


| Basic Information | |
|---|---|
| Family ID | F082510 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 113 |
| Average Sequence Length | 42 residues |
| Representative Sequence | FLLQLGPFGGAYVHGWGIRVWAAGYLCVALALALLAFSRRDL |
| Number of Associated Samples | 98 |
| Number of Associated Scaffolds | 113 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 1.77 % |
| % of genes near scaffold ends (potentially truncated) | 99.12 % |
| % of genes from short scaffolds (< 2000 bps) | 93.81 % |
| Associated GOLD sequencing projects | 95 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.53 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (70.796 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil (9.735 % of family members) |
| Environment Ontology (ENVO) | Unclassified (24.779 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (40.708 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Transmembrane (alpha-helical) | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 30.00% β-sheet: 0.00% Coil/Unstructured: 70.00% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.53 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 113 Family Scaffolds |
|---|---|---|
| PF04227 | Indigoidine_A | 60.18 |
| PF00583 | Acetyltransf_1 | 3.54 |
| PF13302 | Acetyltransf_3 | 2.65 |
| PF02604 | PhdYeFM_antitox | 1.77 |
| PF00294 | PfkB | 1.77 |
| PF13581 | HATPase_c_2 | 1.77 |
| PF13742 | tRNA_anti_2 | 1.77 |
| PF10604 | Polyketide_cyc2 | 1.77 |
| PF05816 | TelA | 1.77 |
| PF00072 | Response_reg | 0.88 |
| PF01674 | Lipase_2 | 0.88 |
| PF13011 | LZ_Tnp_IS481 | 0.88 |
| PF03640 | Lipoprotein_15 | 0.88 |
| PF01026 | TatD_DNase | 0.88 |
| PF12679 | ABC2_membrane_2 | 0.88 |
| PF00248 | Aldo_ket_red | 0.88 |
| PF00265 | TK | 0.88 |
| PF03704 | BTAD | 0.88 |
| PF00694 | Aconitase_C | 0.88 |
| PF00590 | TP_methylase | 0.88 |
| PF07690 | MFS_1 | 0.88 |
| COG ID | Name | Functional Category | % Frequency in 113 Family Scaffolds |
|---|---|---|---|
| COG2313 | Pseudouridine-5'-phosphate glycosidase (pseudoU degradation) | Nucleotide transport and metabolism [F] | 60.18 |
| COG2161 | Antitoxin component YafN of the YafNO toxin-antitoxin module, PHD/YefM family | Defense mechanisms [V] | 1.77 |
| COG3853 | Uncharacterized conserved protein YaaN involved in tellurite resistance | Defense mechanisms [V] | 1.77 |
| COG4118 | Antitoxin component of toxin-antitoxin stability system, DNA-binding transcriptional repressor | Defense mechanisms [V] | 1.77 |
| COG1435 | Thymidine kinase | Nucleotide transport and metabolism [F] | 0.88 |
| COG3629 | DNA-binding transcriptional regulator DnrI/AfsR/EmbR, SARP family, contains BTAD domain | Transcription [K] | 0.88 |
| COG3947 | Two-component response regulator, SAPR family, consists of REC, wHTH and BTAD domains | Transcription [K] | 0.88 |
| COG4315 | Predicted lipoprotein with conserved Yx(FWY)xxD motif (function unknown) | Function unknown [S] | 0.88 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 70.80 % |
| Unclassified | root | N/A | 29.20 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 2140918007|ConsensusfromContig126633 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 654 | Open in IMG/M |
| 2170459003|FZN2CUW02HTNOP | Not Available | 502 | Open in IMG/M |
| 2170459005|F1BAP7Q02INZKL | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 525 | Open in IMG/M |
| 3300001535|A3PFW1_10875037 | Not Available | 945 | Open in IMG/M |
| 3300001536|A1565W1_10459619 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Thermoflexia → Thermoflexales → Thermoflexaceae → Thermoflexus → Thermoflexus hugenholtzii | 1012 | Open in IMG/M |
| 3300002568|C688J35102_118419494 | Not Available | 558 | Open in IMG/M |
| 3300004479|Ga0062595_100131971 | All Organisms → cellular organisms → Bacteria | 1410 | Open in IMG/M |
| 3300004479|Ga0062595_100687305 | All Organisms → cellular organisms → Bacteria | 818 | Open in IMG/M |
| 3300004479|Ga0062595_100805344 | All Organisms → cellular organisms → Bacteria | 775 | Open in IMG/M |
| 3300005174|Ga0066680_10848031 | All Organisms → cellular organisms → Bacteria | 546 | Open in IMG/M |
| 3300005176|Ga0066679_10299226 | All Organisms → cellular organisms → Bacteria | 1046 | Open in IMG/M |
| 3300005176|Ga0066679_11000035 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales | 521 | Open in IMG/M |
| 3300005184|Ga0066671_10183108 | All Organisms → cellular organisms → Bacteria | 1247 | Open in IMG/M |
| 3300005327|Ga0070658_10005067 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia | 10725 | Open in IMG/M |
| 3300005329|Ga0070683_100958679 | All Organisms → cellular organisms → Bacteria | 821 | Open in IMG/M |
| 3300005339|Ga0070660_101517016 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 570 | Open in IMG/M |
| 3300005344|Ga0070661_100217019 | All Organisms → cellular organisms → Bacteria | 1466 | Open in IMG/M |
