Basic Information | |
---|---|
Family ID | F082567 |
Family Type | Metagenome |
Number of Sequences | 113 |
Average Sequence Length | 40 residues |
Representative Sequence | KANGLTVALGAGGTLSATYMSTPGNTTDLVFDVTGYYVP |
Number of Associated Samples | 75 |
Number of Associated Scaffolds | 112 |
Quality Assessment | |
---|---|
Transcriptomic Evidence | No |
Most common taxonomic group | Bacteria |
% of genes with valid RBS motifs | 1.80 % |
% of genes near scaffold ends (potentially truncated) | 95.58 % |
% of genes from short scaffolds (< 2000 bps) | 78.76 % |
Associated GOLD sequencing projects | 72 |
AlphaFold2 3D model prediction | Yes |
3D model pTM-score | 0.50 |
Hidden Markov Model |
---|
Powered by Skylign |
Most Common Taxonomy | |
---|---|
Group | Bacteria (69.912 % of family members) |
NCBI Taxonomy ID | 2 |
Taxonomy | All Organisms → cellular organisms → Bacteria |
Most Common Ecosystem | |
---|---|
GOLD Ecosystem | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Fen (15.044 % of family members) |
Environment Ontology (ENVO) | Unclassified (30.088 % of family members) |
Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (35.398 % of family members) |
⦗Top⦘ |
⦗Top⦘ |
Predicted Topology & Secondary Structure | |||||
---|---|---|---|---|---|
Classification: | Globular | Signal Peptide: | Yes | Secondary Structure distribution: | α-helix: 0.00% β-sheet: 0.00% Coil/Unstructured: 100.00% | Feature Viewer |
|
|||||
Powered by Feature Viewer |
Structure Viewer | |
---|---|
| |
Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.50 |
Powered by PDBe Molstar |
⦗Top⦘ |
Pfam ID | Name | % Frequency in 112 Family Scaffolds |
---|---|---|
PF08486 | SpoIID | 8.04 |
PF00535 | Glycos_transf_2 | 6.25 |
PF00534 | Glycos_transf_1 | 5.36 |
PF04989 | CmcI | 2.68 |
PF13641 | Glyco_tranf_2_3 | 2.68 |
PF01370 | Epimerase | 2.68 |
PF01943 | Polysacc_synt | 1.79 |
PF13439 | Glyco_transf_4 | 1.79 |
PF00908 | dTDP_sugar_isom | 1.79 |
PF13517 | FG-GAP_3 | 1.79 |
PF13361 | UvrD_C | 1.79 |
PF01863 | YgjP-like | 1.79 |
PF01230 | HIT | 1.79 |
PF00106 | adh_short | 0.89 |
PF00704 | Glyco_hydro_18 | 0.89 |
PF01979 | Amidohydro_1 | 0.89 |
PF13489 | Methyltransf_23 | 0.89 |
PF07221 | GlcNAc_2-epim | 0.89 |
PF13579 | Glyco_trans_4_4 | 0.89 |
PF16363 | GDP_Man_Dehyd | 0.89 |
PF13620 | CarboxypepD_reg | 0.89 |
PF13860 | FlgD_ig | 0.89 |
PF00872 | Transposase_mut | 0.89 |
PF00160 | Pro_isomerase | 0.89 |
PF01336 | tRNA_anti-codon | 0.89 |
PF08485 | Polysacc_syn_2C | 0.89 |
PF00753 | Lactamase_B | 0.89 |
PF02082 | Rrf2 | 0.89 |
PF13340 | DUF4096 | 0.89 |
PF00483 | NTP_transferase | 0.89 |
PF14667 | Polysacc_synt_C | 0.89 |
COG ID | Name | Functional Category | % Frequency in 112 Family Scaffolds |
---|---|---|---|
COG2385 | Peptidoglycan hydrolase (amidase) enhancer domain SpoIID | Cell wall/membrane/envelope biogenesis [M] | 8.04 |
COG3510 | Cephalosporin hydroxylase | Defense mechanisms [V] | 2.68 |
COG1086 | NDP-sugar epimerase, includes UDP-GlcNAc-inverting 4,6-dehydratase FlaA1 and capsular polysaccharide biosynthesis protein EpsC | Cell wall/membrane/envelope biogenesis [M] | 1.79 |
COG1451 | UTP pyrophosphatase, metal-dependent hydrolase family | General function prediction only [R] | 1.79 |
COG1898 | dTDP-4-dehydrorhamnose 3,5-epimerase or related enzyme | Cell wall/membrane/envelope biogenesis [M] | 1.79 |
COG0640 | DNA-binding transcriptional regulator, ArsR family | Transcription [K] | 0.89 |
COG0652 | Peptidyl-prolyl cis-trans isomerase (rotamase) - cyclophilin family | Posttranslational modification, protein turnover, chaperones [O] | 0.89 |
COG1414 | DNA-binding transcriptional regulator, IclR family | Transcription [K] | 0.89 |
COG1725 | DNA-binding transcriptional regulator YhcF, GntR family | Transcription [K] | 0.89 |
COG1959 | DNA-binding transcriptional regulator, IscR family | Transcription [K] | 0.89 |
COG2186 | DNA-binding transcriptional regulator, FadR family | Transcription [K] | 0.89 |
COG2188 | DNA-binding transcriptional regulator, GntR family | Transcription [K] | 0.89 |
COG2378 | Predicted DNA-binding transcriptional regulator YobV, contains HTH and WYL domains | Transcription [K] | 0.89 |
COG2524 | Predicted transcriptional regulator, contains C-terminal CBS domains | Transcription [K] | 0.89 |
COG2942 | Mannose or cellobiose epimerase, N-acyl-D-glucosamine 2-epimerase family | Carbohydrate transport and metabolism [G] | 0.89 |
COG3328 | Transposase (or an inactivated derivative) | Mobilome: prophages, transposons [X] | 0.89 |
⦗Top⦘ |
Name | Rank | Taxonomy | Distribution |
All Organisms | root | All Organisms | 69.91 % |
Unclassified | root | N/A | 30.09 % |
