NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome Family F082558

Metagenome Family F082558

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F082558
Family Type Metagenome
Number of Sequences 113
Average Sequence Length 46 residues
Representative Sequence MKTKKLVKNALKHPELYGPAELAFFKRWLDSKKQAKAAKINKDKKKDS
Number of Associated Samples 80
Number of Associated Scaffolds 113

Quality Assessment
Transcriptomic Evidence No
Most common taxonomic group Bacteria
% of genes with valid RBS motifs 49.11 %
% of genes near scaffold ends (potentially truncated) 30.97 %
% of genes from short scaffolds (< 2000 bps) 62.83 %
Associated GOLD sequencing projects 72
AlphaFold2 3D model prediction Yes
3D model pTM-score0.56

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Bacteria (50.442 % of family members)
NCBI Taxonomy ID 2
Taxonomy All Organisms → cellular organisms → Bacteria

Most Common Ecosystem
GOLD Ecosystem Environmental → Aquatic → Marine → Coastal → Unclassified → Aqueous
(17.699 % of family members)
Environment Ontology (ENVO) Unclassified
(38.938 % of family members)
Earth Microbiome Project Ontology (EMPO) Free-living → Saline → Water (saline)
(53.097 % of family members)


 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      

 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Globular Signal Peptide: No Secondary Structure distribution: α-helix: 55.26%    β-sheet: 0.00%    Coil/Unstructured: 44.74%
Feature Viewer
Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer
Per-residue confidence (pLDDT):
  0-50   51-70   71-90   91-100  		pTM-score: 0.56
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.

 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 113 Family Scaffolds
PF04014MazE_antitoxin 15.93
PF03237Terminase_6N 11.50
PF01844HNH 1.77
PF13392HNH_3 0.88
PF136402OG-FeII_Oxy_3 0.88
PF01476LysM 0.88
PF13649Methyltransf_25 0.88