| 3300005440|Ga0070705_100699111 | All Organisms → cellular organisms → Bacteria | 796 | Open in IMG/M |
| 3300005445|Ga0070708_100977434 | All Organisms → cellular organisms → Bacteria | 794 | Open in IMG/M |
| 3300005445|Ga0070708_101746845 | All Organisms → cellular organisms → Bacteria | 578 | Open in IMG/M |
| 3300005458|Ga0070681_11803350 | All Organisms → cellular organisms → Bacteria | 539 | Open in IMG/M |
| 3300005518|Ga0070699_102115770 | All Organisms → cellular organisms → Bacteria | 514 | Open in IMG/M |
| 3300005529|Ga0070741_10269940 | All Organisms → cellular organisms → Bacteria | 1611 | Open in IMG/M |
| 3300005530|Ga0070679_100291380 | All Organisms → cellular organisms → Bacteria | 1584 | Open in IMG/M |
| 3300005536|Ga0070697_101757089 | All Organisms → cellular organisms → Bacteria | 555 | Open in IMG/M |
| 3300005537|Ga0070730_10516762 | All Organisms → cellular organisms → Bacteria | 766 | Open in IMG/M |
| 3300005537|Ga0070730_10743594 | All Organisms → cellular organisms → Bacteria | 620 | Open in IMG/M |
| 3300005539|Ga0068853_100777299 | All Organisms → cellular organisms → Bacteria | 916 | Open in IMG/M |
| 3300005556|Ga0066707_10743536 | Not Available | 611 | Open in IMG/M |
| 3300005559|Ga0066700_10252622 | All Organisms → cellular organisms → Bacteria | 1233 | Open in IMG/M |
| 3300005563|Ga0068855_101217619 | Not Available | 782 | Open in IMG/M |
| 3300005575|Ga0066702_10299681 | All Organisms → cellular organisms → Bacteria | 980 | Open in IMG/M |
| 3300005614|Ga0068856_101453856 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 700 | Open in IMG/M |
| 3300005764|Ga0066903_100950566 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1563 | Open in IMG/M |
| 3300005764|Ga0066903_103447339 | All Organisms → cellular organisms → Bacteria | 853 | Open in IMG/M |
| 3300005764|Ga0066903_103990146 | Not Available | 791 | Open in IMG/M |
| 3300005764|Ga0066903_106746859 | Not Available | 597 | Open in IMG/M |
| 3300005892|Ga0075275_1096919 | All Organisms → cellular organisms → Bacteria | 515 | Open in IMG/M |
| 3300005894|Ga0075270_1027039 | Not Available | 770 | Open in IMG/M |
| 3300005903|Ga0075279_10084877 | All Organisms → cellular organisms → Bacteria | 570 | Open in IMG/M |
| 3300006032|Ga0066696_10950126 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 547 | Open in IMG/M |
| 3300006755|Ga0079222_10768126 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 779 | Open in IMG/M |
| 3300006806|Ga0079220_10270292 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales | 1030 | Open in IMG/M |
| 3300006806|Ga0079220_10684647 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 749 | Open in IMG/M |
| 3300006914|Ga0075436_101433532 | All Organisms → cellular organisms → Bacteria | 524 | Open in IMG/M |
| 3300007788|Ga0099795_10491736 | Not Available | 571 | Open in IMG/M |
| 3300009090|Ga0099827_11550419 | All Organisms → cellular organisms → Bacteria | 577 | Open in IMG/M |
| 3300009098|Ga0105245_10329683 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1506 | Open in IMG/M |
| 3300009519|Ga0116108_1072845 | All Organisms → cellular organisms → Bacteria | 1060 | Open in IMG/M |
| 3300009548|Ga0116107_1213834 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 500 | Open in IMG/M |
| 3300009634|Ga0116124_1014693 | All Organisms → cellular organisms → Bacteria | 2705 | Open in IMG/M |
| 3300010154|Ga0127503_10884601 | Not Available | 746 | Open in IMG/M |
| 3300010323|Ga0134086_10432930 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 534 | Open in IMG/M |
| 3300010329|Ga0134111_10445665 | Not Available | 561 | Open in IMG/M |
| 3300010373|Ga0134128_10734230 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales | 1096 | Open in IMG/M |
| 3300010373|Ga0134128_11830099 | Not Available | 668 | Open in IMG/M |
| 3300010373|Ga0134128_11853776 | All Organisms → cellular organisms → Bacteria | 664 | Open in IMG/M |
| 3300010376|Ga0126381_100728969 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1419 | Open in IMG/M |
| 3300010376|Ga0126381_101565296 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 952 | Open in IMG/M |
| 3300011271|Ga0137393_10639386 | Not Available | 912 | Open in IMG/M |
| 3300012202|Ga0137363_11626765 | Not Available | 538 | Open in IMG/M |
| 3300012209|Ga0137379_11105162 | All Organisms → cellular organisms → Bacteria | 698 | Open in IMG/M |
| 3300012353|Ga0137367_10946042 | All Organisms → cellular organisms → Bacteria | 591 | Open in IMG/M |
| 3300012356|Ga0137371_10894779 | All Organisms → cellular organisms → Bacteria | 675 | Open in IMG/M |
| 3300012944|Ga0137410_11837809 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 535 | Open in IMG/M |
| 3300012989|Ga0164305_11119497 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 677 | Open in IMG/M |
