Basic Information | |
---|---|
Family ID | F082571 |
Family Type | Metagenome / Metatranscriptome |
Number of Sequences | 113 |
Average Sequence Length | 42 residues |
Representative Sequence | MILVGTWVVVGFFSAIGWYGANHYVIEPYFPPPIERKKEETK |
Number of Associated Samples | 60 |
Number of Associated Scaffolds | 113 |
Quality Assessment | |
---|---|
Transcriptomic Evidence | Yes |
Most common taxonomic group | Viruses |
% of genes with valid RBS motifs | 82.14 % |
% of genes near scaffold ends (potentially truncated) | 15.04 % |
% of genes from short scaffolds (< 2000 bps) | 60.18 % |
Associated GOLD sequencing projects | 46 |
AlphaFold2 3D model prediction | Yes |
3D model pTM-score | 0.43 |
Hidden Markov Model |
---|
Powered by Skylign |
Most Common Taxonomy | |
---|---|
Group | Duplodnaviria (65.487 % of family members) |
NCBI Taxonomy ID | 2731341 |
Taxonomy | All Organisms → Viruses → Duplodnaviria |
Most Common Ecosystem | |
---|---|
GOLD Ecosystem | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake (70.796 % of family members) |
Environment Ontology (ENVO) | Unclassified (87.611 % of family members) |
Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Water (non-saline) (94.690 % of family members) |
⦗Top⦘ |
⦗Top⦘ |
Predicted Topology & Secondary Structure | |||||
---|---|---|---|---|---|
Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 35.71% β-sheet: 0.00% Coil/Unstructured: 64.29% | Feature Viewer |
|
|||||
Powered by Feature Viewer |
Structure Viewer | |
---|---|
| |
Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.43 |
Powered by PDBe Molstar |
⦗Top⦘ |
Pfam ID | Name | % Frequency in 113 Family Scaffolds |
---|---|---|
PF09825 | BPL_N | 15.93 |
PF00085 | Thioredoxin | 8.85 |
PF00268 | Ribonuc_red_sm | 4.42 |
PF00730 | HhH-GPD | 3.54 |
PF02867 | Ribonuc_red_lgC | 3.54 |
PF14083 | PGDYG | 2.65 |
PF00149 | Metallophos | 2.65 |
PF01027 | Bax1-I | 2.65 |
PF04325 | DUF465 | 2.65 |
PF10902 | WYL_2 | 1.77 |
PF09722 | Xre_MbcA_ParS_C | 1.77 |
PF03819 | MazG | 1.77 |
PF00004 | AAA | 1.77 |
PF14743 | DNA_ligase_OB_2 | 1.77 |
PF14090 | HTH_39 | 0.88 |
PF02562 | PhoH | 0.88 |
PF11251 | DUF3050 | 0.88 |
PF00155 | Aminotran_1_2 | 0.88 |
PF13759 | 2OG-FeII_Oxy_5 | 0.88 |
PF13186 | SPASM | 0.88 |
PF01227 | GTP_cyclohydroI | 0.88 |
PF13640 | 2OG-FeII_Oxy_3 | 0.88 |
PF00147 | Fibrinogen_C | 0.88 |
PF00210 | Ferritin | 0.88 |
PF04308 | RNaseH_like | 0.88 |
PF00487 | FA_desaturase | 0.88 |
PF03851 | UvdE | 0.88 |
PF00782 | DSPc | 0.88 |
PF01230 | HIT | 0.88 |
COG ID | Name | Functional Category | % Frequency in 113 Family Scaffolds |
---|---|---|---|
COG0208 | Ribonucleotide reductase beta subunit, ferritin-like domain | Nucleotide transport and metabolism [F] | 4.42 |
COG0122 | 3-methyladenine DNA glycosylase/8-oxoguanine DNA glycosylase | Replication, recombination and repair [L] | 3.54 |
COG0177 | Endonuclease III | Replication, recombination and repair [L] | 3.54 |
COG0209 | Ribonucleotide reductase alpha subunit | Nucleotide transport and metabolism [F] | 3.54 |
COG1059 | Thermostable 8-oxoguanine DNA glycosylase | Replication, recombination and repair [L] | 3.54 |
COG1194 | Adenine-specific DNA glycosylase, acts on AG and A-oxoG pairs | Replication, recombination and repair [L] | 3.54 |
COG2231 | 3-Methyladenine DNA glycosylase, HhH-GPD/Endo3 superfamily | Replication, recombination and repair [L] | 3.54 |
COG1398 | Fatty-acid desaturase | Lipid transport and metabolism [I] | 0.88 |
COG1702 | Phosphate starvation-inducible protein PhoH, predicted ATPase | Signal transduction mechanisms [T] | 0.88 |
COG1875 | Predicted ribonuclease YlaK, contains NYN-type RNase and PhoH-family ATPase domains | General function prediction only [R] | 0.88 |
COG3239 | Fatty acid desaturase | Lipid transport and metabolism [I] | 0.88 |
COG4294 | UV DNA damage repair endonuclease | Replication, recombination and repair [L] | 0.88 |
⦗Top⦘ |
Name | Rank | Taxonomy | Distribution |
All Organisms | root | All Organisms | 88.50 % |
Unclassified | root | N/A | 11.50 % |
Visualization |
---|
Powered by ApexCharts |
Scaffold | Taxonomy | Length | IMG/M Link |
---|---|---|---|
3300004772|Ga0007791_10044995 | All Organisms → Viruses → Predicted Viral | 1454 | Open in IMG/M |
3300005662|Ga0078894_10042852 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 3797 | Open in IMG/M |
3300006071|Ga0007876_1015328 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 2187 | Open in IMG/M |
