WetlandsMDLIAFQYDRSLVLEALRRGEIDYLENVSEAAEADFCRHLIRRDV
Ga0066709_10158202933300009137Grasslands SoilMDLAAFELDRQFVIDALYRGQIHFLENVSQAAEADFFRHLIGR
Ga0075423_1044032133300009162Populus RhizosphereMDLIAFQYDRSFVLEALRRGEIDCLEHVSEAAEADLFRHLIRRQVIQRLAETFP*
Ga0105097_1010959713300009169Freshwater SedimentTLMDLVAFQYDRSFVLDALRRGEIDYLENVSEAA*
Ga0116221_111262313300009523Peatlands SoilMDLAAFEHDRKFVIEALRRGEIDYLENVSEAAEADLFRHLLGRDVL
Ga0116107_107702813300009548PeatlandMDLVAFHYDRAFVLDALHQGEIDYLEHVSEAAEADLF
Ga0116119_111612423300009629PeatlandVNLTVFEHDRPFVIGDLRRGEGDYLENVSEAAEANLCRH
Ga0116114_113218123300009630PeatlandVNLTVFEHDRPFVIDALRRGEVDYLENVSEAAEANLFRHLIDRRVL
Ga0116124_121764213300009634PeatlandVNLTLFEHDRQFVIDALRRGELDYLENVSEAAEANLFRHLIDRRVLQRLAESYPSP
Ga0116215_150365213300009672Peatlands SoilVNLTVFEHDRQFGIAALRRGEVDYRENVSEAAEANWFRHLIDRRV
Ga0116217_1042236823300009700Peatlands SoilVNLTVFEHDRPFVIEALRQGEVDYLENVSEAAEANLFRHLIDRRVLERLAESYPSP
Ga0116131_121355123300009760PeatlandMVNLTVFEHDRPFVIEALRRGEVDYLENVSEAAEANLFRHPIDRRVLARLAE
Ga0116130_127325723300009762PeatlandVNLTVFEHDRPFVIEALRRGEVDYLENVSEAAEANLFRHLID
Ga0105064_104980333300009821Groundwater SandMAFVAFEHDRPFVIDALRHGEVDYLESVTEAAEADLFRHLISRDV
Ga0116219_1076692113300009824Peatlands SoilVNLTVFEHDRQFVIEALRQGEVDYLENVSEAAEANLFRHLIDRRVLERLAESYPS
Ga0134088_1063998623300010304Grasslands SoilMDLVSFQYDRSFVLEALRQGDVDYLEHVSEAAEADWFRHLIRRQVIQRLA
Ga0136847_1078680923300010391Freshwater SedimentMDLVAFHYNRSFVLEALRHGEIDYGEHVCEAAEADLFRHLLRR
Ga0114922_1083946913300011118Deep SubsurfaceMDLLAFEHDRGFVVKALRRGEIDYLEPVTEAVEAD
Ga0137342_106690223300012171SoilMDLVAFHYDRSFVLDALRQGEIDYLEQVSEAAEADLFR
Ga0137381_1109599913300012207Vadose Zone SoilMDFVAFENDRKFVLEGLRHGEVDYVESVSEAAEADL
Ga0137369_1048387523300012355Vadose Zone SoilMDLVSFQYDRSFVLEALRQGDIDYLEHVSEAAEADLFRHLIRR
Ga0137390_1084879823300012363Vadose Zone SoilMDLISFQHDRSFVLDALRQGDVDYLEHVSEAAEADLFRHL
Ga0137407_1150605923300012930Vadose Zone SoilMDFVAFENDRKFVLEGLRRGEVDYVEHVSEAAEADLFRHLI
Ga0137407_1186432313300012930Vadose Zone SoilMDWVAFENDRQFVLEGLRRGEVDYVEHVSEAAEADLFR
Ga0181524_1046266533300014155BogVNLTVFEHDRQFVIEALRRGELDCLENVSEAAEASLFRHLLDRRVLERLAESYP
Ga0182021_1012265033300014502FenMVNLTVFEHDRPFVIEALHRGEVDYLENVSEAAEANLFRHLTDRQV
Ga0182021_1144180623300014502FenVNLTVFEHDRQFVIAALRRGEVDYLENVSEAAEANL
Ga0182027_1042882913300014839FenVNLTVFEHDRPFVIEALRRGEVDYLENVSEAAEANLFRHLIDRRVLER
Ga0182027_1086974613300014839FenVNLTVFEHDRPFVIEALRRGEVDYLENVSEAAEANLFRHLIDRRVLERLAES
Ga0180083_111315313300014875SoilMDLVAFQYDRNFVVDALQRGEIDALENVSEAAEADLFRHLIGRGVL
Ga0182035_1062525323300016341SoilMDLVAFEHDRSFILEALRRGEIDYLEHVGEALEGDFFRQLIDRQVLQRLADSYPTLCGIFFLIS
Ga0182039_1125413123300016422SoilMDLVAFQYDCSFVLDALRNGEVDYLEHVSEAAEADLFRHLIRRQVIQRLADTY
