NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome Family F082399

Metagenome Family F082399

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F082399
Family Type Metagenome
Number of Sequences 113
Average Sequence Length 43 residues
Representative Sequence LVKMTAVVIVTSPKTQTRKTREEAKVVRSMNFPVPISVLITGS
Number of Associated Samples 108
Number of Associated Scaffolds 113

Quality Assessment
Transcriptomic Evidence No
Most common taxonomic group Bacteria
% of genes with valid RBS motifs 0.00 %
% of genes near scaffold ends (potentially truncated) 99.12 %
% of genes from short scaffolds (< 2000 bps) 93.81 %
Associated GOLD sequencing projects 103
AlphaFold2 3D model prediction Yes
3D model pTM-score0.21

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Bacteria (83.186 % of family members)
NCBI Taxonomy ID 2
Taxonomy All Organisms → cellular organisms → Bacteria

Most Common Ecosystem
GOLD Ecosystem Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil
(11.504 % of family members)
Environment Ontology (ENVO) Unclassified
(31.858 % of family members)
Earth Microbiome Project Ontology (EMPO) Free-living → Non-saline → Soil (non-saline)
(48.673 % of family members)


 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      

 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Globular Signal Peptide: No Secondary Structure distribution: α-helix: 45.07%    β-sheet: 0.00%    Coil/Unstructured: 54.93%
Feature Viewer
Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer
Per-residue confidence (pLDDT):
  0-50   51-70   71-90   91-100  		pTM-score: 0.21
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.

 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 113 Family Scaffolds
PF09361Phasin_2 73.45
PF02617ClpS 2.65
PF02861Clp_N 1.77
PF13519VWA_2 0.88

Neighboring Clusters of Orthologous Genes (COGs)

COG IDNameFunctional Category % Frequency in 113 Family Scaffolds
COG2127ATP-dependent Clp protease adapter protein ClpSPosttranslational modification, protein turnover, chaperones [O] 2.65
COG0542ATP-dependent Clp protease, ATP-binding subunit ClpAPosttranslational modification, protein turnover, chaperones [O] 1.77