 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms55.75 %
UnclassifiedrootN/A44.25 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
3300000116|DelMOSpr2010_c10001755Not Available12974Open in IMG/M
3300000116|DelMOSpr2010_c10008525All Organisms → cellular organisms → Bacteria5455Open in IMG/M
3300000124|BS_KBA_SWE12_21mDRAFT_c10055885Not Available1047Open in IMG/M
3300000124|BS_KBA_SWE12_21mDRAFT_c10077797All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Alteromonadales → Alteromonadaceae → Alteromonas/Salinimonas group → Alteromonas → Alteromonas australica837Open in IMG/M
3300000882|FwDRAFT_10176452All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Nostocales → Nostocaceae → Trichormus → Trichormus variabilis3559Open in IMG/M
3300001855|JGI2160J19893_10122871All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Alteromonadales → Alteromonadaceae → Alteromonas/Salinimonas group → Alteromonas → Alteromonas australica503Open in IMG/M
3300001934|GOS2267_103089All Organisms → cellular organisms → Bacteria1831Open in IMG/M
3300002835|B570J40625_101068899All Organisms → cellular organisms → Bacteria684Open in IMG/M
3300002835|B570J40625_101334359Not Available594Open in IMG/M
3300004240|Ga0007787_10139305Not Available1158Open in IMG/M
3300004369|Ga0065726_16637Not Available12476Open in IMG/M
3300005512|Ga0074648_1001797Not Available21185Open in IMG/M
3300005512|Ga0074648_1053186All Organisms → cellular organisms → Bacteria1733Open in IMG/M
3300005805|Ga0079957_1003247Not Available13916Open in IMG/M
3300005940|Ga0073913_10026116Not Available863Open in IMG/M
3300006734|Ga0098073_1008614Not Available1822Open in IMG/M
3300006734|Ga0098073_1033463Not Available717Open in IMG/M
3300006790|Ga0098074_1034800All Organisms → cellular organisms → Archaea → DPANN group → Candidatus Woesearchaeota → Candidatus Woesearchaeota archaeon1453Open in IMG/M
3300006802|Ga0070749_10032192All Organisms → cellular organisms → Bacteria3262Open in IMG/M
3300006810|Ga0070754_10008866All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria6468Open in IMG/M
3300006810|Ga0070754_10034847Not Available2775Open in IMG/M
3300007212|Ga0103958_1101630All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Nostocales → Nostocaceae → Trichormus → Trichormus variabilis4873Open in IMG/M
3300007538|Ga0099851_1023562Not Available2485Open in IMG/M
3300007539|Ga0099849_1014056All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium3538Open in IMG/M
3300007539|Ga0099849_1264838Not Available628Open in IMG/M
3300007539|Ga0099849_1364761All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Alteromonadales → Alteromonadaceae → Alteromonas/Salinimonas group → Alteromonas → Alteromonas australica511Open in IMG/M
3300007541|Ga0099848_1116759All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Alteromonadales → Alteromonadaceae → Alteromonas/Salinimonas group → Alteromonas → Alteromonas australica1011Open in IMG/M
3300007640|Ga0070751_1096703All Organisms → Viruses → unclassified bacterial viruses → Synechococcus phage S-EIVl1224Open in IMG/M
3300007735|Ga0104988_10270Not Available12685Open in IMG/M
3300007735|Ga0104988_10574Not Available18170Open in IMG/M
3300007960|Ga0099850_1389224Not Available517Open in IMG/M
3300008055|Ga0108970_10082708All Organisms → Viruses → unclassified bacterial viruses → Synechococcus phage S-EIVl2152Open in IMG/M
3300009159|Ga0114978_10162419Not Available1432Open in IMG/M
3300009183|Ga0114974_10000063Not Available82433Open in IMG/M
3300009529|Ga0114919_10276414All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Alteromonadales → Alteromonadaceae → Alteromonas/Salinimonas group → Alteromonas → Alteromonas australica1183Open in IMG/M
3300010296|Ga0129348_1255033Not Available589Open in IMG/M
3300010296|Ga0129348_1325262All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Alteromonadales → Alteromonadaceae → Alteromonas/Salinimonas group → Alteromonas → Alteromonas australica512Open in IMG/M
3300010297|Ga0129345_1241835Not Available632Open in IMG/M
3300010299|Ga0129342_1071665All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Alteromonadales → Alteromonadaceae → Alteromonas/Salinimonas group → Alteromonas → Alteromonas australica1329Open in IMG/M
3300010300|Ga0129351_1190262Not Available799Open in IMG/M
3300010300|Ga0129351_1201473All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Alteromonadales → Alteromonadaceae → Alteromonas/Salinimonas group → Alteromonas → Alteromonas australica772Open in IMG/M
3300010318|Ga0136656_1319437All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Alteromonadales → Alteromonadaceae → Alteromonas/Salinimonas group → Alteromonas → Alteromonas australica502Open in IMG/M
3300010354|Ga0129333_10027284Not Available5405Open in IMG/M
3300010354|Ga0129333_10190491All Organisms → cellular organisms → Bacteria1868Open in IMG/M
3300010354|Ga0129333_10222781Not Available1710Open in IMG/M
3300010354|Ga0129333_10602542All Organisms → cellular organisms → Bacteria953Open in IMG/M
3300010354|Ga0129333_10757125All Organisms → Viruses → unclassified bacterial viruses → Synechococcus phage S-EIVl831Open in IMG/M
3300010370|Ga0129336_10117517Not Available1552Open in IMG/M
3300010370|Ga0129336_10193711All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Alteromonadales → Alteromonadaceae → Alteromonas/Salinimonas group → Alteromonas → Alteromonas australica1159Open in IMG/M
3300010370|Ga0129336_10356435All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Alteromonadales → Alteromonadaceae → Alteromonas/Salinimonas group → Alteromonas → Alteromonas australica804Open in IMG/M
3300013087|Ga0163212_1004468Not Available5745Open in IMG/M
(restricted) 3300013126|Ga0172367_10584926All Organisms → cellular organisms → Bacteria601Open in IMG/M
(restricted) 3300013132|Ga0172372_10755087All Organisms → cellular organisms → Bacteria608Open in IMG/M
(restricted) 3300014720|Ga0172376_10100556All Organisms → cellular organisms → Bacteria2061Open in IMG/M
(restricted) 3300014720|Ga0172376_10771803All Organisms → cellular organisms → Bacteria515Open in IMG/M
3300017707|Ga0181363_1027524Not Available1085Open in IMG/M
3300017788|Ga0169931_10068146All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Verrucomicrobiae → Verrucomicrobiales → Verrucomicrobiaceae → unclassified Verrucomicrobiaceae → Verrucomicrobiaceae bacterium3634Open in IMG/M
3300017951|Ga0181577_10256969All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Alteromonadales → Alteromonadaceae → Alteromonas/Salinimonas group → Alteromonas → Alteromonas australica1147Open in IMG/M