3300006071|Ga0007876_1035014 | All Organisms → cellular organisms → Bacteria | 1383 | Open in IMG/M |
3300006641|Ga0075471_10582513 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 550 | Open in IMG/M |
3300006875|Ga0075473_10168964 | Not Available | 881 | Open in IMG/M |
3300008962|Ga0104242_1068928 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 590 | Open in IMG/M |
3300009068|Ga0114973_10110846 | All Organisms → cellular organisms → Bacteria | 1552 | Open in IMG/M |
3300009068|Ga0114973_10160723 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1244 | Open in IMG/M |
3300009068|Ga0114973_10246769 | All Organisms → cellular organisms → Bacteria | 963 | Open in IMG/M |
3300009068|Ga0114973_10493807 | Not Available | 634 | Open in IMG/M |
3300009151|Ga0114962_10010261 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 6941 | Open in IMG/M |
3300009151|Ga0114962_10015093 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 5560 | Open in IMG/M |
3300009151|Ga0114962_10022486 | All Organisms → Viruses → Predicted Viral | 4431 | Open in IMG/M |
3300009151|Ga0114962_10042490 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales | 3039 | Open in IMG/M |
3300009151|Ga0114962_10042615 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 3034 | Open in IMG/M |
3300009151|Ga0114962_10044120 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 2972 | Open in IMG/M |
3300009151|Ga0114962_10070560 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 2240 | Open in IMG/M |
3300009151|Ga0114962_10078949 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 2090 | Open in IMG/M |
3300009151|Ga0114962_10103051 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1775 | Open in IMG/M |
3300009151|Ga0114962_10166478 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1312 | Open in IMG/M |
3300009152|Ga0114980_10083043 | Not Available | 1921 | Open in IMG/M |
3300009152|Ga0114980_10306465 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 921 | Open in IMG/M |
3300009152|Ga0114980_10831035 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 513 | Open in IMG/M |
3300009154|Ga0114963_10515845 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 634 | Open in IMG/M |
3300009154|Ga0114963_10533537 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 621 | Open in IMG/M |
3300009158|Ga0114977_10233949 | All Organisms → Viruses → Predicted Viral | 1066 | Open in IMG/M |
3300009158|Ga0114977_10422966 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 739 | Open in IMG/M |
3300009159|Ga0114978_10000929 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 24626 | Open in IMG/M |
3300009159|Ga0114978_10008200 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 8206 | Open in IMG/M |
3300009159|Ga0114978_10029406 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 3940 | Open in IMG/M |
3300009159|Ga0114978_10428741 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 787 | Open in IMG/M |
3300009159|Ga0114978_10459495 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 753 | Open in IMG/M |
3300009159|Ga0114978_10531770 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 687 | Open in IMG/M |
3300009160|Ga0114981_10775915 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 505 | Open in IMG/M |
3300009163|Ga0114970_10300918 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 913 | Open in IMG/M |
3300009164|Ga0114975_10043107 | Not Available | 2676 | Open in IMG/M |
3300009164|Ga0114975_10049428 | All Organisms → Viruses → Predicted Viral | 2480 | Open in IMG/M |
3300009164|Ga0114975_10164400 | All Organisms → Viruses → Predicted Viral | 1264 | Open in IMG/M |
3300009164|Ga0114975_10270070 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 947 | Open in IMG/M |
3300009180|Ga0114979_10075436 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 2097 | Open in IMG/M |
3300009180|Ga0114979_10339863 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 886 | Open in IMG/M |
3300009182|Ga0114959_10095795 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1634 | Open in IMG/M |
3300009183|Ga0114974_10009863 | Not Available | 6944 | Open in IMG/M |
3300009183|Ga0114974_10762756 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 521 | Open in IMG/M |
3300009184|Ga0114976_10043029 | All Organisms → Viruses → Predicted Viral | 2684 | Open in IMG/M |
3300009184|Ga0114976_10362735 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 764 | Open in IMG/M |
3300009684|Ga0114958_10146128 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 1199 | Open in IMG/M |