| 3300013105|Ga0157369_10939274 | Not Available | 886 | Open in IMG/M |
| 3300013307|Ga0157372_12530447 | Not Available | 589 | Open in IMG/M |
| 3300015245|Ga0137409_10243323 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1601 | Open in IMG/M |
| 3300015371|Ga0132258_13747071 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1036 | Open in IMG/M |
| 3300015372|Ga0132256_101747006 | All Organisms → cellular organisms → Bacteria | 731 | Open in IMG/M |
| 3300015372|Ga0132256_102876071 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 579 | Open in IMG/M |
| 3300016387|Ga0182040_10470393 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 999 | Open in IMG/M |
| 3300017936|Ga0187821_10263920 | All Organisms → cellular organisms → Bacteria | 676 | Open in IMG/M |
| 3300017937|Ga0187809_10187634 | Not Available | 729 | Open in IMG/M |
| 3300017959|Ga0187779_11109394 | Not Available | 553 | Open in IMG/M |
| 3300018432|Ga0190275_10908182 | Not Available | 949 | Open in IMG/M |
| 3300018433|Ga0066667_11920388 | Not Available | 541 | Open in IMG/M |
| 3300020081|Ga0206354_11480532 | Not Available | 664 | Open in IMG/M |
| 3300020082|Ga0206353_10706646 | Not Available | 626 | Open in IMG/M |
| 3300021377|Ga0213874_10264519 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 638 | Open in IMG/M |
| 3300025321|Ga0207656_10526290 | Not Available | 601 | Open in IMG/M |
| 3300025459|Ga0208689_1009303 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 3348 | Open in IMG/M |
| 3300025477|Ga0208192_1071158 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 654 | Open in IMG/M |
| 3300025929|Ga0207664_10581670 | Not Available | 1005 | Open in IMG/M |
| 3300025929|Ga0207664_11285829 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 651 | Open in IMG/M |
| 3300025952|Ga0210077_1058817 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Comamonadaceae | 796 | Open in IMG/M |
| 3300026036|Ga0208650_1029667 | Not Available | 673 | Open in IMG/M |
| 3300026318|Ga0209471_1217466 | Not Available | 708 | Open in IMG/M |
| 3300026542|Ga0209805_1183129 | Not Available | 924 | Open in IMG/M |
| 3300026552|Ga0209577_10408444 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 973 | Open in IMG/M |
| 3300027869|Ga0209579_10781768 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 516 | Open in IMG/M |
| 3300028577|Ga0265318_10342916 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 545 | Open in IMG/M |
| 3300028653|Ga0265323_10052368 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1444 | Open in IMG/M |
| 3300028666|Ga0265336_10198106 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 597 | Open in IMG/M |
| 3300028666|Ga0265336_10239744 | Not Available | 539 | Open in IMG/M |
| 3300028802|Ga0307503_10024426 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 2039 | Open in IMG/M |
| 3300028889|Ga0247827_11257032 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Thermoleophilales → Thermoleophilaceae → unclassified Thermoleophilaceae → Thermoleophilaceae bacterium | 516 | Open in IMG/M |
| 3300031239|Ga0265328_10172261 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 818 | Open in IMG/M |
| 3300031241|Ga0265325_10365363 | Not Available | 636 | Open in IMG/M |
| 3300031249|Ga0265339_10577005 | Not Available | 516 | Open in IMG/M |
| 3300031251|Ga0265327_10077223 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 1653 | Open in IMG/M |
| 3300031712|Ga0265342_10699023 | Not Available | 507 | Open in IMG/M |
| 3300031724|Ga0318500_10705126 | Not Available | 515 | Open in IMG/M |
| 3300031778|Ga0318498_10388872 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 621 | Open in IMG/M |
| 3300031945|Ga0310913_11320049 | Not Available | 500 | Open in IMG/M |
| 3300031954|Ga0306926_10500888 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1493 | Open in IMG/M |
| 3300032770|Ga0335085_10193047 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 2502 | Open in IMG/M |
| 3300032783|Ga0335079_10470902 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1344 | Open in IMG/M |
| 3300032805|Ga0335078_11341629 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 813 | Open in IMG/M |
| 3300032892|Ga0335081_10036120 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 7889 | Open in IMG/M |
| 3300032955|Ga0335076_10269828 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1594 | Open in IMG/M |
| 3300033475|Ga0310811_10009106 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 12803 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 9.73% |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 7.96% |
| Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Rhizosphere | 7.96% |
| Peatland | Environmental → Aquatic → Freshwater → Wetlands → Unclassified → Peatland | 4.42% |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 4.42% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 4.42% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 3.54% |