Ga0187820_131421323300017924Freshwater SedimentVNLTVFEHDRQFVIEALRRGELDYLENVSEAAEANLFRHLLDRQVLERLAESYPS
Ga0187819_1035587113300017943Freshwater SedimentMDLTAFQYDRSFVLDALRHGDLDYLEHVSEAAEADLFRHLIRRQ
Ga0187822_1023307813300017994Freshwater SedimentMDLTAFQYDRSFVLDALRHGDLDYLEHVSEAAEADLF
Ga0187804_1039996623300018006Freshwater SedimentVNLTVFAHDRPLVIEALRRGEVDYLENVAEAAEAN
Ga0187880_121036313300018016PeatlandVNLTVFEHDRQFVIEALRRGEVDYLENVSEAAEANLFRHL
Ga0187882_110308533300018021PeatlandMDLTAFSYDRSFVLDALRQGEINYLEHVSEAAEADLFRHLIRRQVVQRLA
Ga0187864_1016829523300018022PeatlandVNLTVFEHDRPFVIEALRRGEVDYLENVSEAAEANLFRHLI
Ga0187864_1028681623300018022PeatlandVNLTVFEHDRQFVIEALRRGELDYLENVSEAAEASLFRHLLDR
Ga0187889_1012770733300018023PeatlandVNLTLFEHDRQFVIDALRRGELDYLENVSEAAEANLFRHL
Ga0184621_1009619913300018054Groundwater SedimentMELVAFENDRKFVLEGLRHGEVDYVEHVSEAAEADLFRHLISRDVLTRLAETY
Ga0187858_1039698313300018057PeatlandVNLTVFEHDRPFVVDALRRGELDYLENVSEAAEANLFRHLI
Ga0184636_131901123300018068Groundwater SedimentMDLVGLQFDRPFVLDALSRGEIDYLENVSEAAEADLFRKLIRRDVL
Ga0187772_1051568113300018085Tropical PeatlandVNLIGFEYDRGFVLKALRQGEVDYLESVSEAVEADLFRHLIDRR
Ga0187770_1052316733300018090Tropical PeatlandVNLTVFERDRQLVIEALRRGELDYLENVSEAAEAGLFRHLLDRRVLERLA
Ga0187770_1099206813300018090Tropical PeatlandMNLIAFEHDRRFVVEALRQGEVDYLENVSEAVEADLFRHLIDRRVLARLA
Ga0182022_101015113300019785FenMDLAVFSYDRSFVLDALRQGEIDYLEHVSEAAEADLFRHLRLV
Ga0179596_1025788313300021086Vadose Zone SoilMDLAAFQYDRSFVLDALRHGDLDYLEHVSEAAEADLFRHLLRRQVIQ
Ga0179596_1052863713300021086Vadose Zone SoilMDLVAFQYDRSFVLDALQHGDLDYLEHVSEAAEADLFRHLIQRQVIQRLADSYPSPRN
Ga0208321_103846123300025409PeatlandVNLTLFEHDRQFVIDALRRGELDYLENVSEAAEANLFRHLIDRRVL
Ga0208686_106892323300025500PeatlandVNLTVFEHDRQFVIEALRRGELDYLENVSEAAEASLFRH
Ga0209748_104982943300025836Arctic Peat SoilMDLVAFHFDRSFVLDALRQGEIDYLEHVSEAAEADLF
Ga0209182_1020277223300025843Lake SedimentMDLAAFHYDRSFVLDALRHGEIDYLEHVSEAAEADLFRHLIGRQV
Ga0209176_1007584823300025854Arctic Peat SoilMDLVAFHFDRSFVLDALRQGEIDYLEHVSEAAEADLFRHLIGRQVVQRLA
Ga0210124_114205233300026007Natural And Restored WetlandsMDLLAFEHDRLFVLQALRQGEIDYLEPVTEAVEADF
Ga0257164_101949813300026497SoilMDWVAFENDRKFVLEGLRRGEVDYVEHVSEAAEADLFRHLISRDV
Ga0179587_1073646723300026557Vadose Zone SoilMDWVAFENDRKFVLEGLRHGEVDYVEHVSEAAEADLFRHLVSRD
Ga0207852_102400123300026959Tropical Forest SoilMHLLAFEYDRPFILEALRRGQIDYLEHVGEALEGDFFRQ
Ga0209329_101374013300027605Forest SoilMDLAAFEYDRQFVIEALRRGEIDFLENVSEAAEADLFRHLLGRDVLE
(restricted) Ga0233416_1030170313300027799SedimentMDLVLFEHDRDFVVSALREGNLDYLEHVSEAAETELFRH
Ga0209580_1002258713300027842Surface SoilMDLISFHYDRSFALEALRNGDIDYLEHVSEAAEADLFRHLIRRQVIQRLAETW
Ga0209590_1091742113300027882Vadose Zone SoilVDFAAFEHDPKFVIESLRRGEIDYLENLSEAAEADFFRHLIG