3300017951|Ga0181577_10465738All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Alteromonadales → Alteromonadaceae → Alteromonas/Salinimonas group → Alteromonas → Alteromonas australica795Open in IMG/M
3300017951|Ga0181577_10628076All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Alteromonadales → Alteromonadaceae → Alteromonas/Salinimonas group → Alteromonas → Alteromonas australica660Open in IMG/M
3300017967|Ga0181590_10020570All Organisms → cellular organisms → Bacteria5343Open in IMG/M
3300018421|Ga0181592_10006658All Organisms → Viruses → unclassified bacterial viruses → Synechococcus phage S-EIVl9489Open in IMG/M
3300018421|Ga0181592_10022120All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium5167Open in IMG/M
3300019732|Ga0194014_1055038All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Alteromonadales → Alteromonadaceae → Alteromonas/Salinimonas group → Alteromonas → Alteromonas australica562Open in IMG/M
3300020055|Ga0181575_10129526Not Available1537Open in IMG/M
3300020074|Ga0194113_10063202All Organisms → cellular organisms → Bacteria3471Open in IMG/M
3300020074|Ga0194113_10074212All Organisms → cellular organisms → Bacteria3115Open in IMG/M
3300020074|Ga0194113_10886378All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Alteromonadales → Alteromonadaceae → Alteromonas/Salinimonas group → Alteromonas → Alteromonas australica604Open in IMG/M
3300020179|Ga0194134_10002906Not Available19309Open in IMG/M
3300020179|Ga0194134_10017370Not Available4964Open in IMG/M
3300020179|Ga0194134_10104929All Organisms → Viruses → unclassified bacterial viruses → Synechococcus phage S-EIVl1374Open in IMG/M
3300020179|Ga0194134_10108182All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Alteromonadales → Alteromonadaceae → Alteromonas/Salinimonas group → Alteromonas → Alteromonas australica1344Open in IMG/M
3300020183|Ga0194115_10019457Not Available5377Open in IMG/M
3300020183|Ga0194115_10026159All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria4303Open in IMG/M
3300020184|Ga0181573_10380483All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Alteromonadales → Alteromonadaceae → Alteromonas/Salinimonas group → Alteromonas → Alteromonas australica659Open in IMG/M
3300020221|Ga0194127_10406883Not Available897Open in IMG/M
3300020442|Ga0211559_10032946Not Available2587Open in IMG/M
3300020498|Ga0208050_1003647Not Available1959Open in IMG/M
3300020518|Ga0208721_1015484Not Available998Open in IMG/M
3300020578|Ga0194129_10220105All Organisms → cellular organisms → Bacteria1136Open in IMG/M
3300021376|Ga0194130_10110175Not Available1772Open in IMG/M
3300021961|Ga0222714_10043797Not Available3174Open in IMG/M
3300021961|Ga0222714_10339834Not Available810Open in IMG/M
3300022190|Ga0181354_1136056Not Available779Open in IMG/M
3300022198|Ga0196905_1024200All Organisms → cellular organisms → Bacteria1873Open in IMG/M
3300022198|Ga0196905_1107982All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Alteromonadales → Alteromonadaceae → Alteromonas/Salinimonas group → Alteromonas → Alteromonas australica738Open in IMG/M
3300022200|Ga0196901_1066132All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Alteromonadales → Alteromonadaceae → Alteromonas/Salinimonas group → Alteromonas → Alteromonas australica1317Open in IMG/M
3300022200|Ga0196901_1102516All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Alteromonadales → Alteromonadaceae → Alteromonas/Salinimonas group → Alteromonas → Alteromonas australica996Open in IMG/M
3300022752|Ga0214917_10045267All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Verrucomicrobiae → Verrucomicrobiales → Verrucomicrobiaceae → unclassified Verrucomicrobiaceae → Verrucomicrobiaceae bacterium3055Open in IMG/M
3300023176|Ga0255772_10122554Not Available1595Open in IMG/M
3300023176|Ga0255772_10262171Not Available938Open in IMG/M
3300023180|Ga0255768_10211986All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Alteromonadales → Alteromonadaceae → Alteromonas/Salinimonas group → Alteromonas → Alteromonas australica1157Open in IMG/M
3300025057|Ga0208018_123059All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Alteromonadales → Alteromonadaceae → Alteromonas/Salinimonas group → Alteromonas → Alteromonas australica712Open in IMG/M
3300025647|Ga0208160_1101156All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium747Open in IMG/M
3300025647|Ga0208160_1162429All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Alteromonadales → Alteromonadaceae → Alteromonas/Salinimonas group → Alteromonas → Alteromonas australica532Open in IMG/M
3300025687|Ga0208019_1000198Not Available33616Open in IMG/M
3300025828|Ga0208547_1027201Not Available2217Open in IMG/M
3300025840|Ga0208917_1032144Not Available2170Open in IMG/M
3300025853|Ga0208645_1223797All Organisms → cellular organisms → Bacteria647Open in IMG/M
3300027393|Ga0209867_1002885Not Available2467Open in IMG/M
3300027734|Ga0209087_1083790All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Alteromonadales → Alteromonadaceae → Alteromonas/Salinimonas group → Alteromonas → Alteromonas australica1380Open in IMG/M
3300027782|Ga0209500_10454942All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Alteromonadales → Alteromonadaceae → Alteromonas/Salinimonas group → Alteromonas → Alteromonas australica503Open in IMG/M
3300027917|Ga0209536_100878158All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Alteromonadales → Alteromonadaceae → Alteromonas/Salinimonas group → Alteromonas → Alteromonas australica1108Open in IMG/M
3300029753|Ga0135224_1014047All Organisms → cellular organisms → Bacteria717Open in IMG/M
3300029930|Ga0119944_1000096Not Available14004Open in IMG/M
3300029930|Ga0119944_1012362All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Alteromonadales → Alteromonadaceae → Alteromonas/Salinimonas group → Alteromonas → Alteromonas australica1253Open in IMG/M
3300031539|Ga0307380_10011370Not Available11151Open in IMG/M
3300031772|Ga0315288_10039306All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria5715Open in IMG/M
3300031857|Ga0315909_10453487Not Available901Open in IMG/M
3300032093|Ga0315902_10100307Not Available3137Open in IMG/M
3300034061|Ga0334987_0197885All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Alteromonadales → Alteromonadaceae → Alteromonas/Salinimonas group → Alteromonas → Alteromonas australica1417Open in IMG/M
3300034073|Ga0310130_0000226Not Available47268Open in IMG/M

Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).


 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
AqueousEnvironmental → Aquatic → Marine → Coastal → Unclassified → Aqueous17.70%
Freshwater To Marine Saline GradientEnvironmental → Aquatic → Marine → Coastal → Unclassified → Freshwater To Marine Saline Gradient13.27%
Freshwater LakeEnvironmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake11.50%
Salt MarshEnvironmental → Aquatic → Marine → Intertidal Zone → Salt Marsh → Salt Marsh9.73%
FreshwaterEnvironmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater7.08%
Freshwater LakeEnvironmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake3.54%
MarineEnvironmental → Aquatic → Marine → Oceanic → Unclassified → Marine3.54%
FreshwaterEnvironmental → Aquatic → Freshwater → Lentic → Epilimnion → Freshwater2.65%
Freshwater LakeEnvironmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lake2.65%
FreshwaterEnvironmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater1.77%
AquaticEnvironmental → Aquatic → Freshwater → Drinking Water → Unclassified → Aquatic1.77%
FreshwaterEnvironmental → Aquatic → Freshwater → Unclassified → Unclassified → Freshwater1.77%
Marine SedimentEnvironmental → Aquatic → Marine → Oceanic → Sediment → Marine Sediment1.77%
MarineEnvironmental → Aquatic → Marine → Wetlands → Sediment → Marine1.77%
Estuarine WaterEnvironmental → Aquatic → Marine → Unclassified → Unclassified → Estuarine Water1.77%
MarineEnvironmental → Aquatic → Marine → Neritic Zone → Unclassified → Marine1.77%
Marine HarborEnvironmental → Aquatic → Marine → Harbor → Unclassified → Marine Harbor1.77%
Saline Water And SedimentEnvironmental → Aquatic → Non-Marine Saline And Alkaline → Saline → Epilimnion → Saline Water And Sediment1.77%
SandEnvironmental → Terrestrial → Soil → Sand → Unclassified → Sand1.77%
SedimentEnvironmental → Aquatic → Freshwater → Sediment → Unclassified → Sediment0.89%
FreshwaterEnvironmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater0.89%
LakeEnvironmental → Aquatic → Freshwater → Lake → Unclassified → Lake0.89%
SedimentEnvironmental → Aquatic → Freshwater → Lake → Sediment → Sediment0.89%
Freshwater And MarineEnvironmental → Aquatic → Freshwater → Lotic → Unclassified → Freshwater And Marine0.89%
Deep SubsurfaceEnvironmental → Aquatic → Marine → Oceanic → Sediment → Deep Subsurface0.89%
MarineEnvironmental → Aquatic → Marine → Intertidal Zone → Unclassified → Marine0.89%
MarineEnvironmental → Aquatic → Marine → Unclassified → Unclassified → Marine0.89%
SalineEnvironmental → Aquatic → Non-Marine Saline And Alkaline → Saline → Unclassified → Saline0.89%
SoilEnvironmental → Terrestrial → Soil → Clay → Unclassified → Soil0.89%
Fracking WaterEnvironmental → Terrestrial → Deep Subsurface → Unclassified → Unclassified → Fracking Water0.89%
EstuaryHost-Associated → Plants → Leaf → Unclassified → Unclassified → Estuary0.89%