| Surface Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil | 3.54% |
| Rice Paddy Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Rice Paddy Soil | 3.54% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 3.54% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere | 3.54% |
| Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 2.65% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil | 2.65% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 2.65% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 2.65% |
| Corn Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere | 2.65% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere | 2.65% |
| Freshwater Sediment | Environmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment | 1.77% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 1.77% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 1.77% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Corn, Switchgrass And Miscanthus Rhizosphere | 1.77% |
| Permafrost | Environmental → Terrestrial → Soil → Unclassified → Permafrost → Permafrost | 1.77% |
| Grass Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grass Soil | 1.77% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 1.77% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Agricultural Soil | 1.77% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 1.77% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Arabidopsis Rhizosphere | 1.77% |
| Soil | Environmental → Aquatic → Freshwater → Groundwater → Unclassified → Soil | 0.89% |
| Natural And Restored Wetlands | Environmental → Aquatic → Marine → Wetlands → Unclassified → Natural And Restored Wetlands | 0.89% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Permafrost → Soil | 0.89% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 0.89% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural → Soil | 0.89% |
| Tropical Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland | 0.89% |
| Soil | Environmental → Terrestrial → Soil → Loam → Grasslands → Soil | 0.89% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere | 0.89% |
| Plant Roots | Host-Associated → Plants → Roots → Unclassified → Unclassified → Plant Roots | 0.89% |
| Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 0.89% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 0.89% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 2140918007 | Permafrost microbial communities from permafrost in Bonanza Creek, Alaska - Active_all | Environmental | Open in IMG/M |
| 2170459003 | Grass soil microbial communities from Rothamsted Park, UK - March 2009 indirect MP BIO 1O1 lysis 0-21cm | Environmental | Open in IMG/M |
| 2170459005 | Grass soil microbial communities from Rothamsted Park, UK - July 2009 direct MP BIO1O1 lysis 0-21cm | Environmental | Open in IMG/M |
| 3300001535 | Permafrost active layer microbial communities from McGill Arctic Research Station, Canada - (A3-PF-15A)- 1 week illumina | Environmental | Open in IMG/M |
| 3300001536 | Permafrost active layer microbial communities from McGill Arctic Research Station, Canada - (A15-65cm-8A)- 1 week illumina | Environmental | Open in IMG/M |
| 3300002568 | Grasslands soil microbial communities from Hopland, California, USA - 2 | Environmental | Open in IMG/M |
| 3300004479 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of All WPAs | Environmental | Open in IMG/M |
| 3300005174 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_129 | Environmental | Open in IMG/M |
| 3300005176 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_128 | Environmental | Open in IMG/M |
| 3300005184 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_120 | Environmental | Open in IMG/M |
| 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Host-Associated | Open in IMG/M |
| 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Environmental | Open in IMG/M |
| 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Host-Associated | Open in IMG/M |
| 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Host-Associated | Open in IMG/M |
| 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Environmental | Open in IMG/M |
| 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Environmental | Open in IMG/M |
| 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Environmental | Open in IMG/M |
| 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Environmental | Open in IMG/M |
| 3300005529 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen16_06102014_R1 | Environmental | Open in IMG/M |
| 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Environmental | Open in IMG/M |
| 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Environmental | Open in IMG/M |
| 3300005537 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen01_05102014_R1 | Environmental | Open in IMG/M |