3300010157|Ga0114964_10288828 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 778 | Open in IMG/M |
3300010158|Ga0114960_10535544 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 559 | Open in IMG/M |
3300010160|Ga0114967_10495525 | Not Available | 597 | Open in IMG/M |
3300010885|Ga0133913_11491011 | All Organisms → Viruses → Predicted Viral | 1714 | Open in IMG/M |
3300010885|Ga0133913_12435917 | Not Available | 1278 | Open in IMG/M |
3300010885|Ga0133913_12521549 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1252 | Open in IMG/M |
3300012779|Ga0138284_1160353 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1081 | Open in IMG/M |
3300012780|Ga0138271_1250798 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 506 | Open in IMG/M |
3300013285|Ga0136642_1000338 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 26349 | Open in IMG/M |
3300013285|Ga0136642_1029495 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1567 | Open in IMG/M |
3300013286|Ga0136641_1008537 | All Organisms → Viruses → Predicted Viral | 3488 | Open in IMG/M |
3300014962|Ga0134315_1014060 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1257 | Open in IMG/M |
3300018416|Ga0181553_10402441 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacterales incertae sedis → Candidatus Fonsibacter → unclassified Candidatus Fonsibacter → Candidatus Fonsibacter sp. PEL4 | 743 | Open in IMG/M |
3300020159|Ga0211734_11138251 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 770 | Open in IMG/M |
3300020159|Ga0211734_11278761 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 798 | Open in IMG/M |
3300020172|Ga0211729_11200191 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 508 | Open in IMG/M |
3300021520|Ga0194053_10326334 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 590 | Open in IMG/M |
3300021952|Ga0213921_1052153 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 599 | Open in IMG/M |
3300021956|Ga0213922_1013910 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 2161 | Open in IMG/M |
3300021956|Ga0213922_1056958 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 854 | Open in IMG/M |
3300021961|Ga0222714_10244563 | Not Available | 1010 | Open in IMG/M |
3300021963|Ga0222712_10302546 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 1002 | Open in IMG/M |
3300022179|Ga0181353_1111976 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 661 | Open in IMG/M |
3300022591|Ga0236341_1000441 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 25957 | Open in IMG/M |
3300022591|Ga0236341_1033592 | All Organisms → Viruses → Predicted Viral | 1425 | Open in IMG/M |
3300022591|Ga0236341_1101177 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 629 | Open in IMG/M |
3300023174|Ga0214921_10010636 | Not Available | 11340 | Open in IMG/M |
3300023174|Ga0214921_10030715 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 5277 | Open in IMG/M |
3300023179|Ga0214923_10453573 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 642 | Open in IMG/M |
3300023184|Ga0214919_10055571 | All Organisms → Viruses → Predicted Viral | 3727 | Open in IMG/M |
3300023184|Ga0214919_10246425 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1285 | Open in IMG/M |
3300025383|Ga0208250_1001302 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 6299 | Open in IMG/M |
3300025450|Ga0208744_1027034 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1199 | Open in IMG/M |
3300025635|Ga0208147_1084940 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 778 | Open in IMG/M |
3300027708|Ga0209188_1000023 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Myoviridae | 168414 | Open in IMG/M |
3300027708|Ga0209188_1000056 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Myoviridae | 130972 | Open in IMG/M |
3300027708|Ga0209188_1013526 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 4466 | Open in IMG/M |
3300027708|Ga0209188_1029446 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 2645 | Open in IMG/M |
3300027708|Ga0209188_1041125 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 2119 | Open in IMG/M |
3300027708|Ga0209188_1058817 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1672 | Open in IMG/M |
3300027708|Ga0209188_1094816 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1209 | Open in IMG/M |
3300027708|Ga0209188_1273046 | Not Available | 574 | Open in IMG/M |
3300027712|Ga0209499_1259898 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 598 | Open in IMG/M |