Visualization
Powered by ApexCharts



Associated Samples

Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).

Taxon OIDSample NameHabitat TypeIMG/M Link
3300000116Marine microbial communities from Delaware Coast, sample from Delaware MO Spring March 2010EnvironmentalOpen in IMG/M
3300000124Marine microbial communities from chronically polluted sediments in the Baltic Sea - site KBA sample SWE 12_21mEnvironmentalOpen in IMG/M
3300000882Freshwater microbial communities from the Columbia RiverEnvironmentalOpen in IMG/M
3300001855Marine sediment microbial communities from White Oak River estuary, North Carolina - WOR-2-8_12EnvironmentalOpen in IMG/M
3300001934Estuary microbial communities from Chesapeake Bay, Maryland, USA - MOVE858EnvironmentalOpen in IMG/M
3300002835Freshwater microbial communities from Lake Mendota, WI - (Lake Mendota Combined Ray assembly, ASSEMBLY_DATE=20140605)EnvironmentalOpen in IMG/M
3300004240Freshwater lake microbial communities from Lake Michigan, USA - Fa13.BD.MLB.SNEnvironmentalOpen in IMG/M
3300004369Saline microbial communities from the South Caspian sea - cas-15EnvironmentalOpen in IMG/M
3300005512Saline surface water microbial communities from Etoliko Lagoon, Greece - halocline_waterEnvironmentalOpen in IMG/M
3300005805Microbial and algae communities from Cheney Reservoir in Wichita, Kansas, USAEnvironmentalOpen in IMG/M
3300005940Groundwater microbial communities from the Columbia River, Washington, USA, for microbe roles in carbon and contaminant biogeochemistry - GW-RW metaG T4_25-Nov-14EnvironmentalOpen in IMG/M
3300006734Marine viral communities from the Gulf of Mexico - 31_GoM_OMZ_CsCl metaGEnvironmentalOpen in IMG/M
3300006790Marine viral communities from the Gulf of Mexico - 32_GoM_OMZ_CsCl metaGEnvironmentalOpen in IMG/M
3300006802Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_18EnvironmentalOpen in IMG/M
3300006810Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Sep_01EnvironmentalOpen in IMG/M
3300007212Combined Assembly of cyanobacterial bloom in Punggol water reservoir, Singapore (Diel cycle-Bottom layer) 7 sequencing projectsEnvironmentalOpen in IMG/M
3300007538Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1508_2 Viral MetaGEnvironmentalOpen in IMG/M
3300007539Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1508_1M Viral MetaGEnvironmentalOpen in IMG/M
3300007541Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1508_1S Viral MetaGEnvironmentalOpen in IMG/M
3300007640Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Aug_28EnvironmentalOpen in IMG/M
3300007735Freshwater viral communities from Lake Soyang, Gangwon-do, South Korea ? 2014OctEnvironmentalOpen in IMG/M
3300007960Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1508_1D Viral MetaGEnvironmentalOpen in IMG/M
3300008055Metatranscriptomes of the Eelgrass leaves and roots. Combined Assembly of Gp0128390, Gp0128391, Gp0128392, and Gp0128393Host-AssociatedOpen in IMG/M
3300009159Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_140212_EF_MetaGEnvironmentalOpen in IMG/M
3300009183Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130206_EF_MetaGEnvironmentalOpen in IMG/M
3300009529Deep subsurface microbial communities from Black Sea to uncover new lineages of life (NeLLi) - Black_00105 metaGEnvironmentalOpen in IMG/M
3300010296Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Sum_27_0.8_DNAEnvironmentalOpen in IMG/M
3300010297Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Sum_20_0.8_DNAEnvironmentalOpen in IMG/M
3300010299Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Sum_15_0.2_DNAEnvironmentalOpen in IMG/M
3300010300Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Sum_27_0.2_DNAEnvironmentalOpen in IMG/M
3300010318Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Sum_15_0.8_DNAEnvironmentalOpen in IMG/M
3300010354Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Sum_0.6_0.8_DNAEnvironmentalOpen in IMG/M
3300010370Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Sum_0.6_0.2_DNAEnvironmentalOpen in IMG/M
3300013087Freshwater microbial communities from Lake Malawi, Central Region, Malawi to study Microbial Dark Matter (Phase II) - Malawi_45m_30LEnvironmentalOpen in IMG/M
3300013126 (restricted)Freshwater microbial communities from Kabuno Bay, South-Kivu, Congo ? kab_022012_10mEnvironmentalOpen in IMG/M
3300013132 (restricted)Freshwater microbial communities from Kabuno Bay, South-Kivu, Congo ? kab_092012_9.5mEnvironmentalOpen in IMG/M
3300014720 (restricted)Freshwater microbial communities from Kabuno Bay, South-Kivu, Congo ? kab_092012_35mEnvironmentalOpen in IMG/M
3300017707Freshwater viral communities from Lake Michigan, USA - Fa13.ND.MLB.S.NEnvironmentalOpen in IMG/M
3300017788Freshwater microbial communities from Lake Kivu, Western Province, Rwanda to study Microbial Dark Matter (Phase II) - Kivu_15m_20LEnvironmentalOpen in IMG/M
3300017951Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 101413BT metaG (megahit assembly)EnvironmentalOpen in IMG/M
3300017967Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 071411BT metaG (megahit assembly)EnvironmentalOpen in IMG/M
3300018421Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 071412BT metaG (megahit assembly)EnvironmentalOpen in IMG/M
3300019732Sediment microbial communities from the Broadkill River, Lewes, Delaware, United States ? BRC_0-1_MGEnvironmentalOpen in IMG/M
3300020055Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 101411CT metaG (spades assembly)EnvironmentalOpen in IMG/M
3300020074Freshwater microbial communities from Lake Tanganyika, Tanzania - TA2015017 Mahale Deep Cast 200mEnvironmentalOpen in IMG/M
3300020179Freshwater microbial communities from Lake Tanganyika, Tanzania - TA2015056 Kigoma Offshore 0mEnvironmentalOpen in IMG/M
3300020183Freshwater microbial communities from Lake Tanganyika, Tanzania - TA2015002 Mahale S4 surfaceEnvironmentalOpen in IMG/M
3300020184Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 101409BT metaG (spades assembly)EnvironmentalOpen in IMG/M
3300020221Freshwater microbial communities from Lake Tanganyika, Tanzania - TA2015036 Kigoma Deep Cast 100mEnvironmentalOpen in IMG/M
3300020442Marine microbial communities from Tara Oceans - TARA_B100002019 (ERX556121-ERR599162)EnvironmentalOpen in IMG/M
3300020498Freshwater microbial communities from Lake Mendota, WI - 13JUN2010 deep hole epilimnion (SPAdes)EnvironmentalOpen in IMG/M
3300020518Freshwater microbial communities from Lake Mendota, WI - 17AUG2010 deep hole epilimnion (SPAdes)EnvironmentalOpen in IMG/M
3300020578Freshwater microbial communities from Lake Tanganyika, Tanzania - TA2015038 Kigoma Deep Cast 35mEnvironmentalOpen in IMG/M
3300021376Freshwater microbial communities from Lake Tanganyika, Tanzania - TA2015050 Kigoma 12 surfaceEnvironmentalOpen in IMG/M
3300021961Estuarine water microbial communities from San Francisco Bay, California, United States - C33_3DEnvironmentalOpen in IMG/M
3300022190Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM15.S.NEnvironmentalOpen in IMG/M
3300022198Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1508_1S Viral MetaG (v3)EnvironmentalOpen in IMG/M
3300022200Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1504_1 Viral MetaG (v3)EnvironmentalOpen in IMG/M
3300022752Freshwater microbial communities from Lake Lanier, Atlanta, Georgia, United States - LL_1208_BBEnvironmentalOpen in IMG/M
3300023176Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 071411BT metaGEnvironmentalOpen in IMG/M
3300023180Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 071412AT metaGEnvironmentalOpen in IMG/M
3300025057Marine viral communities from the Gulf of Mexico - 31_GoM_OMZ_CsCl metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025647Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1504_1 Viral MetaG (SPAdes)EnvironmentalOpen in IMG/M
3300025687Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1508_1D Viral MetaG (SPAdes)EnvironmentalOpen in IMG/M
3300025828Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_22_N_<0.8_DNA (SPAdes)EnvironmentalOpen in IMG/M
3300025840Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_22_D_>0.8_DNA (SPAdes)EnvironmentalOpen in IMG/M
3300025853Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Sep_01 (SPAdes)EnvironmentalOpen in IMG/M
3300027393Groundwater microbial communities from the Columbia River, Washington, USA, for microbe roles in carbon and contaminant biogeochemistry - GW-RW metaG T4_4-Nov-14 (SPAdes)EnvironmentalOpen in IMG/M
3300027734Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130805_EF_MetaG (SPAdes)EnvironmentalOpen in IMG/M
3300027782Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_140212_EF_MetaG (SPAdes)EnvironmentalOpen in IMG/M
3300027917Marine sediment microbial communities from White Oak River estuary, North Carolina - WOR-2-8_12 (SPAdes)EnvironmentalOpen in IMG/M
3300029635Marine harbor viral communities from the Indian Ocean - SMH2EnvironmentalOpen in IMG/M
3300029753Marine harbor viral communities from the Indian Ocean - SRH3EnvironmentalOpen in IMG/M
3300029930Aquatic microbial communities from drinking water treatment plant in Pearl River Delta area, China - influent_20120727EnvironmentalOpen in IMG/M
3300031539Soil microbial communities from Risofladan, Vaasa, Finland - UN-3EnvironmentalOpen in IMG/M
3300031772Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G11_20EnvironmentalOpen in IMG/M
3300031857Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 2 MA125EnvironmentalOpen in IMG/M
3300032093Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 12 MA117EnvironmentalOpen in IMG/M
3300034061Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME02Sep2004-rr0028EnvironmentalOpen in IMG/M
3300034073Fracking water microbial communities from deep shales in Oklahoma, United States - MC-6-XLEnvironmentalOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap


 ⦗Top⦘

Family Sequences

Note: Some of these sequences are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).