| 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Host-Associated | Open in IMG/M |
| 3300005556 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_156 | Environmental | Open in IMG/M |
| 3300005559 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_149 | Environmental | Open in IMG/M |
| 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Host-Associated | Open in IMG/M |
| 3300005575 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_151 | Environmental | Open in IMG/M |
| 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Host-Associated | Open in IMG/M |
| 3300005764 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2) | Environmental | Open in IMG/M |
| 3300005892 | Rice paddy soil microbial communities from Twitchell Island, California, USA - SF_Rice_5C_80N_305 | Environmental | Open in IMG/M |
| 3300005894 | Rice paddy soil microbial communities from Twitchell Island, California, USA - SF_Rice_5C_0N_203 | Environmental | Open in IMG/M |
| 3300005903 | Rice paddy soil microbial communities from Twitchell Island, California, USA - SF_Rice_10C_0N_303 | Environmental | Open in IMG/M |
| 3300006032 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_145 | Environmental | Open in IMG/M |
| 3300006755 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Plitter | Environmental | Open in IMG/M |
| 3300006806 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS100 | Environmental | Open in IMG/M |
| 3300006914 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Host-Associated | Open in IMG/M |
| 3300007788 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 | Environmental | Open in IMG/M |
| 3300009090 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con1.8 metaG | Environmental | Open in IMG/M |
| 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Host-Associated | Open in IMG/M |
| 3300009519 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_6_150 | Environmental | Open in IMG/M |
| 3300009548 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_6_100 | Environmental | Open in IMG/M |
| 3300009634 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_13_150 | Environmental | Open in IMG/M |
| 3300010154 | Soil microbial communities from Willow Creek, Wisconsin, USA - WC-WI-TBF metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300010323 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Glu_40cm_2_24_1 metaG | Environmental | Open in IMG/M |
| 3300010329 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_2_11112015 | Environmental | Open in IMG/M |
| 3300010373 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-4 | Environmental | Open in IMG/M |
| 3300010376 | Tropical forest soil microbial communities from Panama - MetaG Plot_28 | Environmental | Open in IMG/M |
| 3300011271 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h3.4B metaG | Environmental | Open in IMG/M |
| 3300012202 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_115_16 metaG | Environmental | Open in IMG/M |
| 3300012209 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_80_16 metaG | Environmental | Open in IMG/M |
| 3300012353 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_80_16 metaG | Environmental | Open in IMG/M |
| 3300012356 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_40_16 metaG | Environmental | Open in IMG/M |
| 3300012944 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012989 | Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_237_MG | Environmental | Open in IMG/M |
| 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Host-Associated | Open in IMG/M |
| 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Host-Associated | Open in IMG/M |
| 3300015245 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug1_16fungal (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300015371 | Combined assembly of cpr5 and col0 rhizosphere and soil | Host-Associated | Open in IMG/M |
| 3300015372 | Soil combined assembly | Host-Associated | Open in IMG/M |
| 3300016387 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.176 | Environmental | Open in IMG/M |
| 3300017936 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SourceSoil_1 | Environmental | Open in IMG/M |
| 3300017937 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - ASW_4 | Environmental | Open in IMG/M |
| 3300017959 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_Q2_SP10_10_MG | Environmental | Open in IMG/M |
| 3300018432 | Populus adjacent soil microbial communities from riparian zone of Yellowstone River, Montana, USA - 550 T | Environmental | Open in IMG/M |
| 3300018433 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_116 | Environmental | Open in IMG/M |
| 3300020081 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300020082 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300021377 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 | Host-Associated | Open in IMG/M |