 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms83.19 %
UnclassifiedrootN/A16.81 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
2065487018|GPINP_F5MS3JC02JR5J3Not Available520Open in IMG/M
2124908045|KansclcFeb2_ConsensusfromContig823521Not Available526Open in IMG/M
3300001686|C688J18823_10188933All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria1395Open in IMG/M
3300002155|JGI24033J26618_1036577All Organisms → cellular organisms → Bacteria → Proteobacteria674Open in IMG/M
3300002568|C688J35102_120117883All Organisms → cellular organisms → Bacteria → Proteobacteria887Open in IMG/M
3300003322|rootL2_10108671All Organisms → cellular organisms → Bacteria → Proteobacteria1732Open in IMG/M
3300003322|rootL2_10132756All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium2061Open in IMG/M
3300003911|JGI25405J52794_10048399All Organisms → cellular organisms → Bacteria → Proteobacteria908Open in IMG/M
3300004082|Ga0062384_100784696All Organisms → cellular organisms → Bacteria → Proteobacteria664Open in IMG/M
3300005575|Ga0066702_10394290All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria844Open in IMG/M
3300005576|Ga0066708_10187640All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria1290Open in IMG/M
3300005578|Ga0068854_102195712Not Available511Open in IMG/M
3300005843|Ga0068860_100373567All Organisms → cellular organisms → Bacteria → Proteobacteria1406Open in IMG/M
3300006031|Ga0066651_10198254All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria1062Open in IMG/M
3300006047|Ga0075024_100028654All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium2272Open in IMG/M
3300006047|Ga0075024_100465975All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria656Open in IMG/M
3300006052|Ga0075029_100344321All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria959Open in IMG/M
3300006102|Ga0075015_100100645All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria1450Open in IMG/M
3300006800|Ga0066660_10459166All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria1066Open in IMG/M
3300009088|Ga0099830_11008381All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria690Open in IMG/M
3300009092|Ga0105250_10461539Not Available571Open in IMG/M
3300009143|Ga0099792_10533828All Organisms → cellular organisms → Bacteria → Proteobacteria739Open in IMG/M
3300009143|Ga0099792_10561660All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria723Open in IMG/M
3300009148|Ga0105243_11327856All Organisms → cellular organisms → Bacteria → Proteobacteria737Open in IMG/M
3300009545|Ga0105237_11588105All Organisms → cellular organisms → Bacteria → Proteobacteria661Open in IMG/M
3300009551|Ga0105238_11536761All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales695Open in IMG/M
3300009627|Ga0116109_1135694Not Available554Open in IMG/M
3300009635|Ga0116117_1157804Not Available586Open in IMG/M
3300009700|Ga0116217_10079292All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium2284Open in IMG/M
3300009824|Ga0116219_10159064All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria1304Open in IMG/M
3300010038|Ga0126315_10533037All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria752Open in IMG/M
3300010166|Ga0126306_11050075All Organisms → cellular organisms → Bacteria → Proteobacteria665Open in IMG/M
3300010375|Ga0105239_10240799All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales2030Open in IMG/M
3300010397|Ga0134124_10638951All Organisms → cellular organisms → Bacteria → Proteobacteria1047Open in IMG/M
3300011003|Ga0138514_100021786All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium1155Open in IMG/M
3300011269|Ga0137392_11181892Not Available623Open in IMG/M
3300012189|Ga0137388_11439173Not Available627Open in IMG/M
3300012189|Ga0137388_11924045Not Available521Open in IMG/M
3300012202|Ga0137363_10113509All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium2079Open in IMG/M
3300012207|Ga0137381_11483547Not Available570Open in IMG/M
3300012903|Ga0157289_10167736All Organisms → cellular organisms → Bacteria → Proteobacteria691Open in IMG/M
3300012907|Ga0157283_10189115All Organisms → cellular organisms → Bacteria → Proteobacteria640Open in IMG/M
3300012924|Ga0137413_10722945All Organisms → cellular organisms → Bacteria → Proteobacteria758Open in IMG/M
3300012927|Ga0137416_10028630All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium3680Open in IMG/M
3300012929|Ga0137404_10980837All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria773Open in IMG/M
3300012930|Ga0137407_11856446Not Available574Open in IMG/M
3300012961|Ga0164302_10432780All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria908Open in IMG/M
3300012986|Ga0164304_11790554Not Available514Open in IMG/M
3300012988|Ga0164306_10056680All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium2394Open in IMG/M
3300014200|Ga0181526_10765174Not Available608Open in IMG/M
3300014326|Ga0157380_10302184All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium1475Open in IMG/M
3300014497|Ga0182008_10841120Not Available536Open in IMG/M
3300014502|Ga0182021_12078702All Organisms → cellular organisms → Bacteria → Proteobacteria684Open in IMG/M
3300015089|Ga0167643_1035892All Organisms → cellular organisms → Bacteria → Proteobacteria767Open in IMG/M
3300019866|Ga0193756_1036278All Organisms → cellular organisms → Bacteria → Proteobacteria694Open in IMG/M
3300019876|Ga0193703_1056478All Organisms → cellular organisms → Bacteria → Proteobacteria595Open in IMG/M
3300019877|Ga0193722_1037624All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae1245Open in IMG/M
3300020034|Ga0193753_10151681All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium1104Open in IMG/M