Protein ID Sample Taxon ID Habitat Sequence
DelMOSpr2010_1000175553300000116MarineMKTKKLVKNALKHPELYGPAELAFFRKWLDSKKRAKAAKINKDKKENS*
DelMOSpr2010_1000852563300000116MarineMKTKKLVKNALKHPELYGPAELAFFKRWLDSKKRAKAAKINKDKKKDS*
BS_KBA_SWE12_21mDRAFT_1005588513300000124MarineMKTKKLVKKALKKPELYSQAEIVYFKTWLCLHKKSKTAKIKKDK*
BS_KBA_SWE12_21mDRAFT_1007779723300000124MarineMKTKKLVKKALKKPELYSYAELAYFKTWLCLHKKSKTAKIKKAK*
FwDRAFT_1017645253300000882Freshwater And MarineMKTKKLVKKALKKPELYSSAELAYFKTWLCLHKKSKTAKIKKAK*
JGI2160J19893_1012287123300001855Marine SedimentKHPELYGPAELAFFRKWLDSKKRAKAAKINKDKKENS*
GOS2267_10308973300001934MarineMKTKKLVKNALKHPELYGPAELAFFKRWLDSNKRAKAAKINKDKKKDS*
B570J40625_10106889923300002835FreshwaterMKTKKLVKQALNHPELYSSAELVFFDKWLRLKKQAKAAKINKDKKANS*
B570J40625_10133435923300002835FreshwaterMKTKKLVKQALHNPELYSSAELVYFGKWLHFKKQAKAAKIESKKKENS*
Ga0007787_1013930513300004240Freshwater LakeMKTKKLVKQALHHPELYSSAELVYFGKWLDLKKQAKAAKIESKKKENS*
Ga0065726_1663763300004369SalineMKTKKLVKNALKHPELYGPADLAFFKRWLDSKKRAKAAKINKDKKKDS*
Ga0074648_1001797243300005512Saline Water And SedimentMKTKKLVKNALKHPELYGPAELVFFKRWLDSKKRTKAAKINKDKKKDS*
Ga0074648_105318623300005512Saline Water And SedimentMKTKKLLKKALKHPELHTEAELIYFQKWLDLKKQAKSAKMYKEKKSNS*
Ga0079957_1003247153300005805LakeMKTKKLVKKALKHPELYGPAELAFFERWLASKKRAKAAKINKDKKKDS*
Ga0073913_1002611623300005940SandMKTKKLVKKALKKPELYSQAEIVYFKTWLCLHKKSKTAKIKEAK*
Ga0098073_100861423300006734MarineMMKTKKLIKRALKHPELYTPAELTFFGRWLFTKKQEKKAAKIKKHKEQ*
Ga0098073_103346313300006734MarineMKTKKLVKNALKHPELYGLAELTFFRKWLDSKKRAKAAKINKDKKENS*
Ga0098074_103480043300006790MarineMKTKKLVKNALKHPELYGPAELAFFRRWLDSKKRAKTAKIN
Ga0070749_1003219283300006802AqueousMKTKKLVKNALKHPELYGPAELAFFRRWLASKKQAKAAKINKDKKKDS*
Ga0070754_1000886673300006810AqueousMKTKKLVKNALKHPELYGPAELAFFRRWLDSKKRAKTAKINKDKKSEDR*
Ga0070754_1003484723300006810AqueousMKTKKLVKNALKHPELYGPGELAFFRRWLHSKKQAKAAKINKDKKKDS*
Ga0103958_110163023300007212Freshwater LakeMKTKKLVKRALRHPELYSPAELLFFNKWLRLKKQAKTAKINKDKKTNS*
Ga0099851_102356233300007538AqueousMKTKKLVKNALKNPSHWTEGDLVFFKRWLDSKKKVKPAKIKTSKTDK*
Ga0099849_101405623300007539AqueousMKTKKLVKNALKHPELYGPAELAFFRRWLDSKKRAKAAKINKDKKKDS*
Ga0099849_126483843300007539AqueousMKTKKLVKNALKHPELYGPAELAFFKRWLDSKKRAKAAKINK
Ga0099849_136476113300007539AqueousKNALKHPELYGPAELAFFRKWLDSKKRAKAAKINKDKKENS*
Ga0099848_111675923300007541AqueousMKTKKLVKNALKHPELYGPAELAFFRRWLDSKKRAKAAKINKDKKEDS*
Ga0070751_109670353300007640AqueousMKTKKLVKNALKHPELYGPAELAFFKRWLDSKKRAKAAKINKDKK
Ga0104988_10270143300007735FreshwaterMKTKKLVKEALRHPELYSPAEIAFFGKWLRLKKQAKTAKISKDKKANS*
Ga0104988_1057423300007735FreshwaterMKTKKLVKRALRHPELYSPAELLFFNKWLRLKKQAKTAKINKDKKANS*
Ga0099850_138922423300007960AqueousMKTKKLVKNALKHPELYGPAELAFFRKWLDSKKRAKAAKIN
Ga0108970_1008270823300008055EstuaryMKTKKLVKQALHNPELYSSAELVYFGKWLHLKKQAKAAKIESKKKENS*
Ga0114978_1016241943300009159Freshwater LakeMKTKKLVKKALKSPELYSSAELAYFKTWLCLHKKSKTAKIKKAK*
Ga0114974_10000063563300009183Freshwater LakeMKTKKLVKKALKSPELYSPAELAYFKTWLCLHKKSKTAKIKKAK*
Ga0114919_1027641423300009529Deep SubsurfaceMLKHPELYGPAELAFFKRWLDSKKRAKAAKINKDKKKDS*
Ga0129348_125503333300010296Freshwater To Marine Saline GradientMKTKKLVKNALKHPELYGPTELAFFKRWLDSKKRAKAAKINKDKKKDS*
Ga0129348_132526223300010296Freshwater To Marine Saline GradientTKKLVKNALKHPELYGPAELAFFKRWLDSKKRAKAAKINKDKKKDS*
Ga0129345_124183533300010297Freshwater To Marine Saline GradientMKTKKLVKNALKHPELYGPAELAFFKRWLDSKKRAKAAKINKDKKENS*