3300027733|Ga0209297_1000041 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales | 105579 | Open in IMG/M |
3300027734|Ga0209087_1006667 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 6125 | Open in IMG/M |
3300027734|Ga0209087_1011606 | All Organisms → Viruses → Predicted Viral | 4495 | Open in IMG/M |
3300027734|Ga0209087_1021773 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales | 3145 | Open in IMG/M |
3300027736|Ga0209190_1288163 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 633 | Open in IMG/M |
3300027741|Ga0209085_1005380 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales | 6751 | Open in IMG/M |
3300027746|Ga0209597_1030005 | All Organisms → Viruses → Predicted Viral | 2869 | Open in IMG/M |
3300027747|Ga0209189_1066386 | All Organisms → Viruses → Predicted Viral | 1694 | Open in IMG/M |
3300027749|Ga0209084_1003440 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 11666 | Open in IMG/M |
3300027749|Ga0209084_1007558 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 6991 | Open in IMG/M |
3300027759|Ga0209296_1003396 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 10849 | Open in IMG/M |
3300027759|Ga0209296_1080645 | Not Available | 1603 | Open in IMG/M |
3300027759|Ga0209296_1112475 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 1281 | Open in IMG/M |
3300027759|Ga0209296_1139489 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1103 | Open in IMG/M |
3300027777|Ga0209829_10044053 | All Organisms → Viruses → Predicted Viral | 2405 | Open in IMG/M |
3300027777|Ga0209829_10386909 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 546 | Open in IMG/M |
3300027777|Ga0209829_10415734 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 517 | Open in IMG/M |
3300027782|Ga0209500_10025720 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 3370 | Open in IMG/M |
3300027969|Ga0209191_1031223 | Not Available | 2554 | Open in IMG/M |
3300027971|Ga0209401_1246356 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 644 | Open in IMG/M |
3300028392|Ga0304729_1000429 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 31510 | Open in IMG/M |
⦗Top⦘ |
Habitat | Taxonomy | Distribution |
Freshwater Lake | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake | 70.80% |
Freshwater | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater | 8.85% |
Freshwater | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater | 4.42% |
Freshwater | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater | 4.42% |
Freshwater | Environmental → Aquatic → Freshwater → Creek → Unclassified → Freshwater | 2.65% |
Aqueous | Environmental → Aquatic → Marine → Coastal → Unclassified → Aqueous | 2.65% |
Freshwater Lake | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lake | 1.77% |
Estuarine Water | Environmental → Aquatic → Marine → Unclassified → Unclassified → Estuarine Water | 1.77% |
Anoxic Zone Freshwater | Environmental → Aquatic → Freshwater → Lake → Unclassified → Anoxic Zone Freshwater | 0.89% |
Surface Water | Environmental → Aquatic → Freshwater → Groundwater → Unclassified → Surface Water | 0.89% |
Salt Marsh | Environmental → Aquatic → Marine → Intertidal Zone → Salt Marsh → Salt Marsh | 0.89% |
Visualization |
---|
Powered by ApexCharts |
Taxon OID | Sample Name | Habitat Type | IMG/M Link |
---|---|---|---|
3300004772 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - MA0.5M | Environmental | Open in IMG/M |
3300005662 | Freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MLB.SD (version 4) | Environmental | Open in IMG/M |
3300006071 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBH24Aug09 | Environmental | Open in IMG/M |
3300006641 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_0.19_D_>0.8_DNA | Environmental | Open in IMG/M |
3300006875 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_0.19_N_>0.8_DNA | Environmental | Open in IMG/M |
3300008962 | Freshwater microbial communities from Lake Lanier in Georgia, USA - LL_1007_MT5 | Environmental | Open in IMG/M |
3300009068 | Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_140807_MF_MetaG | Environmental | Open in IMG/M |
3300009151 | Freshwater microbial communities from Lake Croche, Canada to study carbon cycling - C_130820_MF_MetaG | Environmental | Open in IMG/M |
3300009152 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_140806_EF_MetaG | Environmental | Open in IMG/M |