| 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025459 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_8_150 (SPAdes) | Environmental | Open in IMG/M |
| 3300025477 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_13_150 (SPAdes) | Environmental | Open in IMG/M |
| 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025952 | Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - RushMan_CattailNLB_D2 (SPAdes) | Environmental | Open in IMG/M |
| 3300026036 | Rice paddy soil microbial communities from Twitchell Island, California, USA - SF_Rice_10C_0N_404 (SPAdes) | Environmental | Open in IMG/M |
| 3300026318 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_128 (SPAdes) | Environmental | Open in IMG/M |
| 3300026542 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_148 (SPAdes) | Environmental | Open in IMG/M |
| 3300026552 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_109 (SPAdes) | Environmental | Open in IMG/M |
| 3300027869 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen03_05102014_R1 (SPAdes) | Environmental | Open in IMG/M |
| 3300028577 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG | Host-Associated | Open in IMG/M |
| 3300028653 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG | Host-Associated | Open in IMG/M |
| 3300028666 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG | Host-Associated | Open in IMG/M |
| 3300028802 | Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 17_S | Environmental | Open in IMG/M |
| 3300028889 | Soil microbial communities from agricultural site in Penn Yan, New York, United States - 12C_Control_Day2 | Environmental | Open in IMG/M |
| 3300031239 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG | Host-Associated | Open in IMG/M |
| 3300031241 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG | Host-Associated | Open in IMG/M |
| 3300031249 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG | Host-Associated | Open in IMG/M |
| 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Host-Associated | Open in IMG/M |
| 3300031712 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG | Host-Associated | Open in IMG/M |
| 3300031724 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.174b1f20 | Environmental | Open in IMG/M |
| 3300031778 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.109b1f24 | Environmental | Open in IMG/M |
| 3300031945 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.OX082 | Environmental | Open in IMG/M |
| 3300031954 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.178 (v2) | Environmental | Open in IMG/M |
| 3300032770 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.5 | Environmental | Open in IMG/M |
| 3300032783 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.3 | Environmental | Open in IMG/M |
| 3300032805 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.2 | Environmental | Open in IMG/M |
| 3300032892 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.5 | Environmental | Open in IMG/M |
| 3300032955 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_2.5 | Environmental | Open in IMG/M |
| 3300033475 | Soil microbial communities from experimental microcosm in Duke University, North Carolina, United States - YC | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| A_all_C_02103990 | 2140918007 | Soil | FLLQLGPFGGAYVHGWPIRLWAAVYLVAALAAAVALFARKDL |
| E4A_08265080 | 2170459003 | Grass Soil | GPFGGAYVHGWGIRLWAVAYALVVGALALVSFARKDL |
| E41_04816450 | 2170459005 | Grass Soil | FLLQLGPFGGAYVHGWGIRAWSVGYLCVALALAVFAFRRRDL |
| A3PFW1_108750372 | 3300001535 | Permafrost | MITERASGLTGFLLQLGPFGGAYVHGWPIRAWAAVYLVAVLAAAVGLFARKNL* |
| A1565W1_104596193 | 3300001536 | Permafrost | FLLQLGPFGGAYVHGWGIRVWSVGYLIVVGAIALYAFSRRNL* |
| C688J35102_1184194941 | 3300002568 | Soil | ASGLTGFLLQLGPFGGAYVHGWGIRLWAVAYLVLVLGVAVAAFSRRNL* |
| Ga0062595_1001319713 | 3300004479 | Soil | SSNASGLTGFLLQLGPFGGAYVHGWGIRLWSVGYLCVALVVALLAFSRRDL* |
| Ga0062595_1006873051 | 3300004479 | Soil | LQLGPFGGAYVHGWPIRVWAIVYLVGIGVLALALFARKDL* |
| Ga0062595_1008053441 | 3300004479 | Soil | SGLTGFLLQLGPFGGAYVHGWGIRVWAAAYLCAALALAVLVFRRRDL* |
| Ga0066680_108480311 | 3300005174 | Soil | GLTGFLLQLGPFGGAYVHGWGIRVWAAAFLCLALALAVLAFQRRDL* |
| Ga0066679_102992262 | 3300005176 | Soil | QLGPFGGAYVHGWGIRVWAVGYLAAVLALAVLAFSRRNL* |
| Ga0066679_110000352 | 3300005176 | Soil | FTTFLLQLGPFGGSYNSGWGVRGWAAAYLVLVGAAALTAFARRDL* |
| Ga0066671_101831083 | 3300005184 | Soil | TGFLLQLGPFGGAYVHGWGIRLWSAGYLCVALILGLLAFSRRDL* |
| Ga0070658_100050671 | 3300005327 | Corn Rhizosphere | FLLQLGPFGGAYIHGWPIRLWAVAYLVLVLVAAVAAFSRRNL* |
| Ga0070683_1009586791 | 3300005329 | Corn Rhizosphere | LLQLGPFGGAYVHGWGVRVWAVGYLFAALALALVLFRRRDL* |
| Ga0070660_1015170162 | 3300005339 | Corn Rhizosphere | LQLGPFGGAYVHGWGIRVWAAFYLVAVLVLAVLAFGRRNL* |