Ga0129342_107166513300010299Freshwater To Marine Saline GradientTRRKMKTKKLVKNALKHPELYGPAELAFFRRWLDSKKRAKTAKINKDKKSEDR*
Ga0129351_119026243300010300Freshwater To Marine Saline GradientMKTKKLVKNALKHPELYGPAELAFFRKWLDSKKRAKAAK
Ga0129351_120147323300010300Freshwater To Marine Saline GradientMKTKKLVKNALKHPELYGPAELAFFRRWLHSKKQAKAAKINKDKKKDS*
Ga0136656_131943723300010318Freshwater To Marine Saline GradientMKTKKLVKNALKHPELYGPAELAFFKRWLDSKKQAKAAKINKDKKKDS*
Ga0129333_1002728443300010354Freshwater To Marine Saline GradientMKTKKLVKNALKHPELYGPAELAFFRSWLASKKQAKAAKINKDKKKDS*
Ga0129333_1019049123300010354Freshwater To Marine Saline GradientMKTKKLVKRALRHPELYSPAELTFFDKWLRLKKQAKTAKINKDKKANS*
Ga0129333_1022278123300010354Freshwater To Marine Saline GradientMKTKKLVKQALHHPELYSSAELVYFGKWLHLKKQAKAAKIESKKKENS*
Ga0129333_1060254223300010354Freshwater To Marine Saline GradientMKTKKLVKQALSHPELYSSAELVFFDKWLRLKKQAKAAKINKDKKANS*
Ga0129333_1075712513300010354Freshwater To Marine Saline GradientMKTKKLVKRALKHPELYGPAELAFFERWLASKKRAKAAKINKDKKKDS*
Ga0129336_1011751713300010370Freshwater To Marine Saline GradientQMKTKKLVKKALKHPELYGPAELAFFERWLASKKRAKAAKINKDKKKDS*
Ga0129336_1019371133300010370Freshwater To Marine Saline GradientMKTKKLVKQALSHPELYSSAELVFFDKWLHLKKQAKAAKINKDKKANS*
Ga0129336_1035643533300010370Freshwater To Marine Saline GradientMKKNKLVKQALQHPELYTPAELAFFDRWLIEKKQKKTAKINKKKVYS*
Ga0163212_100446823300013087FreshwaterMKTKKLVKKALKHPELYTPAELIFFNRWLHLKKQAKTAKISKDKKADG*
(restricted) Ga0172367_1058492633300013126FreshwaterMKTKKLVKNALKHPELYSPAELIFFNKWLRLKKQAKTAKISKDKKADS*
(restricted) Ga0172372_1075508733300013132FreshwaterMKTKKLVKKALKHPELYTPAELIFFNRWLHLKKQAK
(restricted) Ga0172376_1010055623300014720FreshwaterMKTKKLVKNALKHPELYSSAELVFFNKWLRLKKQAKTAKISKDKKADS*
(restricted) Ga0172376_1077180313300014720FreshwaterMKTKKLVKKALKHPELYTPAELIFFNRWLHLKKQAKTA
Ga0181363_102752413300017707Freshwater LakeMKTKKLVKQALNHPELYSSAELVFFDKWLRLKKQAKAAKINKDKGENS
Ga0169931_1006814613300017788FreshwaterKALKHPELYTPAELIFFNRWLHLKKQAKTAKISKDKKADG
Ga0181577_1025696923300017951Salt MarshMKTKKLVKNALKHPELYGPAELAFFRKWLDSKKRAKAAKINKDKKENS
Ga0181577_1046573823300017951Salt MarshMKTKKLVKNALKHPELYGPAELAFFRRWLDSKKQAKAAKINKDKKKDS
Ga0181577_1062807613300017951Salt MarshMKTKKLVKNALKHPELYGPAELAFFKRWLDSKKRAKAAKINKDKKKDS
Ga0181590_1002057023300017967Salt MarshMKTKKLVKNALKHPELYGPAELAFFRRWLDSKKRAKTAKINKDKKSEDR
Ga0181592_10006658203300018421Salt MarshMKTKKLVKNALKHPELYGPAELAFFKRWLDSKKRAKAAKIN
Ga0181592_1002212063300018421Salt MarshMKKKKLVKNALKNPELYSSAEIAYFNMWLKFKKDKKKAAKIKSSS
Ga0194014_105503813300019732SedimentKTKKLVKNALKHPELYGPAELAFFRKWLDSKKRAKAAKINKDKKKDS
Ga0181575_1012952653300020055Salt MarshMKTKKLVKNALKHPELYGPAELAFFRKWLDSKKRAKAAKINKDKKKDS
Ga0194113_1006320243300020074Freshwater LakeMKTKKLVKKALKHPELYTPAELIFFNRWLHLKKQAKTAKISKDKKADG
Ga0194113_1007421233300020074Freshwater LakeMKTKKLVKKALKHPELYSPAEISFFATWLHKKKRAKAAKINRDNRENS
Ga0194113_1088637823300020074Freshwater LakeMKTKKLVKNALKHPELYSSAELVFFNKWLHQKKQAKAAKISKDKKADS
Ga0194134_10002906223300020179Freshwater LakeMKTKKLVKNALKHPELYSPAELIFFSKWLHQKKQTKAAKINKDKKENS
Ga0194134_10017370133300020179Freshwater LakeMKTKKLVKKALKHPELYSPAEISFFATWLHKKKRAKAAKINR
Ga0194134_1010492923300020179Freshwater LakeMKTKKLVKNALKHPELYSSAEFIFFNKWLRLKKQAKTAKINKDKGENS
Ga0194134_1010818223300020179Freshwater LakeKHPELYSPAEISFFATWLHKKKRAKAAKINRDNRENS
Ga0194115_1001945763300020183Freshwater LakeLKHPELYTPAELIFFNRWLHLKKQAKTAKISKDKKADG
Ga0194115_1002615953300020183Freshwater LakeMKTKKLVKNALKHPELYSSAELIFFNKWLRLKKQAKTAKISKDKKADS