Visualization |
---|
Powered by ApexCharts |
Scaffold | Taxonomy | Length | IMG/M Link |
---|---|---|---|
2124908044|A5_c1_ConsensusfromContig19242 | Not Available | 646 | Open in IMG/M |
3300002069|JGIcombinedJ21912_10153466 | Not Available | 813 | Open in IMG/M |
3300003369|JGI24140J50213_10115865 | Not Available | 876 | Open in IMG/M |
3300003990|Ga0055455_10239444 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 574 | Open in IMG/M |
3300005471|Ga0070698_100045863 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 4472 | Open in IMG/M |
3300005879|Ga0075295_1043697 | Not Available | 592 | Open in IMG/M |
3300005886|Ga0075286_1063763 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 532 | Open in IMG/M |
3300005890|Ga0075285_1061349 | All Organisms → cellular organisms → Bacteria | 518 | Open in IMG/M |
3300006642|Ga0075521_10058857 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 1694 | Open in IMG/M |
3300006795|Ga0075520_1012396 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Actinomycetales | 4298 | Open in IMG/M |
3300006795|Ga0075520_1457132 | Not Available | 505 | Open in IMG/M |
3300009029|Ga0066793_10037025 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micrococcales → Dermatophilaceae → Dermatophilus → Dermatophilus congolensis | 2735 | Open in IMG/M |
3300009176|Ga0105242_12601478 | Not Available | 555 | Open in IMG/M |
3300009548|Ga0116107_1151555 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 639 | Open in IMG/M |
3300009615|Ga0116103_1004972 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 4878 | Open in IMG/M |
3300009615|Ga0116103_1027130 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1770 | Open in IMG/M |
3300009616|Ga0116111_1097915 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 745 | Open in IMG/M |
3300009617|Ga0116123_1006539 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 4581 | Open in IMG/M |
3300009617|Ga0116123_1011973 | All Organisms → cellular organisms → Bacteria | 3038 | Open in IMG/M |
3300009760|Ga0116131_1062239 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 1177 | Open in IMG/M |
3300009822|Ga0105066_1132336 | Not Available | 565 | Open in IMG/M |
3300009836|Ga0105068_1029919 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 950 | Open in IMG/M |
3300012355|Ga0137369_10587735 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 776 | Open in IMG/M |
3300012931|Ga0153915_10106899 | Not Available | 2980 | Open in IMG/M |
3300012955|Ga0164298_10090060 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Methylococcales → Methylococcaceae → Methyloterricola → Methyloterricola oryzae | 1598 | Open in IMG/M |
3300012960|Ga0164301_10251736 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Methylococcales → Methylococcaceae → Methyloterricola → Methyloterricola oryzae | 1160 | Open in IMG/M |
3300014490|Ga0182010_10041882 | All Organisms → cellular organisms → Bacteria | 2156 | Open in IMG/M |
3300014490|Ga0182010_10817075 | Not Available | 529 | Open in IMG/M |
3300014494|Ga0182017_10022819 | All Organisms → cellular organisms → Bacteria | 4309 | Open in IMG/M |
3300014494|Ga0182017_10131261 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 1628 | Open in IMG/M |
3300014494|Ga0182017_10778322 | Not Available | 578 | Open in IMG/M |
3300014498|Ga0182019_10571255 | Not Available | 791 | Open in IMG/M |
3300014498|Ga0182019_10600598 | Not Available | 773 | Open in IMG/M |
3300014498|Ga0182019_10692744 | Not Available | 722 | Open in IMG/M |
3300014498|Ga0182019_10737235 | Not Available | 701 | Open in IMG/M |
3300014502|Ga0182021_10020869 | All Organisms → cellular organisms → Bacteria | 7750 | Open in IMG/M |
3300014502|Ga0182021_10356303 | Not Available | 1730 | Open in IMG/M |
3300014502|Ga0182021_10361933 | Not Available | 1716 | Open in IMG/M |
3300014502|Ga0182021_11053534 | Not Available | 979 | Open in IMG/M |
3300014502|Ga0182021_13537003 | Not Available | 519 | Open in IMG/M |
3300014839|Ga0182027_10005297 | All Organisms → cellular organisms → Bacteria | 19651 | Open in IMG/M |
3300014839|Ga0182027_10188588 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 2399 | Open in IMG/M |
3300014839|Ga0182027_10528285 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 1283 | Open in IMG/M |
3300014969|Ga0157376_11920726 | Not Available | 629 | Open in IMG/M |
3300017929|Ga0187849_1087001 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 1351 | Open in IMG/M |
3300017940|Ga0187853_10241928 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 831 | Open in IMG/M |
3300017997|Ga0184610_1205761 | Not Available | 658 | Open in IMG/M |