3300009154 | Freshwater microbial communities from Lake Croche, Canada to study carbon cycling - C_131016_EF_MetaG | Environmental | Open in IMG/M |
3300009158 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130805_MF_MetaG | Environmental | Open in IMG/M |
3300009159 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_140212_EF_MetaG | Environmental | Open in IMG/M |
3300009160 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_140806_MF_MetaG | Environmental | Open in IMG/M |
3300009163 | Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_140205_XF_MetaG | Environmental | Open in IMG/M |
3300009164 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130626_EF_MetaG | Environmental | Open in IMG/M |
3300009180 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_140625_EF_MetaG | Environmental | Open in IMG/M |
3300009182 | Freshwater microbial communities from Lake Croche, Canada to study carbon cycling - C_130625_EF_MetaG | Environmental | Open in IMG/M |
3300009183 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130206_EF_MetaG | Environmental | Open in IMG/M |
3300009184 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130805_EF_MetaG | Environmental | Open in IMG/M |
3300009684 | Freshwater microbial communities from Lake Croche, Canada to study carbon cycling - C_130208_EF_MetaG | Environmental | Open in IMG/M |
3300010157 | Freshwater microbial communities from Lake Croche, Canada to study carbon cycling - C_131016_MF_MetaG | Environmental | Open in IMG/M |
3300010158 | Freshwater microbial communities from Lake Croche, Canada to study carbon cycling - C_130625_MF_MetaG | Environmental | Open in IMG/M |
3300010160 | Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_130628_MF_MetaG | Environmental | Open in IMG/M |
3300010885 | northern Canada Lakes Co-assembly | Environmental | Open in IMG/M |
3300012779 | Freshwater microbial communities from Lake Simoncouche, Canada - S_130206_E_mt (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300012780 | Freshwater microbial communities from Lake Croche, Canada - C_130625_M_mt (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300013285 | Freshwater microbial communities from Lower Cathedral Lake, Yosemite National Park, California, USA - 13028-31Y | Environmental | Open in IMG/M |
3300013286 | Freshwater microbial communities from Elizabeth Lake, Yosemite National Park, California, USA - 13020-23Y | Environmental | Open in IMG/M |
3300014962 | Surface water microbial communities from Bangladesh - BaraHaldiaSW0309 | Environmental | Open in IMG/M |
3300018416 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 011502XT metaG (megahit assembly) | Environmental | Open in IMG/M |
3300020159 | Freshwater lake microbial communities from Lake Erken, Sweden - P4710_108 megahit1 | Environmental | Open in IMG/M |
3300020172 | Freshwater lake microbial communities from Lake Erken, Sweden - P4710_102 megahit1 | Environmental | Open in IMG/M |
3300021520 | Anoxic zone freshwater microbial communities from boreal shield lake in IISD Experimental Lakes Area, Ontario, Canada - Sep2016-L227-8m | Environmental | Open in IMG/M |
3300021952 | Freshwater microbial communities from McNutts Creek, Athens, Georgia, United States - 20-17 MG | Environmental | Open in IMG/M |
3300021956 | Freshwater microbial communities from McNutts Creek, Athens, Georgia, United States - 29-17 MG | Environmental | Open in IMG/M |
3300021961 | Estuarine water microbial communities from San Francisco Bay, California, United States - C33_3D | Environmental | Open in IMG/M |
3300021963 | Estuarine water microbial communities from San Francisco Bay, California, United States - C33_657D | Environmental | Open in IMG/M |
3300022179 | Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MLB.D.N | Environmental | Open in IMG/M |
3300022591 | Freshwater microbial communities from thermokarst lake SAS2a, Kuujjuarapick, Canada - Sample Summer S2 | Environmental | Open in IMG/M |
3300023174 | Freshwater microbial communities from Lake Lanier, Atlanta, Georgia, United States - LL-1505 | Environmental | Open in IMG/M |
3300023179 | Freshwater microbial communities from Lake Lanier, Atlanta, Georgia, United States - LL-1510 | Environmental | Open in IMG/M |
3300023184 | Freshwater microbial communities from Lake Lanier, Atlanta, Georgia, United States - LL-1503 | Environmental | Open in IMG/M |
3300025383 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBE18Aug09 (SPAdes) | Environmental | Open in IMG/M |