| Ga0070661_1002170191 | 3300005344 | Corn Rhizosphere | FLLQLGPFGGAYVHGWGIRVWSAGYLVVVLAVAAAIFNRKSL* |
| Ga0070705_1006991111 | 3300005440 | Corn, Switchgrass And Miscanthus Rhizosphere | ASGLTGFLLQLGPFGGAYVHGWGIRVWAAGYLVAVLGIAVAAFQRRNL* |
| Ga0070708_1009774342 | 3300005445 | Corn, Switchgrass And Miscanthus Rhizosphere | FLLQLGPFGGAYVHGWGIRLWSVGYLLAALALAVFAFQRRDL* |
| Ga0070708_1017468452 | 3300005445 | Corn, Switchgrass And Miscanthus Rhizosphere | ALRLISRDASGLTGFLLQLGPFGGAYVHGWGIRVWSAGYLCVALLLAVLAFSRRDL* |
| Ga0070681_118033501 | 3300005458 | Corn Rhizosphere | LQLGPFGGAYVHGWPIRVWAAVYLLFVLAAAIAAFRRKNL* |
| Ga0070699_1021157702 | 3300005518 | Corn, Switchgrass And Miscanthus Rhizosphere | QLGPFGGAYVHGWGIRLWAVAYLAIVGALALVSFSRRNL* |
| Ga0070741_102699401 | 3300005529 | Surface Soil | LQLGPFGGGYVHGWTIRVWSVAYLVLVCAAALGAFARRNL* |
| Ga0070679_1002913801 | 3300005530 | Corn Rhizosphere | LLQLGPFGGAYIHGWGIRIWSVGYLFVVLTLAVFAFSRRNL* |
| Ga0070697_1017570892 | 3300005536 | Corn, Switchgrass And Miscanthus Rhizosphere | TGFLLQLGPFGGAYVHGWGIRLWAVAYLVIVGAVALVSFSRRNL* |
| Ga0070730_105167621 | 3300005537 | Surface Soil | LQLGPFGGAYVHGWGIRLWAVAYTLIVGAVALVSFARKNL* |
| Ga0070730_107435942 | 3300005537 | Surface Soil | LLQLGPFGGAFVHGWGVRVWAAGYLCVALALAVFLFQRRDL* |
| Ga0068853_1007772991 | 3300005539 | Corn Rhizosphere | LTGFLLQLGPFGGAYIHGWPIRVWAVAYLVLVLAAAIAAFSRRNL* |
| Ga0066707_107435361 | 3300005556 | Soil | QLGPFGGAYIHGWGIRLWAAAYLALVAFGAALVFARRDL* |
| Ga0066700_102526221 | 3300005559 | Soil | GGAYVHGWGIRVWSAGYLCVALALAVLAFSRRDL* |
| Ga0068855_1012176191 | 3300005563 | Corn Rhizosphere | FGGAYIHGWGIRIWSVGYLFVVLALAVFAFSRRNL* |
| Ga0066702_102996812 | 3300005575 | Soil | FLLQLGPFGGAYVHGWGIRVWSVAYVLIVGALALVSFARKNL* |
| Ga0068856_1014538562 | 3300005614 | Corn Rhizosphere | LGPFGGAYVHGWPIRVWAAGYLVVALALAVLAFSRRDL* |
| Ga0066903_1009505663 | 3300005764 | Tropical Forest Soil | LQLGPFGGAYVHGWPIRVWAVVYLVAVGAAALSLFARKDL* |
| Ga0066903_1034473392 | 3300005764 | Tropical Forest Soil | LQLGPFGGAYVHGWGIRIWAVVYLAGILALGLWAFSRRNL* |
| Ga0066903_1039901462 | 3300005764 | Tropical Forest Soil | FGGGYVHGWGIRVWSLGYLVVALAVAVLAFSRKDL* |
| Ga0066903_1067468592 | 3300005764 | Tropical Forest Soil | PFGGAYVHGWGIRVWSVGYLIVALALAVFAFQHRDL* |
| Ga0075275_10969192 | 3300005892 | Rice Paddy Soil | FLLQLGPFGGAYVHGWGIRVWAAGYLCVALALALLAFSRRDL* |
| Ga0075270_10270391 | 3300005894 | Rice Paddy Soil | GGAYVHGWGIRVWAAGYLLVALALALFAFRQRDL* |
| Ga0075279_100848772 | 3300005903 | Rice Paddy Soil | FLLQLGPFGGAYVHGWGIRVWAAAYLGIALALALTVFARRDL* |
| Ga0066696_109501261 | 3300006032 | Soil | FLLQLGPFGGAYVHGWPIRIWAAGYLVAILAIAVAAFSRRNL* |
| Ga0079222_107681261 | 3300006755 | Agricultural Soil | ILQLGPFGGGYVHGWTIRTWSIGYLVLALAAAVAAFSRRNL* |
| Ga0079220_102702921 | 3300006806 | Agricultural Soil | TENASGLTGFLLQLGPFGGAYVHGWPIRFWAAGYLVLVLGAGLLAFSRRNL* |
| Ga0079220_106846471 | 3300006806 | Agricultural Soil | TGFLLQLGPFGGAYVHGWGIRVWSVGYLCVALGLALLAFSRRDL* |
| Ga0075436_1014335321 | 3300006914 | Populus Rhizosphere | PFGGAYVHGWGIRVWSVGYLCVALVLAVLAFSRRDL* |
| Ga0099795_104917362 | 3300007788 | Vadose Zone Soil | FFLQLGPFGGAYVHGWGIRLWAVGFLCIALALAVFLFQRRDL* |
| Ga0099827_115504191 | 3300009090 | Vadose Zone Soil | LLQLGPFGGAYVHGWGIRVWSLGYLLVIDAVALYAFSRRNL* |
| Ga0105245_103296831 | 3300009098 | Miscanthus Rhizosphere | GATSFLLQLGPFGGGYVHGWEIRLWSVAYLVLIGAAALAAFARRDL* |
| Ga0116108_10728451 | 3300009519 | Peatland | SFLLQLGPFGGAYVHGWTIRVGAVGFLVAVGAVALAAFSRKNL* |
| Ga0116107_12138342 | 3300009548 | Peatland | GGAYVHGWTIRVWAVGYLVAVGAVALAAFSRKNL* |
| Ga0116124_10146931 | 3300009634 | Peatland | LTSFLLQLGPFGGAYVHGWTIRVWAVGYLVAVGAVALAAFSRKNL* |
| Ga0127503_108846011 | 3300010154 | Soil | FGGAYVHGWGIRLWSVGYLCVALALAVFAFSRRDL* |
| Ga0134086_104329301 | 3300010323 | Grasslands Soil | LGPFGGAYVHGWGIRVWAAGYLVALLGIALAAFQRRNL* |
| Ga0134111_104456651 | 3300010329 | Grasslands Soil | LTGFLLQLGPFGGAYVHGWGIRLWAAAYLCVVLALAVAAFARRNL* |
| Ga0134128_107342301 | 3300010373 | Terrestrial Soil | MITENASGLTGFLLQLGPFGGAYVHGWGICAWAVVYLAAVLALGAAVFN |
| Ga0134128_118300991 | 3300010373 | Terrestrial Soil | TGFLLQLGPFGGAYVHVWGIRVWSAGYLCVALVLGLLAFSRRDL* |
| Ga0134128_118537763 | 3300010373 | Terrestrial Soil | ASGLTGFLLQLGPFGGAYVHGWGIRVWSAGYLCVALALAVLAFQRRDL* |
| Ga0126381_1007289691 | 3300010376 | Tropical Forest Soil | LLQLGPFGGGYVHGWGIRLWSVGYLCLALVLAVLAFSRKDL* |
| Ga0126381_1015652963 | 3300010376 | Tropical Forest Soil | GFLLQLGPFGGAYVHGWPIRVWAVVYLLAIGVAAIALFARKDL* |
| Ga0137393_106393862 | 3300011271 | Vadose Zone Soil | RMITEKVSVLTGFLLQPGPFGGEYVHGWPIRIWAAFYLVAVLAAAIALFSRRNL* |
| Ga0137363_116267652 | 3300012202 | Vadose Zone Soil | LLQLGPFGGAYVHGWPIRIWAVAYLVAALAAAVALFLRKDL* |
| Ga0137379_111051621 | 3300012209 | Vadose Zone Soil | SGLTGFLLQLGPFGGAYVHGWGIRVWSVGYLVAVGAFALWAFSRRNL* |
| Ga0137367_109460422 | 3300012353 | Vadose Zone Soil | GGGYVHGWSIRLWAAAYLVVFGMVALALFARRDL* |