3300018013|Ga0187873_1041613 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 2059 | Open in IMG/M |
3300018013|Ga0187873_1277934 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 616 | Open in IMG/M |
3300018023|Ga0187889_10000175 | All Organisms → cellular organisms → Bacteria | 75300 | Open in IMG/M |
3300018024|Ga0187881_10111174 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 1228 | Open in IMG/M |
3300018026|Ga0187857_10024975 | All Organisms → cellular organisms → Bacteria | 3283 | Open in IMG/M |
3300018028|Ga0184608_10119256 | All Organisms → cellular organisms → Bacteria | 1117 | Open in IMG/M |
3300018060|Ga0187765_10295110 | All Organisms → cellular organisms → Bacteria | 970 | Open in IMG/M |
3300018060|Ga0187765_10666384 | All Organisms → cellular organisms → Bacteria | 679 | Open in IMG/M |
3300018063|Ga0184637_10604971 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 619 | Open in IMG/M |
3300018075|Ga0184632_10155541 | All Organisms → cellular organisms → Bacteria | 1008 | Open in IMG/M |
3300018075|Ga0184632_10311570 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 680 | Open in IMG/M |
3300018075|Ga0184632_10316181 | Not Available | 674 | Open in IMG/M |
3300018078|Ga0184612_10313810 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 802 | Open in IMG/M |
3300022650|Ga0236339_1265451 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 526 | Open in IMG/M |
3300022694|Ga0222623_10067454 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 1383 | Open in IMG/M |
3300022694|Ga0222623_10361749 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 553 | Open in IMG/M |
3300023311|Ga0256681_11735016 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 627 | Open in IMG/M |
3300023311|Ga0256681_12545775 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 501 | Open in IMG/M |
3300025325|Ga0209341_10159930 | All Organisms → cellular organisms → Bacteria | 1893 | Open in IMG/M |
3300025326|Ga0209342_10081254 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 3013 | Open in IMG/M |
3300025441|Ga0208456_1071348 | Not Available | 625 | Open in IMG/M |
3300025448|Ga0208037_1036304 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 1021 | Open in IMG/M |
3300025725|Ga0209638_1047594 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 1776 | Open in IMG/M |
3300025764|Ga0209539_1300047 | Not Available | 550 | Open in IMG/M |
3300025846|Ga0209538_1045385 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 1896 | Open in IMG/M |
3300025888|Ga0209540_10358831 | Not Available | 809 | Open in IMG/M |
3300025888|Ga0209540_10423522 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 720 | Open in IMG/M |
3300025922|Ga0207646_10389732 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 1258 | Open in IMG/M |
3300026036|Ga0208650_1056420 | Not Available | 512 | Open in IMG/M |
3300026450|Ga0247847_1033016 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 686 | Open in IMG/M |
3300029980|Ga0302298_10258829 | Not Available | 576 | Open in IMG/M |
3300029989|Ga0311365_10243980 | All Organisms → cellular organisms → Bacteria | 1549 | Open in IMG/M |
3300030002|Ga0311350_11800957 | Not Available | 541 | Open in IMG/M |
3300030019|Ga0311348_10703102 | All Organisms → cellular organisms → Bacteria | 754 | Open in IMG/M |
3300031232|Ga0302323_100345130 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 1557 | Open in IMG/M |
3300031232|Ga0302323_100564782 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 1229 | Open in IMG/M |
3300031232|Ga0302323_101826884 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 688 | Open in IMG/M |
3300031834|Ga0315290_10168695 | All Organisms → cellular organisms → Bacteria | 1891 | Open in IMG/M |
3300031834|Ga0315290_11257579 | Not Available | 612 | Open in IMG/M |
3300031873|Ga0315297_10047342 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium GWC2_73_18 | 3243 | Open in IMG/M |
3300031873|Ga0315297_10158116 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1846 | Open in IMG/M |
3300031873|Ga0315297_10217286 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 1578 | Open in IMG/M |
3300031873|Ga0315297_10231907 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1527 | Open in IMG/M |
3300031918|Ga0311367_10902788 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 889 | Open in IMG/M |
3300031918|Ga0311367_11858728 | Not Available | 584 | Open in IMG/M |
3300031965|Ga0326597_10257641 | All Organisms → cellular organisms → Bacteria | 2008 | Open in IMG/M |
3300031965|Ga0326597_10393312 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 1543 | Open in IMG/M |