3300021171|Ga0210405_10356795All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria1153Open in IMG/M
3300022694|Ga0222623_10192379All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria792Open in IMG/M
3300023079|Ga0247758_1217557Not Available531Open in IMG/M
3300025406|Ga0208035_1059562Not Available585Open in IMG/M
3300025891|Ga0209585_10060484All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium1405Open in IMG/M
3300025900|Ga0207710_10486308All Organisms → cellular organisms → Bacteria → Proteobacteria640Open in IMG/M
3300025912|Ga0207707_11309765Not Available582Open in IMG/M
3300025916|Ga0207663_10354811All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria1111Open in IMG/M
3300025924|Ga0207694_10559796All Organisms → cellular organisms → Bacteria → Proteobacteria960Open in IMG/M
3300025939|Ga0207665_10151378All Organisms → cellular organisms → Bacteria → Proteobacteria1662Open in IMG/M
3300026035|Ga0207703_11083683All Organisms → cellular organisms → Bacteria → Proteobacteria769Open in IMG/M
3300026041|Ga0207639_10761773All Organisms → cellular organisms → Bacteria → Proteobacteria901Open in IMG/M
3300026089|Ga0207648_11011562All Organisms → cellular organisms → Bacteria → Proteobacteria778Open in IMG/M
3300026142|Ga0207698_11517477All Organisms → cellular organisms → Bacteria → Proteobacteria685Open in IMG/M
3300026273|Ga0209881_1111665All Organisms → cellular organisms → Bacteria → Proteobacteria681Open in IMG/M
3300026308|Ga0209265_1181705Not Available557Open in IMG/M
3300026340|Ga0257162_1003254All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria1806Open in IMG/M
3300026377|Ga0257171_1019766All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria1133Open in IMG/M
3300026475|Ga0257147_1024885All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria847Open in IMG/M
3300026508|Ga0257161_1065768All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria740Open in IMG/M
3300026530|Ga0209807_1126143All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria1031Open in IMG/M
3300026542|Ga0209805_1222578All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria789Open in IMG/M
3300026552|Ga0209577_10249562All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria1340Open in IMG/M
3300026880|Ga0209623_1005573All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria752Open in IMG/M
3300027381|Ga0208983_1009968All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium1798Open in IMG/M
3300027480|Ga0208993_1034248All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria906Open in IMG/M
3300027524|Ga0208998_1024974All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria944Open in IMG/M
3300027530|Ga0209216_1092925All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria528Open in IMG/M
3300027535|Ga0209734_1038160All Organisms → cellular organisms → Bacteria → Proteobacteria902Open in IMG/M
3300027535|Ga0209734_1039954All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria881Open in IMG/M
3300027587|Ga0209220_1027503All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium erythrophlei1526Open in IMG/M
3300027625|Ga0208044_1056680All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria1233Open in IMG/M
3300027663|Ga0208990_1113201All Organisms → cellular organisms → Bacteria → Proteobacteria743Open in IMG/M
3300027674|Ga0209118_1140347All Organisms → cellular organisms → Bacteria → Proteobacteria670Open in IMG/M
3300027750|Ga0209461_10052262All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria835Open in IMG/M
3300027894|Ga0209068_10235431All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria1015Open in IMG/M
3300027895|Ga0209624_10958538Not Available556Open in IMG/M
3300027908|Ga0209006_10205440All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium1709Open in IMG/M
3300028047|Ga0209526_10110562All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium1933Open in IMG/M
3300028146|Ga0247682_1077748All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria609Open in IMG/M
3300028536|Ga0137415_10821846All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria739Open in IMG/M
3300028780|Ga0302225_10154225All Organisms → cellular organisms → Bacteria → Proteobacteria1113Open in IMG/M
3300028785|Ga0302201_10103679All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp. DOA91277Open in IMG/M
3300028876|Ga0307286_10024060All Organisms → cellular organisms → Bacteria → Proteobacteria1977Open in IMG/M
3300029907|Ga0311329_10303742All Organisms → cellular organisms → Bacteria → Proteobacteria1158Open in IMG/M
3300029917|Ga0311326_10084913All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium erythrophlei1773Open in IMG/M
3300030041|Ga0302274_10337338All Organisms → cellular organisms → Bacteria → Proteobacteria689Open in IMG/M
3300030707|Ga0310038_10380698All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria618Open in IMG/M
3300031198|Ga0307500_10065779All Organisms → cellular organisms → Bacteria → Proteobacteria909Open in IMG/M
3300031456|Ga0307513_10460741All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium994Open in IMG/M
3300031474|Ga0170818_108265870All Organisms → cellular organisms → Bacteria → Proteobacteria695Open in IMG/M
3300031708|Ga0310686_110464757All Organisms → cellular organisms → Bacteria → Proteobacteria615Open in IMG/M
3300031858|Ga0310892_10428924All Organisms → cellular organisms → Bacteria → Proteobacteria867Open in IMG/M
3300031995|Ga0307409_100320426All Organisms → cellular organisms → Bacteria → Proteobacteria1450Open in IMG/M
3300032174|Ga0307470_10987395All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium icense669Open in IMG/M