3300025450 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBH24Aug09 (SPAdes) | Environmental | Open in IMG/M |
3300025635 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Fall_0.3_<0.8_DNA (SPAdes) | Environmental | Open in IMG/M |
3300027708 | Freshwater microbial communities from Lake Croche, Canada to study carbon cycling - C_130625_EF_MetaG (SPAdes) | Environmental | Open in IMG/M |
3300027712 | Freshwater microbial communities from Lake Croche, Canada to study carbon cycling - C_130208_EF_MetaG (SPAdes) | Environmental | Open in IMG/M |
3300027733 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130805_MF_MetaG (SPAdes) | Environmental | Open in IMG/M |
3300027734 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130805_EF_MetaG (SPAdes) | Environmental | Open in IMG/M |
3300027736 | Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_140205_XF_MetaG (SPAdes) | Environmental | Open in IMG/M |
3300027741 | Freshwater microbial communities from Lake Croche, Canada to study carbon cycling - C_131016_EF_MetaG (SPAdes) | Environmental | Open in IMG/M |
3300027746 | Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_140625_MF_MetaG (SPAdes) | Environmental | Open in IMG/M |
3300027747 | Freshwater microbial communities from Lake Croche, Canada to study carbon cycling - C_130820_EF_MetaG (SPAdes) | Environmental | Open in IMG/M |
3300027749 | Freshwater microbial communities from Lake Croche, Canada to study carbon cycling - C_130820_MF_MetaG (SPAdes) | Environmental | Open in IMG/M |
3300027759 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130206_EF_MetaG (SPAdes) | Environmental | Open in IMG/M |
3300027777 | Freshwater microbial communities from Lake Croche, Canada to study carbon cycling - C_140205_EF_MetaG (SPAdes) | Environmental | Open in IMG/M |
3300027782 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_140212_EF_MetaG (SPAdes) | Environmental | Open in IMG/M |
3300027969 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130626_EF_MetaG (SPAdes) | Environmental | Open in IMG/M |
3300027971 | Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_140807_MF_MetaG (SPAdes) | Environmental | Open in IMG/M |
3300028392 | Freshwater microbial communities from Lake Croche, Canada to study carbon cycling - C_131016_MF_MetaG (v2) | Environmental | Open in IMG/M |
Geographical Distribution | |
---|---|
Zoom: | Powered by OpenStreetMap |
⦗Top⦘ |
Protein ID | Sample Taxon ID | Habitat | Sequence |
Ga0007791_100449954 | 3300004772 | Freshwater | MIIVATWTIVGFFSAIGWYGANHYVIEPYFPPPIERKKEESK* |
Ga0078894_100428525 | 3300005662 | Freshwater Lake | MILVATWITVGFFSAIGWWGANHYVIEPYAPPPIERKKEEAK* |
Ga0007876_10153282 | 3300006071 | Freshwater | MVVVGTWIVVGFFSAIGWWGANHYVIEPYAPPPIERKKENSQ* |
Ga0007876_10350142 | 3300006071 | Freshwater | MLILEWTIVGFFSAIGWWGANHYVIEPHFPPAITTEKKDETGT* |
Ga0075471_105825132 | 3300006641 | Aqueous | MLALEYVIIGALSAIGWWGANHYVIEPYAPPPIERKKEEIK* |
Ga0075473_101689643 | 3300006875 | Aqueous | MLALEYIIIGALSAIGWWGANHYVIEPYAPPPIERKKEEIK* |
Ga0104242_10689283 | 3300008962 | Freshwater | MIVATWIVVGFFSAIGWYGANHYVIEPYFPPPIERKKEEAK* |
Ga0114973_101108462 | 3300009068 | Freshwater Lake | MIVAGWIVVGFFSAIGWWSANHYVIEPYFPEPIKKERKVETKND* |
Ga0114973_101607233 | 3300009068 | Freshwater Lake | MILIATWVTVGFFSAIGWYGANHYVIEPHFPAPVEKKEIK* |
Ga0114973_102467692 | 3300009068 | Freshwater Lake | MILVATWVTVGFFSAIGWYGANHYVIEPYFPPPIERKKDENPKTTGN* |
Ga0114973_104938072 | 3300009068 | Freshwater Lake | MILVATWVTVGFFSAIGWYGANHYVIEPYLPPPIERKKEETK* |
Ga0114962_1000007839 | 3300009151 | Freshwater Lake | MILVGTWVVVGFFSAIGWYGANYYVITPYLPEPVFKEKRVEETKPKQDDAK* |
Ga0114962_100102612 | 3300009151 | Freshwater Lake | MMIILEWTIIGFFSAIGWWSANHYVIDPYFPQEITMEKKDEKGN* |
Ga0114962_1001509315 | 3300009151 | Freshwater Lake | MILVATWITVGFFSAIGWYGANHLVIEPYLPPPRQIEKKKDD* |
Ga0114962_100224862 | 3300009151 | Freshwater Lake | MLVATWVVVGFFSAIGWWSANHYVIEPYFPEPVVKEKKMETKDQT* |
Ga0114962_100424906 | 3300009151 | Freshwater Lake | MIVATWVVVGFFSAIGWWSANHYVIDPYFPEPIKKERKVEKND* |
Ga0114962_100426154 | 3300009151 | Freshwater Lake | MILVATWVTVGFFSAIGWYGANHYVIEPHFPPPIEKKETK* |
Ga0114962_100441206 | 3300009151 | Freshwater Lake | MILVGTWVVVGFFSAIGWYGANHYVIEPYLPPPIERKKEEAK* |
Ga0114962_100705604 | 3300009151 | Freshwater Lake | MILVGTWVVVGFFSAIGWYGANHYVIEPYFPEPVVKEKKIETKDQK* |
Ga0114962_100789495 | 3300009151 | Freshwater Lake | TSTSTMILVGTWVVVGFFSAIGWYGANHYVIEPYFPPPIERKKEETK* |
Ga0114962_101030514 | 3300009151 | Freshwater Lake | MLVATWVVVGFFSAIGWWSANHYVIEPYFPEPVVKEKKIETKDQK* |