3300031965|Ga0326597_12152194 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 511 | Open in IMG/M |
3300031997|Ga0315278_10109778 | All Organisms → cellular organisms → Bacteria | 2788 | Open in IMG/M |
3300032164|Ga0315283_10233950 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1984 | Open in IMG/M |
3300032164|Ga0315283_10745965 | Not Available | 1052 | Open in IMG/M |
3300032177|Ga0315276_10336140 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1610 | Open in IMG/M |
3300032342|Ga0315286_10190261 | All Organisms → cellular organisms → Bacteria | 2196 | Open in IMG/M |
3300032397|Ga0315287_10013120 | All Organisms → cellular organisms → Bacteria | 8541 | Open in IMG/M |
3300032397|Ga0315287_10374289 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1685 | Open in IMG/M |
3300032397|Ga0315287_10374289 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1685 | Open in IMG/M |
3300032397|Ga0315287_10912973 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 1027 | Open in IMG/M |
3300032397|Ga0315287_11078022 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 931 | Open in IMG/M |
3300032401|Ga0315275_10969011 | Not Available | 936 | Open in IMG/M |
3300033433|Ga0326726_10614389 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 1046 | Open in IMG/M |
3300033486|Ga0316624_10054154 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 2584 | Open in IMG/M |
3300034195|Ga0370501_0019305 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 1974 | Open in IMG/M |
3300034195|Ga0370501_0081362 | Not Available | 1071 | Open in IMG/M |
3300034195|Ga0370501_0277993 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 601 | Open in IMG/M |
⦗Top⦘ |
Habitat | Taxonomy | Distribution |
Sediment | Environmental → Aquatic → Freshwater → Lake → Sediment → Sediment | 15.04% |
Fen | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Fen | 15.04% |
Arctic Peat Soil | Environmental → Terrestrial → Soil → Unclassified → Permafrost → Arctic Peat Soil | 9.73% |
Peatland | Environmental → Aquatic → Freshwater → Wetlands → Unclassified → Peatland | 7.96% |
Fen | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Fen | 7.96% |
Peatland | Environmental → Aquatic → Freshwater → Wetlands → Bog → Peatland | 6.19% |
Groundwater Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment | 6.19% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 4.42% |
Rice Paddy Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Rice Paddy Soil | 3.54% |
Freshwater | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater | 2.65% |
Untreated Peat Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Untreated Peat Soil | 2.65% |
Groundwater Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment | 1.77% |
Tropical Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland | 1.77% |
Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 1.77% |
Soil | Environmental → Terrestrial → Soil → Loam → Unclassified → Soil | 1.77% |
Groundwater Sand | Environmental → Terrestrial → Soil → Sand → Unclassified → Groundwater Sand | 1.77% |
Soil | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Soil | 1.77% |
Freshwater Wetlands | Environmental → Aquatic → Freshwater → Wetlands → Unclassified → Freshwater Wetlands | 0.89% |
Natural And Restored Wetlands | Environmental → Aquatic → Marine → Wetlands → Unclassified → Natural And Restored Wetlands | 0.89% |
Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 0.89% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Permafrost → Soil | 0.89% |
Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 0.89% |
Prmafrost Soil | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Prmafrost Soil | 0.89% |
Peat Soil | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Peat Soil | 0.89% |
Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 0.89% |
Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 0.89% |
Visualization |
---|
Powered by ApexCharts |
Taxon OID | Sample Name | Habitat Type | IMG/M Link |
---|---|---|---|
2124908044 | Soil microbial communities from permafrost in Bonanza Creek, Alaska, sample from Active Layer A5 | Environmental | Open in IMG/M |
3300002069 | Barrow Graham LP Ref core NGADG0002-212 (Barrow Graham LP Ref core NGADG0002-212,NGADG0004-211, ASSEMBLY_DATE=20131010) | Environmental | Open in IMG/M |
3300003369 | Arctic peat soil from Barrow, Alaska - Barrow Graham LP Incubations 002-22A | Environmental | Open in IMG/M |
3300003990 | Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - Goodyear_PhragC_D2 | Environmental | Open in IMG/M |
3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Environmental | Open in IMG/M |