| Ga0137371_108947792 | 3300012356 | Vadose Zone Soil | GFLLQLGPFGGAYVHGWGIRVWSAAYLVAVLAVALYGFSRRNL* |
| Ga0137410_118378092 | 3300012944 | Vadose Zone Soil | QLGPFGGAYVHGWPIRIWAGVYLVLALAAAVALFSRKDL* |
| Ga0164305_111194972 | 3300012989 | Soil | LGPFGGAYVHGWGIRVWAVFYLVAVLAVAVAAFGRRNL* |
| Ga0157369_109392742 | 3300013105 | Corn Rhizosphere | LQLGPFGGAYVHGWGIRVWSAGYLVVVLAVAAAIFNRKSL* |
| Ga0157372_125304472 | 3300013307 | Corn Rhizosphere | QLGPFGGAYIHGWPIRIWAVCYLLLVLAAAVAAFSRRNL* |
| Ga0137409_102433233 | 3300015245 | Vadose Zone Soil | PFGGAYVHGWPIRVWAVVYLGAALAAAVALFQRKDL* |
| Ga0132258_137470712 | 3300015371 | Arabidopsis Rhizosphere | EALYQDGLRMITENTSGLTGFLLQLGPFRGAYVHGWGIRVWALVYTLLVGAVALAAFARKDL* |
| Ga0132256_1017470061 | 3300015372 | Arabidopsis Rhizosphere | TGFLLQLGPFGGAYVHGWPIRVWAIVYLVGIGVLALALFARKDL* |
| Ga0132256_1028760711 | 3300015372 | Arabidopsis Rhizosphere | LLQLGPFGGGYVHGWSIRLWAVAYLAVIGAAALAAFTRRNL* |
| Ga0182040_104703933 | 3300016387 | Soil | LQLGPFGGAYVHGWPIRVWAVAYLVASGAGALALFARKDL |
| Ga0187821_102639201 | 3300017936 | Freshwater Sediment | GPFGGAYVHGWPIRVWAVAYTLGVGVLALAAFARKNL |
| Ga0187809_101876342 | 3300017937 | Freshwater Sediment | FGGAYVHGWGIRAWAVVYVLLIGAVALFSFSRKNL |
| Ga0187779_111093942 | 3300017959 | Tropical Peatland | TEHQTGLNAFLLQLGPFGGAYVHGWSIRIWAIVYLVLVGATALALFARKDL |
| Ga0190275_109081822 | 3300018432 | Soil | GPFGGADPAGPGLVLFAAAYTGVVIALAVAAFARRDL |
| Ga0066667_119203881 | 3300018433 | Grasslands Soil | LTGFLLQLGPFGGAYVHGWGIRVWAVAYVLIVGAVALVSFTRKNL |
| Ga0206354_114805321 | 3300020081 | Corn, Switchgrass And Miscanthus Rhizosphere | FGGAYVHGWGIRVWAVAYLALVLALGAVVFNRKNL |
| Ga0206353_107066462 | 3300020082 | Corn, Switchgrass And Miscanthus Rhizosphere | FLLQLGPFGGAYIHGWPIRIWAAAYLLLVLVAAVAAFSRRNL |
| Ga0213874_102645192 | 3300021377 | Plant Roots | VQLGPFGGGYVHGWPIRIWAVLYLLAVLAAAVAAFNRRNL |
| Ga0207656_105262901 | 3300025321 | Corn Rhizosphere | GLTGAALKLGPFGGSFVYGWDVRVWAVGYLGAALALAVFLFKRRDL |
| Ga0208689_10093035 | 3300025459 | Peatland | ENTSGLTSFLLQLGPFGGAYVHGWTIRVWAVGYLVAVGAVALAAFSRKNL |
| Ga0208192_10711582 | 3300025477 | Peatland | LTSFLLQLGPFGGAYVHGWTIRVWAVGYLVAVGAVALAAFSRKNL |
| Ga0207664_105816701 | 3300025929 | Agricultural Soil | TGFLLQLGPFGGAYVHGWGIRVWAVAYVLIVGALALVSFARKNL |
| Ga0207664_112858291 | 3300025929 | Agricultural Soil | QLGPFGGAYVHGWGIRVWSLGYLLVVGAVALYAFSRRNL |
| Ga0210077_10588172 | 3300025952 | Natural And Restored Wetlands | LQLGPFGGAYVHGWGIRVWAACYLVAALVLALLAFSRRDL |
| Ga0208650_10296671 | 3300026036 | Rice Paddy Soil | ITGFLLQLGPFGGAYVHGWGIRVWAAAYLGIALALALTVFARRDL |
| Ga0209471_12174662 | 3300026318 | Soil | GFLLQLGPFGGAYVHGWGIRVWAVGYLAAVLALAVLAFSRRNL |
| Ga0209805_11831291 | 3300026542 | Soil | GPFGGAYVHGWPIRLWSVAYALLVGGLALVSFARKDL |
| Ga0209577_104084443 | 3300026552 | Soil | LLQLGPFGGSYNSGWGVRGWAAAYLVLVGAAALTAFSRRDL |
| Ga0209579_107817682 | 3300027869 | Surface Soil | TSFLLQLGPFGGAYVHGWPIRIWSLAYLVLIGAAAIFAFSRRDL |
| Ga0265318_103429161 | 3300028577 | Rhizosphere | GPFGGAYVHGWTIRIWALGYLVAVGAIAVWAFARRNL |
| Ga0265323_100523681 | 3300028653 | Rhizosphere | PFGGAYVHGWTIRIWALAYLVAVGAVALFAFRRKNL |
| Ga0265336_101981062 | 3300028666 | Rhizosphere | PFGGAYVHGWTIRIWALGYLVAVGAVALFAFRRKNL |
| Ga0265336_102397442 | 3300028666 | Rhizosphere | SGLTGFLLQLGPFGGAYVHGWPIRVWAAFYLVAALAAAVALFARKDL |
| Ga0307503_100244261 | 3300028802 | Soil | TENTFGLTGFLLQLGPFGGAYVHGWPIRIWAAVYLVLALAAAVALFLRKDL |
| Ga0247827_112570321 | 3300028889 | Soil | ATSFLLQLGPFGGGYVHGWTIRVWALAYLALVVAAALAAFARRNL |
| Ga0265328_101722612 | 3300031239 | Rhizosphere | FGGAYVHGWPIRVWAAFYLVAALAAAVALFARKDL |
| Ga0265325_103653632 | 3300031241 | Rhizosphere | SNASGLTGFLLQLGPFGGAYVHGWPIRIWAAAYLVMVGGAALAAFSRRNL |
| Ga0265339_105770052 | 3300031249 | Rhizosphere | SGLTGFLLQLGPFGGAYVHGWPIRIWAAAYLVMVGGAALAAFSRRNL |
| Ga0265327_100772231 | 3300031251 | Rhizosphere | LGPFGGAYVHGWGIRVWAVGYVVAVGAVALAAFARKNL |
| Ga0265342_106990232 | 3300031712 | Rhizosphere | GLTGFLLQLGPFGGAYVHGWPIRIWAAAYLAFVGGAALAAFSRRNL |
| Ga0318500_107051261 | 3300031724 | Soil | IISSNASGVTGFLLQLGPFGGAFVHGWGVRIWSLGYLCAALALAVFLFKRRDL |
| Ga0318498_103888721 | 3300031778 | Soil | LQLGPFGGAYVHGWPIRLWSIVYLAAIGAAALALFARKDL |
| Ga0310913_113200491 | 3300031945 | Soil | LQLGPFGGAYVHGWSIRIWAVVYLLLVGAAALALFARKDL |
| Ga0306926_105008881 | 3300031954 | Soil | GVTGFLLQLGPFGGAFVHGWGVRIWSLGYLCAALALAVFLFKRRDL |
| Ga0335085_101930475 | 3300032770 | Soil | FGGAYVHGWGIRVWAAAYLALALGLGLVGFSRRDL |
| Ga0335079_104709021 | 3300032783 | Soil | TGFLLQLGPFGGAYVHGWEIRVWSAAYLVAIGALALWAFSRRNL |
| Ga0335078_113416291 | 3300032805 | Soil | GLTGFLLQLGPFGGAYVHGWEIRVWSAAYLVAIGALALWAFSRRNL |
| Ga0335081_1003612012 | 3300032892 | Soil | QLGPFGGAYIHGWQIRVWAAAYLAIALAVALLAFRRRDL |
| Ga0335076_102698283 | 3300032955 | Soil | TGFLLQLGPFGGAYVHGWEIRVWSVAYLVAIGALALWAFSRRNL |
| Ga0310811_100091061 | 3300033475 | Soil | LQLGPFGGAYVHGWGIRVWAAFYLVAVLVLAVLAFGRRNL |
| ⦗Top⦘ |