 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
Vadose Zone SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil11.50%
Forest SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil11.50%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil10.62%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Soil8.85%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil5.31%
WatershedsEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds4.42%
Peatlands SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil3.54%
BogEnvironmental → Terrestrial → Peat → Unclassified → Unclassified → Bog3.54%
Corn RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere3.54%
PeatlandEnvironmental → Aquatic → Freshwater → Wetlands → Unclassified → Peatland2.65%
Corn RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere2.65%
Serpentine SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Serpentine Soil1.77%
SoilEnvironmental → Terrestrial → Soil → Loam → Grasslands → Soil1.77%
Corn, Switchgrass And Miscanthus RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere1.77%
Switchgrass RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere1.77%
Sugarcane Root And Bulk SoilHost-Associated → Plants → Rhizome → Unclassified → Unclassified → Sugarcane Root And Bulk Soil1.77%
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere1.77%
Bog Forest SoilEnvironmental → Aquatic → Freshwater → Wetlands → Bog → Bog Forest Soil0.89%
BogEnvironmental → Aquatic → Freshwater → Wetlands → Bog → Bog0.89%
Groundwater SedimentEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment0.89%
Terrestrial SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil0.89%
Glacier Forefield SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Glacier Forefield Soil0.89%
Arctic Peat SoilEnvironmental → Terrestrial → Soil → Unclassified → Permafrost → Arctic Peat Soil0.89%
Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil0.89%
Hardwood Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil0.89%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural → Soil0.89%
FenEnvironmental → Terrestrial → Soil → Wetlands → Permafrost → Fen0.89%
SoilEnvironmental → Terrestrial → Soil → Wetlands → Permafrost → Soil0.89%
Corn RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere0.89%
PalsaEnvironmental → Terrestrial → Peat → Unclassified → Unclassified → Palsa0.89%
Plant LitterEnvironmental → Terrestrial → Plant Litter → Unclassified → Unclassified → Plant Litter0.89%
SoilEnvironmental → Terrestrial → Agricultural Field → Unclassified → Unclassified → Soil0.89%
Tabebuia Heterophylla RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Tabebuia Heterophylla Rhizosphere0.89%
Miscanthus RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere0.89%
Corn, Switchgrass And Miscanthus RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn, Switchgrass And Miscanthus Rhizosphere0.89%
EctomycorrhizaHost-Associated → Plants → Roots → Unclassified → Unclassified → Ectomycorrhiza0.89%
RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere0.89%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere0.89%
RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere0.89%
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere0.89%
AgaveHost-Associated → Plants → Phyllosphere → Phylloplane/Leaf Surface → Unclassified → Agave0.89%