3300005879 | Rice paddy soil microbial communities from Twitchell Island, California, USA - SF_Rice_25C_0N_301 | Environmental | Open in IMG/M |
3300005886 | Rice paddy soil microbial communities from Twitchell Island, California, USA - SF_Rice_20C_0N_205 | Environmental | Open in IMG/M |
3300005890 | Rice paddy soil microbial communities from Twitchell Island, California, USA - SF_Rice_20C_0N_104 | Environmental | Open in IMG/M |
3300006642 | Arctic peat soil microbial communities from the Barrow Environmental Observatory site, Barrow, Alaska, USA - NGEE PermafrostAB12-D | Environmental | Open in IMG/M |
3300006795 | Arctic peat soil microbial communities from the Barrow Environmental Observatory site, Barrow, Alaska, USA - NGEE PermafrostAB12-B | Environmental | Open in IMG/M |
3300009029 | Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Permafrost soil replicate 1 DNA2013-189 | Environmental | Open in IMG/M |
3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Host-Associated | Open in IMG/M |
3300009548 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_6_100 | Environmental | Open in IMG/M |
3300009615 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_4_100 | Environmental | Open in IMG/M |
3300009616 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_8_100 | Environmental | Open in IMG/M |
3300009617 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_13_100 | Environmental | Open in IMG/M |
3300009760 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_17_100 | Environmental | Open in IMG/M |
3300009822 | Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW S1_30_40 | Environmental | Open in IMG/M |
3300009836 | Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW N1_10_20 | Environmental | Open in IMG/M |
3300012355 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_113_16 metaG | Environmental | Open in IMG/M |
3300012931 | Freshwater wetland microbial communities from Ohio, USA - Open water 3 Core 3 Depth 3 metaG | Environmental | Open in IMG/M |
3300012955 | Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_216_MG | Environmental | Open in IMG/M |
3300012960 | Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_231_MG | Environmental | Open in IMG/M |
3300014490 | Permafrost microbial communities from Stordalen Mire, Sweden - 611E1M metaG | Environmental | Open in IMG/M |
3300014494 | Permafrost microbial communities from Stordalen Mire, Sweden - 712E3D metaG | Environmental | Open in IMG/M |
3300014498 | Permafrost microbial communities from Stordalen Mire, Sweden - 812E2M metaG | Environmental | Open in IMG/M |
3300014502 | Permafrost microbial communities from Stordalen Mire, Sweden - 612E3M metaG (Illumina Assembly) | Environmental | Open in IMG/M |
3300014839 | Permafrost microbial communities from Stordalen Mire, Sweden - 712E1D metaG (Illumina Assembly) | Environmental | Open in IMG/M |
3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Host-Associated | Open in IMG/M |
3300017929 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_4_100 | Environmental | Open in IMG/M |
3300017940 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_6_100 | Environmental | Open in IMG/M |
3300017997 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_100_coex | Environmental | Open in IMG/M |
3300018013 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_16_100 | Environmental | Open in IMG/M |
3300018023 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_7_100 | Environmental | Open in IMG/M |
3300018024 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_19_100 | Environmental | Open in IMG/M |
3300018026 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_8_100 | Environmental | Open in IMG/M |
3300018028 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_30_coex | Environmental | Open in IMG/M |
3300018060 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_QUI02_MP05_10_MG | Environmental | Open in IMG/M |
3300018063 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3_127_b2 | Environmental | Open in IMG/M |
3300018075 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3-1_50_b1 | Environmental | Open in IMG/M |
3300018078 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3_60_coex | Environmental | Open in IMG/M |
3300022650 | Freshwater microbial communities from thermokarst lake SAS2a, Kuujjuarapick, Canada - Sample Winter W3 | Environmental | Open in IMG/M |
3300022694 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM2_30_coex | Environmental | Open in IMG/M |
3300023311 | Combined Assembly of Gp0281739, Gp0281740, Gp0281741 | Environmental | Open in IMG/M |
3300025325 | Soil microbial communities from Rifle, Colorado - Rifle CSP2_sed 13_2 (SPAdes) | Environmental | Open in IMG/M |