Ga0114962_101664783 | 3300009151 | Freshwater Lake | MIIAGWVVVGFFSAIGWYGANHYVIEPYFPPPIERKKEEAK* |
Ga0114980_100830432 | 3300009152 | Freshwater Lake | MIVATWVVVGFFSAIGWWSANHYVIEPYFPEPIKKERKVETKND* |
Ga0114980_103064652 | 3300009152 | Freshwater Lake | MILIATWVTVGFFSAIGWYGANQFVIEPYFPEPKQKIERKNDQTTS* |
Ga0114980_108310353 | 3300009152 | Freshwater Lake | MIIVATWTVVGFFSAIGWYGANHYVIEPYFPPPIERKKEEAK* |
Ga0114963_105158451 | 3300009154 | Freshwater Lake | MILIATWVTVGFFSAIGWYGANHYVIEPHFPAPVEKKEVK* |
Ga0114963_105335372 | 3300009154 | Freshwater Lake | MLVASWVVVGFFSAIGWWSANHYVIEPYFPEPIKKIEKQVEEK* |
Ga0114977_102339493 | 3300009158 | Freshwater Lake | MILVATWITVGFFSAIGWYGANHLVIEPYLPPPRVVEKKKDEQ* |
Ga0114977_104229663 | 3300009158 | Freshwater Lake | LILIATWVTVGFFSAIGWYGANHLVIEPYLPPPRQIEKKKDE* |
Ga0114978_1000092935 | 3300009159 | Freshwater Lake | MILVGTWVVVGFFSAIGWWGANHYVIEPYAPPPIERKKDEAK* |
Ga0114978_100082005 | 3300009159 | Freshwater Lake | MILVATWITVGFFSAIGWYGANQFVIDPYFPEPKQKIERKNDQTTT* |
Ga0114978_100294068 | 3300009159 | Freshwater Lake | MLIVEWVVIGFFSAMGWWSANHYVIEPYFPEPIVKEKKVGTKE* |
Ga0114978_104287412 | 3300009159 | Freshwater Lake | MILVGTWVVVGFFSAIGWWGANHYVIEPYAPPPIERKKEETK* |
Ga0114978_104594951 | 3300009159 | Freshwater Lake | ILIATWVTVGFFSAIGWYGANQFVIEPYFPEPKQKIERKNDQTTS* |
Ga0114978_105317701 | 3300009159 | Freshwater Lake | MILVGTWVVVGFFSAIGWYGANHLVIEPYFPPPIERKKEEAK* |
Ga0114981_107759151 | 3300009160 | Freshwater Lake | MILIATWVTVGFFSAIGWYGANHFVIEPHFPPPIEKK |
Ga0114970_103009182 | 3300009163 | Freshwater Lake | MIVAGWIVVGFFSAIGWWSANHYVIEPYFPEPIKKERKVEKND* |
Ga0114975_100431075 | 3300009164 | Freshwater Lake | MILVGTWVVVGFFSAIGWYGANHYVIEPYFPPPIERKKDETK* |
Ga0114975_100494282 | 3300009164 | Freshwater Lake | MIIEWIVVGFFSALGWWGANHYVIEPYLPPPIERKKEEAKKEQ* |
Ga0114975_101644001 | 3300009164 | Freshwater Lake | TWVTVGFFSAIGWWGANHYVIEPHFPESTKIEKKND* |
Ga0114975_102700701 | 3300009164 | Freshwater Lake | VVGFFSAIGWWGANHYVIEPYAPPPIERKKDEAK* |
Ga0114979_100754364 | 3300009180 | Freshwater Lake | MIVAGWIVVGFFSAIGWWSANHYVIDPYFPEPIKKERKVETKND* |
Ga0114979_103398632 | 3300009180 | Freshwater Lake | MLVVEWVVIGFFSAMGWWGANHYVIEPYFPEPIVKEKKVGTKE* |
Ga0114959_100957952 | 3300009182 | Freshwater Lake | MILVGTWVVVGFFSAIGWYGANHYVIEPYFPPPIERKKEETK* |
Ga0114974_100098631 | 3300009183 | Freshwater Lake | GTRMILVGTWVVVGFFSAIGWYGANHLVIEPYFPPPIERKKEETK* |
Ga0114974_107627562 | 3300009183 | Freshwater Lake | MILIATWVTVGFFSAIGWYGANQFVIDPYFPEPKQKIERKNDQTTS* |
Ga0114976_100430294 | 3300009184 | Freshwater Lake | MILIATWVTVGFFSAIGWWGANHYVIEPHFPESTKIEKKND* |
Ga0114976_103627352 | 3300009184 | Freshwater Lake | MILIATWVTVGFFSAIGWYGANQFVIDPYFPEPKQKIERKNDQTTT* |
Ga0114958_101461283 | 3300009684 | Freshwater Lake | MIVATWVVVGFFSAIGWWRANHYVIEPYFPAPIKKARKVEKND* |
Ga0114964_102888281 | 3300010157 | Freshwater Lake | VATWVVVGFFSAIGWWSANHYVIEPYFPEPVVKEKKIETKDQK* |
Ga0114960_105355442 | 3300010158 | Freshwater Lake | VVGFFSAIGWYGANHYVIEPYFPPPIERKKEEAK* |
Ga0114967_104955251 | 3300010160 | Freshwater Lake | MILVGTWVVVGFFSAIGWYGANHLVIEPYFPPPIERKKEETK* |
Ga0133913_114910115 | 3300010885 | Freshwater Lake | MILVATWVTVGFFSAIGWYGANHLVIEPYLPPPRVVEKKREEQ* |
Ga0133913_124359172 | 3300010885 | Freshwater Lake | MILIATWVTVGFFSAIGWYGANHYVIEPHFPPPIEKKETK* |
Ga0133913_125215493 | 3300010885 | Freshwater Lake | MILVATWVTVGFFSAIGWYGANHYVIEPYFPPPIEKKVEEKK* |
Ga0138284_11603532 | 3300012779 | Freshwater Lake | MILVGTWVVVGFFSAIGWYGANHYVIEPYFPPPIERKKEEAK* |
Ga0138271_12507982 | 3300012780 | Freshwater Lake | MLVASWVVVGFFSAIGWWSANHYVIEPYFPEPIKKIE |
Ga0136642_10003382 | 3300013285 | Freshwater | MLVAGWVVVGFFSAIGWWSANHYVIEPYFPEPIVKEKKIEIKVKDQE* |
Ga0136642_10294951 | 3300013285 | Freshwater | MILVGTWVVVGFFSAIGWYGANHYVIEPYLPPPIERKKEETK* |
Ga0136641_100853710 | 3300013286 | Freshwater | MILVGTWIVVGFFSAIGWYGANHYVIEPYLPPPIERKKEETK* |
Ga0134315_10140602 | 3300014962 | Surface Water | MLVAEYIIIGFLSALGWWSANHYVIEPYAPPPIERKKEEK* |
Ga0181553_104024412 | 3300018416 | Salt Marsh | MILIATWVTVGFFSAIGWYGANHYVIEPHFPPPIEKKETK |
Ga0211734_111382511 | 3300020159 | Freshwater | MILVATWVTVGFFSAIGWYGANHYVIEPYFPPPIEKKVEEKK |
Ga0211734_112787612 | 3300020159 | Freshwater | MILIATWVTVGFFSAIGWYGANHFVIEPHFPPPIEKKETK |
Ga0211729_112001911 | 3300020172 | Freshwater | MILIATWVTVGFFSAIGWYGANHFVIEPYFPPPIEKKETK |
Ga0194053_103263341 | 3300021520 | Anoxic Zone Freshwater | MLVATWVVVGFFSAIGWYGANHYVIEPYLPPPIERKKEEAK |
Ga0213921_10521532 | 3300021952 | Freshwater | MILVATWTVVGFFSAIGWYGANHYVIEPYFPPPIERKKEEAK |