Visualization
Powered by ApexCharts



Associated Samples

Taxon OIDSample NameHabitat TypeIMG/M Link
2065487018Soil microbial communities from Great Prairies - Iowa, Native Prairie soilEnvironmentalOpen in IMG/M
2124908045Soil microbial communities from Great Prairies - Kansas assembly 1 01_01_2011EnvironmentalOpen in IMG/M
3300001686Grasslands soil microbial communities from Hopland, California, USAEnvironmentalOpen in IMG/M
3300002155Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX- M7Host-AssociatedOpen in IMG/M
3300002568Grasslands soil microbial communities from Hopland, California, USA - 2EnvironmentalOpen in IMG/M
3300003322Sugarcane root Sample L2Host-AssociatedOpen in IMG/M
3300003911Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1Host-AssociatedOpen in IMG/M
3300004082Coassembly of ECP03_0M1, ECP03_OM2, ECP03_OM3EnvironmentalOpen in IMG/M
3300005575Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_151EnvironmentalOpen in IMG/M
3300005576Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_157EnvironmentalOpen in IMG/M
3300005578Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2Host-AssociatedOpen in IMG/M
3300005843Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2Host-AssociatedOpen in IMG/M
3300006031Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Angelo_100EnvironmentalOpen in IMG/M
3300006047Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Straight Creek_MetaG_SC_2013EnvironmentalOpen in IMG/M
3300006052Freshwater sediment microbial communities from North America - Little Laurel Run_MetaG_LLR_2013EnvironmentalOpen in IMG/M
3300006102Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Alex Branch Run_MetaG_ABR_2013EnvironmentalOpen in IMG/M
3300006800Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_109EnvironmentalOpen in IMG/M
3300009088Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H3.8 metaGEnvironmentalOpen in IMG/M
3300009092Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaGHost-AssociatedOpen in IMG/M
3300009143Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_2EnvironmentalOpen in IMG/M
3300009148Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaGHost-AssociatedOpen in IMG/M
3300009545Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaGHost-AssociatedOpen in IMG/M
3300009551Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaGHost-AssociatedOpen in IMG/M
3300009627Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_8_10EnvironmentalOpen in IMG/M
3300009635Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_11_10EnvironmentalOpen in IMG/M
3300009700Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_4_PS metaGEnvironmentalOpen in IMG/M
3300009824Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_6_BS metaGEnvironmentalOpen in IMG/M
3300010038Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot106EnvironmentalOpen in IMG/M
3300010166Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot27EnvironmentalOpen in IMG/M
3300010375Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaGHost-AssociatedOpen in IMG/M
3300010397Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-4EnvironmentalOpen in IMG/M
3300011003Agricultural soil microbial communities from Tamara ranch near Red Deer, Alberta, Canada - d1t9i015EnvironmentalOpen in IMG/M
3300011269Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h3.4A metaGEnvironmentalOpen in IMG/M
3300012189Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h1.4A metaGEnvironmentalOpen in IMG/M
3300012202Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_115_16 metaGEnvironmentalOpen in IMG/M
3300012207Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_115_16 metaGEnvironmentalOpen in IMG/M
3300012903Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S134-311R-1EnvironmentalOpen in IMG/M
3300012907Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S044-104R-1EnvironmentalOpen in IMG/M
3300012924Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_16fungal (Illumina Assembly)EnvironmentalOpen in IMG/M
3300012927Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_1_16fungal (Illumina Assembly)EnvironmentalOpen in IMG/M
3300012929Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_16fungal (Illumina Assembly)EnvironmentalOpen in IMG/M
3300012930Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_2_16fungal (Illumina Assembly)EnvironmentalOpen in IMG/M
3300012961Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_202_MGEnvironmentalOpen in IMG/M
3300012986Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_217_MGEnvironmentalOpen in IMG/M
3300012988Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_242_MGEnvironmentalOpen in IMG/M
3300014200Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin06_30_metaGEnvironmentalOpen in IMG/M
3300014326Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaGHost-AssociatedOpen in IMG/M
3300014497Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaGHost-AssociatedOpen in IMG/M
3300014502Permafrost microbial communities from Stordalen Mire, Sweden - 612E3M metaG (Illumina Assembly)EnvironmentalOpen in IMG/M
3300015089Arctic soil microbial communities from a glacier forefield, Russell Glacier, Kangerlussuaq, Greenland (Sample G8A, Adjacent to main proglacial river, end of transect (Watson river))EnvironmentalOpen in IMG/M
3300019866Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? H1m1EnvironmentalOpen in IMG/M
3300019876Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U3a2EnvironmentalOpen in IMG/M
3300019877Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? H2m1EnvironmentalOpen in IMG/M
3300020034Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? H1c2EnvironmentalOpen in IMG/M
3300021171Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-11-MEnvironmentalOpen in IMG/M
3300022694Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM2_30_coexEnvironmentalOpen in IMG/M
3300023079Plant litter microbial communities from Arlington Agricultural Research Station in Wisconsin, United States - UWRJ-L156-409C-4EnvironmentalOpen in IMG/M
3300025406Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_11_10 (SPAdes)EnvironmentalOpen in IMG/M
3300025891Arctic peat soil microbial communities from the Barrow Environmental Observatory site, Barrow, Alaska, USA - NGEE Permafrost154B-one (SPAdes)EnvironmentalOpen in IMG/M
3300025900Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025912Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025916Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025924Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025939Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300026035Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300026041Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300026089Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300026142Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300026273Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Permafrost soil replicate 3 DNA2013-193 (SPAdes)EnvironmentalOpen in IMG/M
3300026308Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_103 (SPAdes)EnvironmentalOpen in IMG/M
3300026340Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - NR-04-AEnvironmentalOpen in IMG/M
3300026377Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - DW-10-BEnvironmentalOpen in IMG/M
3300026475Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - CO-12-AEnvironmentalOpen in IMG/M
3300026508Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - NR-01-AEnvironmentalOpen in IMG/M
3300026530Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_154 (SPAdes)EnvironmentalOpen in IMG/M
3300026542Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_148 (SPAdes)EnvironmentalOpen in IMG/M
3300026552Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_109 (SPAdes)EnvironmentalOpen in IMG/M
3300026880Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_Ref_M1 (SPAdes)EnvironmentalOpen in IMG/M
3300027381Forest soil microbial communities from El Dorado National Forest, California, USA - Mediterranean Blodgett CA Ref_M2 (SPAdes)EnvironmentalOpen in IMG/M
3300027480Forest soil microbial communities from El Dorado National Forest, California, USA - Mediterranean Blodgett CA OM2_M3 (SPAdes)EnvironmentalOpen in IMG/M
3300027524Forest soil microbial communities from El Dorado National Forest, California, USA - Mediterranean Blodgett CA OM2_M2 (SPAdes)EnvironmentalOpen in IMG/M
3300027530Forest soil microbial communities from Davy Crockett National Forest, Groveton, Texas, USA - Texas A ecozone_OM2H0_O2 (SPAdes)EnvironmentalOpen in IMG/M
3300027535Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM1_M2 (SPAdes)EnvironmentalOpen in IMG/M
3300027587Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM3_M3 (SPAdes)EnvironmentalOpen in IMG/M
3300027625Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_c_BC metaG (SPAdes)EnvironmentalOpen in IMG/M
3300027663Forest soil microbial communities from El Dorado National Forest, California, USA - Mediterranean Blodgett CA Ref_M3 (SPAdes)EnvironmentalOpen in IMG/M
3300027674Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_Ref_M1 (SPAdes)EnvironmentalOpen in IMG/M
3300027750Agave microbial communities from Guanajuato, Mexico - As.Ma.rz (SPAdes)Host-AssociatedOpen in IMG/M
3300027894Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Cold Stream Run_MetaG_CSR_2012 (SPAdes)EnvironmentalOpen in IMG/M
3300027895Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM2H0_O1 (SPAdes)EnvironmentalOpen in IMG/M
3300027908Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_Ref_O2 (SPAdes)EnvironmentalOpen in IMG/M
3300028047Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM2H0_M1 (SPAdes)EnvironmentalOpen in IMG/M
3300028146Soil microbial communities from Purdue University Martell Research Forest, Indiana, United States - CNK23EnvironmentalOpen in IMG/M
3300028536Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_1_16fungal (Hybrid Assembly)EnvironmentalOpen in IMG/M
3300028780Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Palsa_E3_2EnvironmentalOpen in IMG/M
3300028785Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Bog_N3_2EnvironmentalOpen in IMG/M
3300028876Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_140EnvironmentalOpen in IMG/M
3300029907I_Bog_N1 coassemblyEnvironmentalOpen in IMG/M
3300029917I_Bog_E1 coassemblyEnvironmentalOpen in IMG/M
3300030041Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - III_Bog_N2_1EnvironmentalOpen in IMG/M
3300030707Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_4_PS metaG (v2)EnvironmentalOpen in IMG/M
3300031198Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 14_SEnvironmentalOpen in IMG/M
3300031456Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EMHost-AssociatedOpen in IMG/M
3300031474Fir Coassembly Site 11 - Champenoux / Amance forestEnvironmentalOpen in IMG/M
3300031708FICUS49499 Metagenome Czech Republic combined assemblyEnvironmentalOpen in IMG/M
3300031858Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C8D2EnvironmentalOpen in IMG/M
3300031995Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2Host-AssociatedOpen in IMG/M
3300032174Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_05EnvironmentalOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap


 ⦗Top⦘

Family Sequences

Protein ID Sample Taxon ID Habitat Sequence
GPINP_028719202065487018SoilMIAVVIVNNAKTLARRTREEAKVVRSMNFPVPISDLITGS
KansclcFeb2_076289902124908045SoilSVVKMIAVVIVNSARALTRRRREEAKVVRSINFPVPISVLITGS
C688J18823_1018893313300001686SoilVNMTAVEAATSPKTQTRKAREEANVVRSINFPVPISVLITGS*
JGI24033J26618_103657713300002155Corn, Switchgrass And Miscanthus RhizosphereSLEINIAVLKVTSPRAHTRNAREEAKVVRSIYFPVPISVLITGA*
C688J35102_12011788313300002568SoilINIALVKVTSPRAHTRNAREEAKVVRSIYFPVPISVLITGS*
rootL2_1010867133300003322Sugarcane Root And Bulk SoilSALSLEIRIVVVKVISPRAHTRKAREEAKVVRSIYFPVPISVLITGP*
rootL2_1013275613300003322Sugarcane Root And Bulk SoilSALSLEIRIAAVKVMSPRAHTRNAREEAKVVRSIYFPVPISVLITGL*
JGI25405J52794_1004839913300003911Tabebuia Heterophylla RhizosphereSALSLEISIAVVKVMSPRAHTRKAREEAKVVRSIYFPVPISVLITGS*
Ga0062384_10078469623300004082Bog Forest SoilVSLVKATAVVTVTNPKTQTRKREEAKVVRSMNFPVPISVLITGP*
Ga0066702_1039429013300005575SoilVKMAAVVTVVSPRTQTRNTREEAKFVQSMNFPAPISALITGS*
Ga0066708_1018764013300005576SoilSAESVVKMIAVVIVNSAKTLTRRTCEEAKIVRSMNFPVPISVLITGS*
Ga0068854_10219571223300005578Corn RhizosphereVRRASALSLVKMIAVVAVISPKTQTRKVREEANLVRSMNFPVPISVLITGS*
Ga0068860_10037356713300005843Switchgrass RhizosphereVVKVMSPRAHTRKAREEAKVVRSIYFPVPISVLINGS*
Ga0066651_1019825413300006031SoilWRGCWDRRACAASPVKMAAVVTVVSPRTQTRNTREEAKFVQSMNFPAPISALITGS*
Ga0075024_10002865413300006047WatershedsALSLVKRTAVETVTSPKTQTRKTREEPKVVRSMNFPVPISVLITGS*
Ga0075024_10046597533300006047WatershedsVIKPKAEKRSTRVEAKVLRSMHFPVPISALITGS*
Ga0075029_10034432113300006052WatershedsAVETVTSPKTQTRKTREEPKVVRSMNFPVPISVLITGS*
Ga0075015_10010064513300006102WatershedsVETVTSPKTQTRKTREEPKVVRSMNFPVPISVLITGS*
Ga0066660_1045916643300006800SoilERRASARSLVEMTAVVIVTSPKTQTRKPREEVDIVRSINFPVPISLLITGS*
Ga0099830_1100838113300009088Vadose Zone SoilLVKMSVVVIVNSPKMPARRTREDAMVVRSINFPVPISVLITGS*
Ga0105250_1046153913300009092Switchgrass RhizosphereRASALSLVMRIAVVKVASPRTQTRNEREEAKVVRSIYFPVPISVLITGT*
Ga0099792_1053382813300009143Vadose Zone SoilALSLLISIAVVKVMSPRAHTRKAREEAKVVRSIYFPVPISVLITGS*
Ga0099792_1056166023300009143Vadose Zone SoilRASAESVVKMIAVVIVNNAKTLARRTREEAKVVRSMNFPVPISLS*
Ga0105243_1132785613300009148Miscanthus RhizosphereRASALSLEIRIAVVKVTSPRAHTRNVREEAKVVRSIYFPVPISVLITGS*
Ga0105237_1158810523300009545Corn RhizosphereSALSLVISIALVKVMSPRAHTRNAREDAKVVRSIYFPVPISVLITGS*
Ga0105238_1153676123300009551Corn RhizosphereALMVASPKAQARMTREEAKVVRSIDFPVPNFSFITGS*
Ga0116109_113569413300009627PeatlandASAVPDVKASAVVIVTKPKAQTRIREEAKVVRSMNFPVPISVLITGS*
Ga0116117_115780423300009635PeatlandAVSLVKATAAVTVTNPKTHTRKREEAKVVRSMNFPVPISVLITGS*
Ga0116217_1007929213300009700Peatlands SoilSAVSVVKAAAVVAATNPKTQTRKTREEAKVVRSMNFPVPISALVTGS*
Ga0116219_1015906413300009824Peatlands SoilKVAAVVTATNPKKQARKTREEAKVVRSMNFPVPISALVTGS*
Ga0126315_1053303713300010038Serpentine SoilSASLVKMTAVVIVTSPKMQTCKTREEALVVRSINFPVPISVLITGS*
Ga0126306_1105007513300010166Serpentine SoilSLEIRIAVVKVMSPRAHTRNAREEAKVVRSIYFPVPISVLITGA*
Ga0105239_1024079923300010375Corn RhizosphereVASPKAQARITREEAKVVRSINFPVPNFSFITGS*
Ga0134124_1063895133300010397Terrestrial SoilAVVKVMSPRAHTRKAREEAKVVRSIYFPVPISVLINGS*
Ga0138514_10002178633300011003SoilEINIAVVKVTSPRAHTRNAREEAKVVRSIYFPVPISVLITGT*
Ga0137392_1118189213300011269Vadose Zone SoilKMIAVVIANSAKTPTRRTREEAKVVRSMNFPVPISVLITGS*