3300025326 | Soil microbial communities from Rifle, Colorado - Rifle CSP2_sed 16_2 (SPAdes) | Environmental | Open in IMG/M |
3300025441 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_4_100 (SPAdes) | Environmental | Open in IMG/M |
3300025448 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_13_100 (SPAdes) | Environmental | Open in IMG/M |
3300025725 | Arctic peat soil from Barrow, Alaska - Barrow Graham LP Ref core NGADG0002-211 (SPAdes) | Environmental | Open in IMG/M |
3300025764 | Arctic peat soil from Barrow, Alaska - Barrow Graham LP Ref core NGADG0011-312 (SPAdes) | Environmental | Open in IMG/M |
3300025846 | Arctic peat soil from Barrow, Alaska - Barrow Graham LP Ref core NGADG0004-211 (SPAdes) | Environmental | Open in IMG/M |
3300025857 | Arctic peat soil from Barrow, Alaska - Barrow Graham LP Ref core NGADG0002-212 (SPAdes) | Environmental | Open in IMG/M |
3300025888 | Arctic peat soil from Barrow, Alaska - Barrow Graham LP Incubations 011-21A (SPAdes) | Environmental | Open in IMG/M |
3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) | Environmental | Open in IMG/M |
3300026036 | Rice paddy soil microbial communities from Twitchell Island, California, USA - SF_Rice_10C_0N_404 (SPAdes) | Environmental | Open in IMG/M |
3300026450 | Peat soil microbial communities from Stordalen Mire, Sweden - P.F.S.T25 | Environmental | Open in IMG/M |
3300029980 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - III_Fen_N3_3 | Environmental | Open in IMG/M |
3300029989 | III_Fen_N1 coassembly | Environmental | Open in IMG/M |
3300030002 | II_Fen_N1 coassembly | Environmental | Open in IMG/M |
3300030019 | II_Fen_E2 coassembly | Environmental | Open in IMG/M |
3300031232 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Fen_T0_3 | Environmental | Open in IMG/M |
3300031834 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G12_0 | Environmental | Open in IMG/M |
3300031873 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G15_0 | Environmental | Open in IMG/M |
3300031918 | III_Fen_N3 coassembly | Environmental | Open in IMG/M |
3300031965 | Soil microbial communities from uranium-contaminated site in the Upper Colorado River Basin, Wyoming, United States - RVT100D185 | Environmental | Open in IMG/M |
3300031997 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G06_0 | Environmental | Open in IMG/M |
3300032164 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G09_0 | Environmental | Open in IMG/M |
3300032177 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G05_0 | Environmental | Open in IMG/M |
3300032342 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G10_0 | Environmental | Open in IMG/M |
3300032397 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G11_0 | Environmental | Open in IMG/M |
3300032401 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G03_0 | Environmental | Open in IMG/M |
3300033433 | Lab enriched peat soil microbial communities from Michigan Hollow, Ithaca, NY, United States - MHF15MN | Environmental | Open in IMG/M |
3300033486 | Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_Aug_N3_C1_D5_A | Environmental | Open in IMG/M |
3300033820 | Peat soil microbial communities from Stordalen Mire, Sweden - 713 E-2-D | Environmental | Open in IMG/M |
3300034195 | Peat soil microbial communities from wetlands in Alaska, United States - Sheep_creek_fen_01D_17 | Environmental | Open in IMG/M |
Geographical Distribution | |
---|---|
Zoom: | Powered by OpenStreetMap |
⦗Top⦘ |
Protein ID | Sample Taxon ID | Habitat | Sequence |
A5_c1_00302360 | 2124908044 | Soil | NFPVRDTRANGVTVALSGSGTLNALYTGPAGATIHILFDVTGYFK |
JGIcombinedJ21912_101534662 | 3300002069 | Arctic Peat Soil | TRANGVTVRLSAKGTLSAVFKGTAGATTALVFDVTGYFLP* |
JGI24140J50213_101158652 | 3300003369 | Arctic Peat Soil | GDIKGNGLTVALGAAGTLSVTYISTPGNTTDLVFDVTGYYVP* |
Ga0055455_102394441 | 3300003990 | Natural And Restored Wetlands | DTRANGITVPLGADGTLSATLKGASGATTALVFDVTGYFLP* |
Ga0070698_1000458637 | 3300005471 | Corn, Switchgrass And Miscanthus Rhizosphere | DNRANGVTVALGAGGTLSITYLAASGTTDFVFDVTGYFVP* |
Ga0075295_10436972 | 3300005879 | Rice Paddy Soil | RANGVTVALGSGGKLSATYISSAGGTTQLIFDVTGYFVP* |
Ga0075286_10637631 | 3300005886 | Rice Paddy Soil | GVTVGLGSGGTLSATFVATAGARTNLVFDVTGYFTP* |
Ga0075285_10613491 | 3300005890 | Rice Paddy Soil | GDIRANGMTVKLGAGGTLSAVYKAGGGTTDLVYDVFGYYK* |
Ga0075521_100588571 | 3300006642 | Arctic Peat Soil | NRGDIKANGLTVALGAGGTLSATYMSTPGNTTDLVFDVTGYYVP* |
Ga0075520_10123961 | 3300006795 | Arctic Peat Soil | KGNGLTVALSATGSLSATYMSNPGNTTNLVFDVTGYFVP* |