Ga0213922_10139104 | 3300021956 | Freshwater | MIVAGWVVVGFFSAIGWYGANHYVIEPYFPPPIERKKEEAK |
Ga0213922_10569582 | 3300021956 | Freshwater | MIVATWIVVGFFSAIGWYGANHYVIEPYFPPPIERKKEEAK |
Ga0222714_102445634 | 3300021961 | Estuarine Water | MILIATWVTVGFFSAIGWYGANHFVIEPHFPAPVEKKETK |
Ga0222712_103025462 | 3300021963 | Estuarine Water | MILVATWTVVGFFSAIGWYGANHFVIEPHFPPPIERKKEEAK |
Ga0181353_11119762 | 3300022179 | Freshwater Lake | MLALEYVIIGALSAIGWWGVNHYVIEPYAPPPIERKKEEIK |
Ga0236341_100044131 | 3300022591 | Freshwater | MIVAGWIVVGFFSAIGWWSANHYVIEPYFPEKIVKEKPLKETNE |
Ga0236341_10335924 | 3300022591 | Freshwater | MIVAGWVVVGFFSAIGWWSANHYVIEPYFPPPIERKKEETK |
Ga0236341_11011771 | 3300022591 | Freshwater | MILVGTWIVVGFFSAIGWWGANHYVIEPYAPPPIERKKEEAK |
Ga0214921_100106367 | 3300023174 | Freshwater | MIIATWVVVGFFSAIGWYGANHFVIEPYFPPPIERKKEEAK |
Ga0214921_100307153 | 3300023174 | Freshwater | MILVATWVTVGFFSAIGWYGANHYVIEPYLPPPIERKKEETK |
Ga0214923_104535732 | 3300023179 | Freshwater | MILVATWVTVGFFSAIGWYGANHYVIEPHFPAPVEKKEVK |
Ga0214919_100555714 | 3300023184 | Freshwater | MLLIGTWITVGFFSAIGWWGANHYVIEPYAPPPIERKKEETK |
Ga0214919_102464253 | 3300023184 | Freshwater | MILIATWVTVGFFSAIGWYGANHYVIEPYFPAPVEKKETK |
Ga0208250_100130212 | 3300025383 | Freshwater | MLILEWTIVGFFSAIGWWGANHYVIEPHFPPAITTEKKDETGT |
Ga0208744_10270343 | 3300025450 | Freshwater | MVVVGTWIVVGFFSAIGWWGANHYVIEPYAPPPIERKKENSQ |
Ga0208147_10849401 | 3300025635 | Aqueous | MLALEYVIIGALSAIGWWGANHYVIEPYAPPPIERKKEEIK |
Ga0209188_1000023135 | 3300027708 | Freshwater Lake | MLVASWVVVGFFSAIGWWSANHYVIEPYFPEPIKKIEKQVEEK |
Ga0209188_100005687 | 3300027708 | Freshwater Lake | MILVATWITVGFFSAIGWYGANHLVIEPYLPPPRQIEKKKDD |
Ga0209188_10135266 | 3300027708 | Freshwater Lake | MILVGTWVVVGFFSAIGWYGANHYVIEPYLPPPIERKKEEAK |
Ga0209188_10294464 | 3300027708 | Freshwater Lake | MILVGTWVVVGFFSAIGWYGANHYVIEPYFPEPVVKEKKIETKDQK |
Ga0209188_10411255 | 3300027708 | Freshwater Lake | MILIATWVTVGFFSAIGWYGANHYVIEPHFPAPVEKKEIK |
Ga0209188_10588172 | 3300027708 | Freshwater Lake | MLVATWVVVGFFSAIGWWSANHYVIEPYFPEPVVKEKKIETKDQK |
Ga0209188_10948162 | 3300027708 | Freshwater Lake | MILVGTWVVVGFFSAIGWYGANHYVIEPYFPPPIERKKEETK |
Ga0209188_12730462 | 3300027708 | Freshwater Lake | MIILEWTIVGFFSAIGWWSANHYVIEPYFPPPIIKQEVKKDDEKNSK |
Ga0209499_12598982 | 3300027712 | Freshwater Lake | MILIATWVTVGFFSAIGWYGANHYVIEPYLPPPIERKKEETK |
Ga0209297_1000041168 | 3300027733 | Freshwater Lake | MIVAGWIVVGFFSAIGWWSANHYVIEPYFPEPIKKERKVETKND |
Ga0209087_10066679 | 3300027734 | Freshwater Lake | MILVATWITVGFFSAIGWYGANHLVIEPYLPPPRVVEKKKDEQ |
Ga0209087_101160621 | 3300027734 | Freshwater Lake | MILIATWVTVGFFSAIGWWGANHYVIEPHFPESTKMEKKND |
Ga0209087_10217735 | 3300027734 | Freshwater Lake | MIVATWVVVGFFSAIGWWSANHYVIDPYFPEPIKKERKVETKND |
Ga0209190_12881632 | 3300027736 | Freshwater Lake | MILVATWVTVGFFSAIGWYGANHYVIEPYFPPPIERKKDENPKTTGN |
Ga0209085_10053807 | 3300027741 | Freshwater Lake | MIVATWVVVGFFSAIGWWSANHYVIDPYFPEPIKKERKVEKND |
Ga0209597_10300052 | 3300027746 | Freshwater Lake | MVLEWIVVGFFSAIGWWSANHYVIEPYFPPPIEKIEKKEK |
Ga0209189_10663865 | 3300027747 | Freshwater Lake | SKWRLVAKMILVATWITVGFFSAIGWYGANHLVIEPYLPPPRQIEKKKDD |
Ga0209084_100344023 | 3300027749 | Freshwater Lake | MIILEWTIIGFFSAIGWWSANHYVIDPYFPQEITMEKKDEKGN |
Ga0209084_10075585 | 3300027749 | Freshwater Lake | MLVATWVVVGFFSAIGWWSANHYVIEPYFPEPVVKEKKMETKDQT |
Ga0209296_10033969 | 3300027759 | Freshwater Lake | MIIVATWTVVGFFSAIGWYGANHYVIEPYFPPPIERKKEEAK |
Ga0209296_10806455 | 3300027759 | Freshwater Lake | MILVATWITVGFFSAIGWYGANQFVIDPYFPEPKQKIERKNDQTTT |
Ga0209296_11124753 | 3300027759 | Freshwater Lake | MILVGTWVVVGFFSAIGWYGANHLVIEPYFPPPIERKKEEAK |
Ga0209296_11394891 | 3300027759 | Freshwater Lake | LMILVATWITVGFFSAIGWYGANHLVIEPYLPPPRVVEKKKDEQ |
Ga0209829_1004405313 | 3300027777 | Freshwater Lake | MILVATWITVGFFSAIGWYGANHLVIEPYLPPPRQIEKKKD |
Ga0209829_103869092 | 3300027777 | Freshwater Lake | MILVATWVTVGFFSAIGWYGANHLVIEPYLPPPRVVEKKREEQ |
Ga0209829_104157343 | 3300027777 | Freshwater Lake | NLRRNNMLVASWVVVGFFSAIGWWSANHYVIEPYFPEPIKKIEKQVEEK |
Ga0209500_100257208 | 3300027782 | Freshwater Lake | MLVVEWVVIGFFSAMGWWGANHYVIEPYFPEPIVKEKKVGTKE |
Ga0209191_10312235 | 3300027969 | Freshwater Lake | MILVGTWVVVGFFSAIGWYGANHYVIEPYFPPPIERKKDETK |
Ga0209401_12463562 | 3300027971 | Freshwater Lake | MILVATWVTVGFFSAIGWYGANHYVIEPYLPPPIERKKEE |
Ga0304729_100042918 | 3300028392 | Freshwater Lake | MILVATWVTVGFFSAIGWYGANHYVIEPHFPPPIEKKETK |
⦗Top⦘ |