Ga0137388_1143917323300012189Vadose Zone SoilSALSLVKMIAVVIVNSPKMPARRTREDAMVVRSINFPVPISVLITGS*
Ga0137388_1192404513300012189Vadose Zone SoilERRASAESVVKMIAVVIANSAKTLTRRTREEAKVVRSMNFLVPISVLITGS*
Ga0137363_1011350943300012202Vadose Zone SoilLERRASAESVVKMIAVVIVNSAKTLTRRTREEAKVVRSMNFPVPQFLS*
Ga0137381_1148354713300012207Vadose Zone SoilVVKVTSPRTQTRNVREEAKVVRSIYFPVPISILITGS*
Ga0157289_1016773613300012903SoilLEINIAVVKVTSPRAHTRNAREEAKVVRSIYFPVPISVLITGA*
Ga0157283_1018911523300012907SoilRASALSLVISIALVKVMSPRAHTRNAREDAKVVRSIYFPVPISVLITGA*
Ga0137413_1072294513300012924Vadose Zone SoilIAVVKVTSPRTQARNVREEAKVVRSIYFPVPISILITGS*
Ga0137416_1002863053300012927Vadose Zone SoilSALSLVITIADVKVANPRTQTRNAREEAKVVRSIYFPVPISILITGS*
Ga0137404_1098083713300012929Vadose Zone SoilATNPKKQTRKTCEEAKVVRSMNFPVPISVLITGS*
Ga0137407_1185644613300012930Vadose Zone SoilLVQMIAVVKVTSPRTHTRNAREEAKVVRSIYFPVPISILITGS*
Ga0164302_1043278023300012961SoilIENSAKTLTRRTREEAKVVRSMNFPVPISVLITGS*
Ga0164304_1179055413300012986SoilLSLEIRIAVVKVMSPRAHTRKAREEAKVVRSIYFPVPISVLITGS*
Ga0164306_1005668043300012988SoilLERRASAESVVKMIAVVIVNNAKTLARRTREEAKVVRSMNFPVPISVLITGS*
Ga0181526_1076517423300014200BogSTVSVVKAAAVVAATNPKTQTRKTREEAKVVRSMNFPVPISALITGS*
Ga0157380_1030218413300014326Switchgrass RhizosphereIRIAVVKVMSPRAHTRNTREEAKVVRSIYFPVPISVLITGA*
Ga0182008_1084112013300014497RhizosphereISIAVVKVMSPRAHTRKAREEAKVVRSIYFPVPISVLITAT*
Ga0182021_1207870213300014502FenAVVIVTSPKTQTRKTREEAKVVRSMNFPVPISVLITGS*
Ga0167643_103589223300015089Glacier Forefield SoilALSVVKMTAVVIVSRPKTPARRTREEAKVVRSMNFPVPISVLITGS*
Ga0193756_103627823300019866SoilLVKMTAAVVVTSPKMQARKIREEAKVVRSMNFPVPISALITGS
Ga0193703_105647823300019876SoilVKVMSPRAHTRKAREEAKVVRSIYFPVPISVLITGS
Ga0193722_103762413300019877SoilSALSVVKMIAVVKVTSPRTQTRKLREEAKVVRSIYFPVPISILITGS
Ga0193753_1015168133300020034SoilIVTSPRTHTRNVREEAKVVRSIYFPVPISILITGS
Ga0210405_1035679513300021171SoilKVTAVVTATNPKKQARKTREEANVVRSMNFPVPISALITGS
Ga0222623_1019237913300022694Groundwater SedimentMIAVVIVNSAKTLTRRTREEAKVVRSMNFPVPISVLITGS
Ga0247758_121755733300023079Plant LitterVSVVKMTAVMMVARPSTQTRRLREEAKVVRSINFPVPISVLITGS
Ga0208035_105956223300025406PeatlandAVSLVKATAAVTVTNPKTHTRKREEAKVVRSMNFPVPISVLITGS
Ga0209585_1006048413300025891Arctic Peat SoilLVKMTAVVIVTSPKTQTRKTREEAKVVRSMNFPVPISVLITGS
Ga0207710_1048630823300025900Switchgrass RhizosphereSALSLEISIAVVKVMSPRAHTRKAREEAKVVRSIYFPVPISVLITAT
Ga0207707_1130976513300025912Corn RhizosphereAVVAVISPKTQTRKVREEANLVRSMNFPVPISVLITGS
Ga0207663_1035481113300025916Corn, Switchgrass And Miscanthus RhizosphereRRASAVLVVKVTAVVTATNPKKQTRKACEEAKVVRSMNFPVPISALITGS
Ga0207694_1055979613300025924Corn RhizosphereRASALSLVVMIAVVKVISPRTHTRKLREEAKVVRSIYFPVPISILITGS
Ga0207665_1015137813300025939Corn, Switchgrass And Miscanthus RhizosphereLEINIAVVNVMSPRAHTRNAREEAKVVRSIYFPVPISVLITAT
Ga0207703_1108368323300026035Switchgrass RhizosphereMIAVVKVTSPRTQTRKLREEAKVVRSIYFPVPISILITGS
Ga0207639_1076177323300026041Corn RhizosphereRASALSLLIRIAVVKVMSPRAHTRKAREEAKVVRSIYFPVPISVLITGS
Ga0207648_1101156213300026089Miscanthus RhizosphereLEIRIAVVKVMSPRAHTRKAREEAKVVRSIYFPVPISVLITGS
Ga0207698_1151747713300026142Corn RhizosphereSIAVVKVMSPRAHTRKAREEAKVVRSIYFPVPISVLITGS
Ga0209881_111166513300026273SoilVLKVTSPKTQTRRAREEAKVVRSINFPVPISVLITGS