(restricted) Ga0233418_1030355113300027995SedimentMDLIAFKYDRSFVVEALSRGEIDYLEPVSEAAEADF
Ga0302323_10283540823300031232FenMDLVAFHYDRSFVLDALRQGEIDYLEHVSEAAEADLFRHLIGRQERPTPGRYLSH
Ga0318541_1060993813300031545SoilMDLVAFQYDCSFVLDALRNGEVDYLEHVSEAAEADLFRHLIRRQVIQRLAD
Ga0318496_1079284523300031713SoilMDLISFQYDRSFVLDALRQGDIDYLEHVSEAAEADLFRHLIRRQVIQRLAET
Ga0315293_1114976323300031746SedimentMNLVLFEHDRQFVIEALRRGQVDYLENVGQAVETD
Ga0315293_1124043823300031746SedimentMDLVAFHYDRSFVLDALRQSEIDYLEHVSEAAEADLFRHLIGRQVVQRL
Ga0318554_1076805913300031765SoilPKVMDLVAFEYDRSFILEALRRGEIDYLEHVGEALEGDFFR
Ga0315288_1132262123300031772SedimentMDLVGFQFDRPFVLDALSRGEIDFLENVSEAAEADF
Ga0318568_1051083023300031819SoilMDLISFQYDRSFVLDALRQGDIDYLEHVSEAAEADLFRHLIRRQVIQRL
Ga0310917_1004329643300031833SoilTPKVMDLVAFEYDRSFILEALRRGEIDYLEHVGEALEGDFFR
Ga0315290_1087578923300031834SedimentMNLVLFEHDRQFVIEALRRGQVDYLENVGQAVETDLFR
Ga0318495_1023286023300031860SoilMDLISFQYDRSFVLDALRQGDIDYLEHVSEAAEADLFR
Ga0306919_1015965833300031879SoilMDLVAFEYDRSFILEALRRGEIDYLEHVGEALEGDFFR
Ga0315289_1065423123300032046SedimentMDLIGLQFDRPFVLDALSRGENDYLEHVSEAAEAS
Ga0318506_1041866123300032052SoilMDLVAFQYDCSFVLDALRNGEVDYLEHVSEAAEADLFRHLIRRQVIQ
Ga0318506_1041876423300032052SoilMDLISFQYDRSFVLDALRQGDIDYLEHVSEAAEADLFRHLIRR
Ga0315284_1225785723300032053SedimentMDLVAFQYDRSFVLDALRNGEIDYLEHVSEAAEADLFRHLIRRQ
Ga0315282_1059308423300032069SedimentMDLLTFQYDRSFVLDALRQGDIDYLEHVSEAAEADWFRHLIRRQV
Ga0318525_1032187023300032089SoilMDLISFQYDRSFVLDALRQGDIDYLEHVSEAAEADLFRHLIRRQVIQRLAE
Ga0315277_1098626623300032118SedimentMDLITFQYDRSFVLGALRQGDIDYLEHVSEAAEADLFRHLIRRQVVQRLAET
Ga0315292_1122389613300032143SedimentMDFVAFEYDRKFVLEGLRHGEVDYVEAVTEAAETDLFRHLI
Ga0315292_1159313313300032143SedimentMDLIGLQFDRPFVLDALSRGEIDFLENVSEAAEADF
Ga0315270_1052665723300032275SedimentMDFVAFEHDRKFVLDALRNGEVDYLESVNEAAEADLFRHLISRDVLN
Ga0315287_1096078023300032397SedimentMDLLALEYDRDFVIEAMRQGQLDYLEHVSEAAETDFFRHLIGRGVLA
Ga0335076_1010792933300032955SoilMDLISFQYDRSFVLDALRNGDVDYLENVSEAAEADLF
Ga0316619_1178404613300033414SoilMDLVAFQYDRNFVVDALQRGEIDALENVSEAAEADLFRHLIGRGVLN
Ga0316625_10178630113300033418SoilMDLVAFQFDRPFVLDALSRGEIDYLEHVSEAAEAGFFRQL
Ga0316617_10060482033300033557SoilMDLVAFQFDRPLVLDALSRGEIDYLEHVSEAAEAGFFRHLIRR
Ga0364928_0088670_1_1473300033813SedimentMDLVAFHYDRSFVLDALRQGEIDYLEHVSEAAEADLFRHLIRRQVVQRL
Ga0334817_060979_623_7333300033820SoilMDLVAFQYDRSFVLEALRRGEIDCLEHVSEAAEADFF
Ga0370484_0022553_1_1083300034125Untreated Peat SoilMDLVAFHFDRSFVLDALRQGEIDYLEHVSEAAEADL
Ga0373909_0279512_3_1373300034191Sediment SlurryMDLLAFQYDRSFVLDALRHGDIDYLEHVGEAAEADLFRHLIRRQV
Ga0373914_0167022_423_5663300034419Sediment SlurryMNLMVFEHDQQFVIDALRRGEVDYLENVSEAAETELFRHLIGRGVLKR

 ⦗Top⦘


Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.