Ga0181573_1038048313300020184Salt MarshLKHPELYGPAELAFFRKWLDSKKRAKAAKINKDKKENS
Ga0194127_1040688343300020221Freshwater LakeMKTKKLIKQALKHPELYTPAELSFFGRWLRKKKEDKKTAKIQ
Ga0211559_1003294613300020442MarineMKTKKLVKNALKNPSYWTEGDLAFFKRWLDSKKKVKPAKIKTSKTDK
Ga0208050_100364723300020498FreshwaterMKTKKLVKQALHNPELYSSAELVYFGKWLHLKKQAKAAKIESKKKENS
Ga0208721_101548423300020518FreshwaterMKTKKLVKQALHHPELYSSAELVYFGKWLDLKKQAKAAKIESKKKENS
Ga0194129_1022010523300020578Freshwater LakeMKTKKLVKNALKHPELYSSAEFIFFNKWLRLKKQAKTAKIKKDKRENS
Ga0194130_1011017543300021376Freshwater LakeMKTKKLVKKALKHPELYTPAELIFFNRWLHLKKQAKTAKISKDKKA
Ga0222714_1004379743300021961Estuarine WaterLILEMKTKKLVKKALKHPELYSSADLVFFNKWLQQKKQAKAAKISKDK
Ga0222714_1033983413300021961Estuarine WaterMKTKKLVKKALKHPELYSSADLVFFNKWLQQKKQAKAAKISKDK
Ga0181354_113605633300022190Freshwater LakeMKTKKLVKQALHHPELYSSAELVYFGKWLDLKKQAKAAKI
Ga0196905_102420023300022198AqueousMKTKKLVKNALKHPELYGPAELAFFRSWLASKKQAKAAKINKDKKKDS
Ga0196905_110798223300022198AqueousMKTKKLVKKALKHPELYGPAELAFFERWLASKKRAKAAKINKDKKKDS
Ga0196901_106613223300022200AqueousKNALKNPSHWTEGDLVFFKRWLDSKKKVKPAKIKTSKTDK
Ga0196901_110251633300022200AqueousMKTKKLVKNALKHPELYGLAELTFFRKWLDSKKRAKAAKINKDKKENS
Ga0214917_1004526723300022752FreshwaterMKRKKLVKKALKHPELYALAEIAYFKRWLWQKKQNKKTAKIQLKQEVNS
Ga0255772_1012255423300023176Salt MarshKMKTKKLVKNALKHPELYGPAELAFFRRWLDSKKQAKAAKINKDKKKDS
Ga0255772_1026217113300023176Salt MarshMKTKKLVKNALKHPELYGPAELAFFRRWLDSKKRAKTAKI
Ga0255768_1021198623300023180Salt MarshALKHPELYGPAELAFFRKWLDSKKRAKAAKINKDKKENS
Ga0208018_12305913300025057MarineWAWLRPLCSAGMMKTKKLIKRALKHPELYTPAELTFFGRWLFTKKQEKKAAKIKKHKEQ
Ga0208160_110115623300025647AqueousMKTKKLVKNALKHPELYGPAELAFFRRWLDSKKRAKAAKINKDKKKDS
Ga0208160_116242923300025647AqueousRRKMKTKKLVKNALKHPELYGPAELAFFRRWLDSKKRAKTAKINKDKKSEDR
Ga0208019_1000198333300025687AqueousMKTKKLVKNALKNPSHWTEGDLVFFKRWLDSKKKVKPAKIKTSKTDK
Ga0208547_102720113300025828AqueousLVKNALKHPELYGPAELAFFRKWLDSKKRAKAAKINKDKKENS
Ga0208917_103214423300025840AqueousKHPELYGPAELAFFRKWLDSKKRAKAAKINKDKKENS
Ga0208645_122379723300025853AqueousMKTKKLVKNALKHPELYGPGELAFFRRWLHSKKQAKAAKINKDKKKDS
Ga0209867_100288523300027393SandMKTKKLVKKALKKPELYSQAEIVYFKTWLCLHKKSKTAKIKEAK
Ga0209087_108379023300027734Freshwater LakeMKTKKLVKKALKSPELYSPAELAYFKTWLCLHKKSKTAKIKKAK
Ga0209500_1045494213300027782Freshwater LakeKTKKLVKKALKSPELYSSAELAYFKTWLCLHKKSKTAKIKKAK
Ga0209536_10087815823300027917Marine SedimentLKHPELYGPAELAFFRRWLDSKKRAKTAKINKDKKSEDR
Ga0135217_10094623300029635Marine HarborVLQDGTKKPMKTKKLVKNALKNPSYWTEGDLAFFKLWLASKKKAKPAKIKTSKTDK
Ga0135224_101404723300029753Marine HarborMKTKKLVKNALKNPSYWTEGDLAFFKLWLASKKKAKPAKIKTSKTDK
Ga0119944_1000096183300029930AquaticMKRKKLVKKALKQPELYTPAEIAYFKRWLWQKKQDKKTAKIQLKQEANS
Ga0119944_101236223300029930AquaticGVKMKTKKLVKNALRHPELYTPAELVFFNKWLQLKKQAKTAKISKDKKANS
Ga0307380_1001137083300031539SoilMKTKKLVKKALKKPELYSYAELAYFKTWLCLHKKSKTAKIKKAK
Ga0315288_1003930653300031772SedimentMKTKKLVKKALKKPEFYSSAELVYFKTWLCLHKKSKTAKIKKAK
Ga0315909_1045348723300031857FreshwaterMKTKKLVKQALHHPELYSSAELVYFGKWLHFKKQAKAAKIESKKKENS
Ga0315902_1010030723300032093FreshwaterMKTKKLVQQALQHPELYSPAELVYFGKWLHFKKQAKAAKIESKKKENS
Ga0334987_0197885_962_11083300034061FreshwaterMKTKKLVKQALHNPELYSSAELVYFGKWLDLKKQAKAAKIESKKKENS
Ga0310130_0000226_15492_156383300034073Fracking WaterMMKTKKLIKRALKHPELYTPAELTFFGRWLFNKKQEKKAAKIKKHKEQ

 ⦗Top⦘


Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.