Ga0209265_118170513300026308SoilRGCWDRRACAASPVKMAAVVTVVSPRTQTRNTREEAKFVQSMNFPAPISALITGS
Ga0257162_100325443300026340SoilRRASAESVVKMIAVVIVNNAKTLARRTREEAKVVRSMNFPVPISVLITGS
Ga0257171_101976613300026377SoilIVNNAKTLARRTREEAKVVRSMNFPVPISVLITGS
Ga0257147_102488513300026475SoilAESVVKMIAVVIVNNAKTLARRTREEAKVVRSMNFPVPISVLITGS
Ga0257161_106576823300026508SoilSAESVVKMIAVVIVNNAKTLARRTREEAKVVRSMNFPVPISVLITGS
Ga0209807_112614313300026530SoilVVKMIAVVIVNSAKTLTRRTCEEAKIVRSMNFPVPISVLITGS
Ga0209805_122257823300026542SoilKMTAVVIVTSPKMQTRKTREEALVVRNINFPVPISVLITGS
Ga0209577_1024956213300026552SoilSLVEMTAVVIVTSPKTQTRKPREEVDIVRSINFPVPISLLITGS
Ga0209623_100557313300026880Forest SoilAMSVVKVTAVVAATNPKKQTRKMCEEAKVVRSMNFPVPISLLITGS
Ga0208983_100996833300027381Forest SoilVVKMIAVVTVASPSTHTRKTREETKVVRSMNFPVPISVLITGS
Ga0208993_103424823300027480Forest SoilSLVKMTAVVTVTSPKTQTRKTREYAKVVRSINFPVPISVLITGS
Ga0208998_102497413300027524Forest SoilVVTVTNPKAQTRIREEAKVVRSMNFPVPISVLITGS
Ga0209216_109292513300027530Forest SoilLWRRASAASVVKMIAVLIVASPRTQTRNTREEAKVVRSMNFPVPISVLITGP
Ga0209734_103816013300027535Forest SoilLVIRIAVVKVASPRTQTRNVREKAKVVRSIYFPVPISILITGS
Ga0209734_103995423300027535Forest SoilASAASVVKMIAVVTVASPSTHTRKTREETKVVRSMNFPVPISVLITGP
Ga0209220_102750313300027587Forest SoilIVTSPKTHTRKLREEAKVVRSINFPVPISVLITGS
Ga0208044_105668013300027625Peatlands SoilAVVTATNPKKQARKTREEAKVVRSMNFPVPISALVTGS
Ga0208990_111320113300027663Forest SoilRASALSLVITIADVKVANPRTQTRNAREEAKVVRSIYFPVPISILITGS
Ga0209118_114034713300027674Forest SoilKVTAVVAATNPKKQTRKTCEEAKVVRSMNFPVPISVLITGS
Ga0209461_1005226213300027750AgaveALSLEIRIVVVKVISPRAHTRKAREEAKVVRSIYFPVPISVLITGS
Ga0209068_1023543113300027894WatershedsAWALSLVKRTAVETVTSPKTQTRKTREEPKVVRSMNFPVPISVLITGS
Ga0209624_1095853813300027895Forest SoilVKMTAVVTVTSPKTQTRTRCEQAKVLRSMNFPVPISVLITGS
Ga0209006_1020544013300027908Forest SoilVTVTSPKTQTRTRREQAKVLRSMNFPVPISVLITGS
Ga0209526_1011056233300028047Forest SoilSVVKMIAVVTVASPSTHTRKTREETKVVRSMNFPVPISVLITGS
Ga0247682_107774823300028146SoilVKASAVVTVTNPKAQTRIREEAKVVRSMNFPVPISVLITGS
Ga0137415_1082184613300028536Vadose Zone SoilVIVNSPKMPARRTREDAMVVRSIDFPVPISVLITGP
Ga0302225_1015422513300028780PalsaSLVNATAVVTVTNPNTHTRKREEAKVVRSMNFPVPISVLITGS
Ga0302201_1010367933300028785BogRASALLLVKVTAVVIVTRPKTQTRRTREEAKVVRSMNFPVPISVLITGS
Ga0307286_1002406043300028876SoilTVVNVMSPRAHTRNAREEAKVVRSIYFPVPISVLITGS
Ga0311329_1030374213300029907BogLLVKVTAVVIVTRPKTQTRRTREEAKVVRSMNFPVPISVLITGS
Ga0311326_1008491333300029917BogVKVTAVVIVTRPKTQTRKTREEAKVVRSMNFPVPISVLITGS
Ga0302274_1033733823300030041BogLVKVTAVVIVTRPKTQTRRTREEAKVVRSMNFPVPISVLITGS
Ga0310038_1038069813300030707Peatlands SoilAAVVTATNPKKQARKTREEAKVVRSMNFPVPISALVTGS
Ga0307500_1006577913300031198SoilLLIRIAVVMVTSPSAQTRNAREEAKVVRSIYFPVPISILITGS
Ga0307513_1046074133300031456EctomycorrhizaLISIAVVKVMSPRAHTRKAREEAKVVRSIYFPVPISVLITGS
Ga0170818_10826587013300031474Forest SoilVKITAVVMVTSPKTQTRSGREQAQVVRSIDFPVPISVLITGS
Ga0310686_11046475723300031708SoilVTVTNPKTHTRKREEAKVVRSMNFPVPISVLITGS
Ga0310892_1042892413300031858SoilLEIRIAVVKVMSPRAHTRNTREEAKVVRSIYFPVPISVLITGS
Ga0307409_10032042613300031995RhizosphereSALSLEIRIAVVKVMSPRAHTRNAREEAKVVRSIYFPVPISVLITGA
Ga0307470_1098739523300032174Hardwood Forest SoilLTVISPRANARNAREEAKVVRSINFPVPFSVLITGS

 ⦗Top⦘


Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.