Ga0075520_14571321 | 3300006795 | Arctic Peat Soil | LTVALSSGGTLSSTYMSTAGNTTDLVFDVTGYFVPAAG* |
Ga0066793_100370251 | 3300009029 | Prmafrost Soil | TGVTVALGTGGTLSAVFKGSGGTTALVFDVTGYFVR* |
Ga0105242_126014782 | 3300009176 | Miscanthus Rhizosphere | STINVPVGDNRANGVDVGLAANGSLSAVWVGNTPTSTTHVIFDVTGYFR* |
Ga0116107_11515552 | 3300009548 | Peatland | TVALGSGGTLSATYMSNPGNRTDLVFDVSGYYAP* |
Ga0116103_10049724 | 3300009615 | Peatland | QIVGNGLTVALGSGGTLSATYMSTAGNKTDLVFDVAGYFAP* |
Ga0116103_10271303 | 3300009615 | Peatland | TVALGSAGTLSATYMSTAGATTDLVFDVTGYFTP* |
Ga0116111_10979152 | 3300009616 | Peatland | LTVALGSAGTLSATYMSTAGATTDLVFDVTGYFTP* |
Ga0116123_10065391 | 3300009617 | Peatland | IVGNGLTVALGSGGTLSATYLSTAGAKTDLVFDVSGYFAP* |
Ga0116123_10119731 | 3300009617 | Peatland | EILANGLTVALGSAGTLSATYMSTAGATTDLVFDVTGYFTP* |
Ga0116131_10622391 | 3300009760 | Peatland | VGNGLTVALGSGGTLSATYMSTAGNKTDLVFDVSGYFAP* |
Ga0105066_11323362 | 3300009822 | Groundwater Sand | GVTVALGAGGALSATYISGTGGYTHLVFDVTGYFMP* |
Ga0105068_10299191 | 3300009836 | Groundwater Sand | NGVTVALGAGGALSATYISGTGGYTHLVFDVTGYFMP* |
Ga0137369_105877353 | 3300012355 | Vadose Zone Soil | VTVGLGGAGTLSITYLASSGASTDFVFDVTGYFVH* |
Ga0153915_101068991 | 3300012931 | Freshwater Wetlands | DNRANGVTVTLSGSGTLSATYMASAGASTQLVFDVTGYFVP* |
Ga0164298_100900601 | 3300012955 | Soil | LTVALSPAGTLSATFVGSSSATAQIVFDVTGYYQ* |
Ga0164301_102517361 | 3300012960 | Soil | NGLTVALSPAGTLSATFVGSSSATAQVVFDVTGYYQ* |
Ga0182010_100418821 | 3300014490 | Fen | TVALSSSGTLSATYMAGAGATTDLVFDVTGYFTK* |
Ga0182010_108170751 | 3300014490 | Fen | IKGNGLAVGLGSGGSLSATYISTAGNKTDLVFDVTGYFTP* |
Ga0182017_100228196 | 3300014494 | Fen | GDIVANGVTVALSSSGTLSATYMAGAGATTDLVFDVTGYFTK* |
Ga0182017_101312613 | 3300014494 | Fen | MTVALSGIESLSVTYMPNPGNRTDLVFDVSGYYAP* |
Ga0182017_107783221 | 3300014494 | Fen | FVKGDIKGNGLAVALGSGGSLSATYVSLAGNTTDLVFDVTGYFAP* |
Ga0182019_105712552 | 3300014498 | Fen | TVALSATGTLSATYSGGVGQTTQLIFDVTGYFVP* |
Ga0182019_106005981 | 3300014498 | Fen | NRANGVTVALSGSGSLWALYDTGGPGQTSDLVFDVTGYFVP* |
Ga0182019_106927441 | 3300014498 | Fen | NRANGVTAALSATGTLSATYIAGAGQTTQLIFDVTGYFVPLR* |
Ga0182019_107372351 | 3300014498 | Fen | SNGVTVALSGGGALSVTYMGGPGATTNVAFVVTGYFAP* |
Ga0182021_100208691 | 3300014502 | Fen | NRANGVTVALSGTGGLSATFVGSSGGATTDLLFDVTGYFVP* |
Ga0182021_103563033 | 3300014502 | Fen | VKGDIKGNGLAVALGSGGGLSATYMSTTGNTTDLVFDVTGYFAP* |
Ga0182021_103619333 | 3300014502 | Fen | KGNGLAVALGSGGSLSATYVSVAGNTTDLVFDVTGYFAP* |
Ga0182021_110535343 | 3300014502 | Fen | DNRANGVTVALSATGTLSATYSGGVGQTTQLIFDVTGYFVP* |
Ga0182021_135370031 | 3300014502 | Fen | ANGVTVALSGTGSLSATFVGSSGSATTQLIFDVTGYFVP* |
Ga0182027_100052971 | 3300014839 | Fen | NGLTVALSSSGTLSATYISSAGATTDLVFDVTGYFTP* |
Ga0182027_101885882 | 3300014839 | Fen | GVTVALGSGGTLSATYISYSGNTTDLIFDATGYYEP* |
Ga0182027_105282851 | 3300014839 | Fen | KGNGLAVALGSGGGLSATYMSTTGNTTDLVFDVTGFFAP* |
Ga0157376_119207262 | 3300014969 | Miscanthus Rhizosphere | PLGDTRANGLTVALSPAGTLSATYVASSSSATAQVLFDVTGYYQ* |
Ga0187849_10870011 | 3300017929 | Peatland | IVGNGLTVALGSGGTLSATYLSTAGAKTDLVFDVSGYFAP |
Ga0187853_102419281 | 3300017940 | Peatland | NGVTVALGSGGTLSATYMSNPGNRTDLVFDVSGYYAP |
Ga0184610_12057612 | 3300017997 | Groundwater Sediment | DNRANGVTVALGAGGSLSATYRALGGAGSTDLVFDVTGYFVP |
Ga0187873_10416133 | 3300018013 | Peatland | LANGVTVGLSGTGTLSATYISTTGQTTNLVFDVTGYFVH |
Ga0187873_12779342 | 3300018013 | Peatland | TTVGLASGGILYPTYMSNAGNTTDLVLDVTGYFLP |
Ga0187889_100001751 | 3300018023 | Peatland | EILANGLTVALGSAGTLSATYMSTAGATTDLVFDVTGYFTP |
Ga0187881_101111742 | 3300018024 | Peatland | FKKGQIVGNGLTVALGSGGTLSATYLSTAGAKTDLVFDVSGYFAP |
Ga0187857_100249755 | 3300018026 | Peatland | IAGNGVTVALGSGGTLSATYMSNPGNRTDLVFDVSGYYAP |
Ga0184608_101192564 | 3300018028 | Groundwater Sediment | LGDTRANGVTVALSLSGTLSATFGYAGSTQLIFDVTGYFVE |
Ga0187765_102951102 | 3300018060 | Tropical Peatland | NGLAVAVGSSGTLSGVYMSISGNTTDVVVDVTGYFAP |
Ga0187765_106663842 | 3300018060 | Tropical Peatland | LGTGGTLSATYMSNLGNTTHLVFDVTGYFEMPIPS |
Ga0184637_106049711 | 3300018063 | Groundwater Sediment | LNFPAGDSRANGVTAALSPTGSLSATYGPSSGAATDLVFDVTGYFVP |
Ga0184632_101555411 | 3300018075 | Groundwater Sediment | PLGDTRANGVTVALGLDGTLSATFAYSGSTDLIFDVTGYFVD |
Ga0184632_103115701 | 3300018075 | Groundwater Sediment | LGDTRANGVTVALSSTGSLSATFGYAGTTDLVFDVTGYFVP |
Ga0184632_103161811 | 3300018075 | Groundwater Sediment | DNRANGVTVALGPGGTLSATYVTGSWSGTTDVVFDVTGYFVP |
Ga0184612_103138101 | 3300018078 | Groundwater Sediment | RANGVTVALGPGGALSATYISGTGGSTHLVFDVTGYFVP |
Ga0236339_12654511 | 3300022650 | Freshwater | KGQVTGNGLTVALSATGSLSATYISSPGNTTDLVFEVTGYFGP |
Ga0222623_100674544 | 3300022694 | Groundwater Sediment | TGVTVALGPGGTLSATSGYAGTTDLVFDVTGYFFLN |
Ga0222623_103617491 | 3300022694 | Groundwater Sediment | VGDTRSNGVTVALSSTGTLSATFGYAGSTDLVFDVTGYFVP |
Ga0256681_117350161 | 3300023311 | Freshwater | VKGNGLTVALGSGGKLSATYISTAGNVTDLVFDVTGYFVPAGG |
Ga0256681_125457751 | 3300023311 | Freshwater | NFLAGDIRGNGLTIPLGSGGTLSATYLSTSGNTTDLVVDVTGYFAP |
Ga0209341_101599303 | 3300025325 | Soil | ANGVTLALSGSGTLSATYLAAAGKTTDFIFDVTGYFDAP |
Ga0209342_100812545 | 3300025326 | Soil | ADNRANGVTLALGAGGTLSATLAPSGTTDLVFDVTGYFVD |
Ga0208456_10713481 | 3300025441 | Peatland | DIRANNLAVALSGTGTLSATYMSSAGNKTDLVFDVTGYFVP |
Ga0208037_10363041 | 3300025448 | Peatland | QIVGNGLTVALGSGGTLSATYLSTAGAKTDLVFDVSGYFAP |
Ga0209638_10475942 | 3300025725 | Arctic Peat Soil | GLTVALGSGGTLSATYMSFAGNTTDLVFDVTGYYVP |
Ga0209539_13000471 | 3300025764 | Arctic Peat Soil | PKGDTRATGVTVALGTGGTLSAVFKGSGGTTALVFDVTGYFR |
Ga0209538_10453852 | 3300025846 | Arctic Peat Soil | TGVTVTLGAGGTLSAVFKGGGGATTALVFDVTGYFR |
Ga0209014_101209801 | 3300025857 | Arctic Peat Soil | GVTVALSGTGTLSATYMGSVGGATTDLLFDVTGYFVP |
Ga0209540_103588312 | 3300025888 | Arctic Peat Soil | PVGDTRATGVTVTLGAGGTLSAVFRGGGGTTTALVFDVTGYFR |
Ga0209540_104235221 | 3300025888 | Arctic Peat Soil | KGDTRATGVTVALGTGGTLSAFFKGATGATTALIFDVTGYFVR |
Ga0207646_103897323 | 3300025922 | Corn, Switchgrass And Miscanthus Rhizosphere | VGDNRANGVTVALGAGGTLSITYLAASGTTDFVFDVTGYFVP |
Ga0208650_10564202 | 3300026036 | Rice Paddy Soil | LGDNRANGVTVGLGSGGTLSATFVATAGARTNLVFDVTGYFTP |
Ga0247847_10330162 | 3300026450 | Soil | VKDNGVTVSLSATGMLSATYMSTPKNTTDLVLDVTGYFVP |
Ga0302298_102588291 | 3300029980 | Fen | FKAGDIRANGLTVALGLGGILSATYISTPGNTTDLVFDMTGYFVPAG |
Ga0311365_102439801 | 3300029989 | Fen | GLTVALGAGGTLSATYMSTPGNTTDLVFDVTGYYVP |
Ga0311350_118009571 | 3300030002 | Fen | ANGLTVALGLGGILSATYISTAGNTTDLVFDMTGYFVPAG |
Ga0311348_107031022 | 3300030019 | Fen | NFNKGDIKANGLTVELSPTGTLAVTYISTAGNTTDLVFDVTGYYLP |
Ga0302323_1003451302 | 3300031232 | Fen | KANGLTVALGAGGTLSATYMSTPGNTTDLVFDVTGYYVP |
Ga0302323_1005647821 | 3300031232 | Fen | LTVALGLGGILSATYISTAGNTTDLVFDMTGYFVPAG |
Ga0302323_1018268842 | 3300031232 | Fen | GLTVALGVGGILSATYISTAGNTTDLVFDMTGYFVPAG |
Ga0315290_101686951 | 3300031834 | Sediment | NRANGVTVALSATGTLSATYMGEVGSATTHLVFDVTGYFVP |
Ga0315290_112575791 | 3300031834 | Sediment | ANGVTVALSGTGTLSATYMGEVGSATTHLIFDVTGYFVP |
Ga0315297_100473422 | 3300031873 | Sediment | VTVALSATGTLSATYMGEVGSATTHLVFDVTGYFVP |
Ga0315297_101581163 | 3300031873 | Sediment | NGVTVALSGTGTLSATYMGEAGPSATTHLIFDVTGYFVP |
Ga0315297_102172861 | 3300031873 | Sediment | FPLGDNRANGVTVALSGTGTLSATYMGEVGTATTHLIFDVTGYFVP |
Ga0315297_102319072 | 3300031873 | Sediment | NGVTVALSATGTLSATYMGEVGSATTHLVFDVTGYFVP |
Ga0311367_109027881 | 3300031918 | Fen | KANGLTVALSPSGTLSATYMSTPGNATDLVFDVTGYYVP |
Ga0311367_118587281 | 3300031918 | Fen | RGDIKGNGLAVGLGSGGSLSATYISNAGNKTDLVFDVTGYFTP |
Ga0326597_102576411 | 3300031965 | Soil | GQTIANGVTVALGAGGTLSATYLSSPGKTVALIFDVTGYFVP |
Ga0326597_103933121 | 3300031965 | Soil | GDNVANGVTVALGAGGTLSATYLSTPGNTTALVFDVTGYFVP |
Ga0326597_121521942 | 3300031965 | Soil | RANGVTVALSPTGSLSATNGYAGTTDLVFDVTGYFVP |
Ga0315278_101097781 | 3300031997 | Sediment | DWANGVTVPLGGTGTLSATYVTGGPGHTTHLVFDVTGYFVPE |
Ga0315283_102339501 | 3300032164 | Sediment | NRANGVTVALSGTGTLSATYMGEAGPSATTHLIFDVTGYFVP |
Ga0315283_107459651 | 3300032164 | Sediment | DNRANGVTVPLSGTGTLSATYLENGPGSPTTHLIFDVTGYFAP |
Ga0315276_103361401 | 3300032177 | Sediment | DNRANGVTVALSATGTLSATYVGAAGPSATTHLIFDVTGYFAP |
Ga0315286_101902611 | 3300032342 | Sediment | RANGVTVALSATGTLSATYMGEVGSATTHLVFDVTGYFVP |
Ga0315287_100131209 | 3300032397 | Sediment | GVTVALSGTGTLSATYMGEAGPSATTHLIFDVTGYFVP |
Ga0315287_103742891 | 3300032397 | Sediment | GVTVALSATGTLSATYVGAAGPSATTHLIFDVTGYFAP |
Ga0315287_103742893 | 3300032397 | Sediment | NFPVGDNRANGVTVALSATGTLSATYVGAAGPSATTHLIFDVTGYFVP |
Ga0315287_109129732 | 3300032397 | Sediment | VNRANGVTVALSRTGTLSATYMGAAGPSATTDLIFDVTGYFVP |
Ga0315287_110780222 | 3300032397 | Sediment | FPVGDNRANGVTVALSATGTLSATYVGAAGPSATTHLIFDVTGYFVP |
Ga0315275_109690112 | 3300032401 | Sediment | NGVTVALSGTGTLSATYMGEVGTATTHLIFDVTGYFVP |
Ga0326726_106143891 | 3300033433 | Peat Soil | TVALGAGGTLSATYLAPAGATTDLIFDVTGYFVPE |
Ga0316624_100541544 | 3300033486 | Soil | GLTVELGLSGSLSATYISFGGETTDLILDMTGYFVK |
Ga0334817_023806_11_118 | 3300033820 | Soil | VTVTLGAGGILYVTYVGSAGATTQVSFDVTGYFVK |
Ga0370501_0019305_13_123 | 3300034195 | Untreated Peat Soil | VTVALSGTGTLSATYMGETGSATTHLIFDVTGYFLP |
Ga0370501_0081362_960_1070 | 3300034195 | Untreated Peat Soil | TVALGSGGTLSATYAGEAGPSATTQLIFDVTGFFVH |
Ga0370501_0277993_2_130 | 3300034195 | Untreated Peat Soil | GDIKGNGLTVALGAGGTLSVTYISTPGNTTDLVLDVTGYYVP |
⦗Top⦘ |