Metagenome Family F082314

Basic Information
Family ID	F082314
Family Type	Metagenome
Number of Sequences	113
Average Sequence Length	41 residues
Representative Sequence	FPSSLRVIEKAMANALKFVDHPKAKQFDVRQSFDNSFVDEAMK
Number of Associated Samples	100
Number of Associated Scaffolds	113

Quality Assessment
Transcriptomic Evidence	No
Most common taxonomic group	Bacteria
% of genes with valid RBS motifs	0.00 %
% of genes near scaffold ends (potentially truncated)	98.23 %
% of genes from short scaffolds (< 2000 bps)	92.04 %
Associated GOLD sequencing projects	96
AlphaFold2 3D model prediction	Yes
3D model pTM-score	0.23

Most Common Taxonomy
Group	Bacteria (94.690 % of family members)
NCBI Taxonomy ID	2
Taxonomy	All Organisms → cellular organisms → Bacteria

Most Common Ecosystem
GOLD Ecosystem	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere (12.389 % of family members)
Environment Ontology (ENVO)	Unclassified (26.549 % of family members)
Earth Microbiome Project Ontology (EMPO)	Host-associated → Plant → Plant rhizosphere (44.248 % of family members)

Full Alignment
Alignment of all the sequences in the family.

Powered by MSAViewer

Seed Alignment
Alignment of a non-redundant set of sequences, used to build the family's HMM profile.

Powered by MSAViewer

AlphaFold2 Input Alignment
Refined alignment used as input for AlphaFold2.

Powered by MSAViewer

Predicted Topology & Secondary Structure
Classification:	Globular	Signal Peptide:	No	Secondary Structure distribution:	α-helix: 45.07% β-sheet: 0.00% Coil/Unstructured: 54.93%
Feature Viewer

Powered by Feature Viewer

Pfam ID	Name	% Frequency in 113 Family Scaffolds
PF09084	NMT1	21.24
PF04392	ABC_sub_bind	18.58
PF13379	NMT1_2	2.65
PF04480	DUF559	1.77
PF00211	Guanylate_cyc	1.77
PF00072	Response_reg	0.88
PF07883	Cupin_2	0.88
PF07992	Pyr_redox_2	0.88
PF02604	PhdYeFM_antitox	0.88
PF13565	HTH_32	0.88
PF13546	DDE_5	0.88
PF04909	Amidohydro_2	0.88
PF08882	Acetone_carb_G	0.88
PF14559	TPR_19	0.88
PF00872	Transposase_mut	0.88
PF06277	EutA	0.88
PF05977	MFS_3	0.88
PF00561	Abhydrolase_1	0.88

COG ID	Name	Functional Category	% Frequency in 113 Family Scaffolds
COG0715	ABC-type nitrate/sulfonate/bicarbonate transport system, periplasmic component	Inorganic ion transport and metabolism [P]	21.24
COG4521	ABC-type taurine transport system, periplasmic component	Inorganic ion transport and metabolism [P]	21.24
COG2984	ABC-type uncharacterized transport system, periplasmic component	General function prediction only [R]	18.58
COG2114	Adenylate cyclase, class 3	Signal transduction mechanisms [T]	1.77
COG2161	Antitoxin component YafN of the YafNO toxin-antitoxin module, PHD/YefM family	Defense mechanisms [V]	0.88
COG2814	Predicted arabinose efflux permease AraJ, MFS family	Carbohydrate transport and metabolism [G]	0.88
COG3328	Transposase (or an inactivated derivative)	Mobilome: prophages, transposons [X]	0.88
COG4118	Antitoxin component of toxin-antitoxin stability system, DNA-binding transcriptional repressor	Defense mechanisms [V]	0.88
COG4647	Acetone carboxylase, gamma subunit	Secondary metabolites biosynthesis, transport and catabolism [Q]	0.88
COG4819	Ethanolamine utilization protein EutA, possible chaperonin	Amino acid transport and metabolism [E]	0.88

NCBI Taxonomy

Select NCBI taxonomy Level:

Name	Rank	Taxonomy	Distribution
All Organisms	root	All Organisms	94.69 %
Unclassified	root	N/A	5.31 %

Name	Rank	Taxonomy	Distribution
cellular organisms	root	All Organisms → cellular organisms	94.69 %
Unclassified	root	N/A	5.31 %

Name	Rank	Taxonomy	Distribution
Bacteria	superkingdom	All Organisms → cellular organisms → Bacteria	94.69 %
Unclassified	root	N/A	5.31 %

Name	Rank	Taxonomy	Distribution
Proteobacteria	phylum	All Organisms → cellular organisms → Bacteria → Proteobacteria	40.71 %
Unclassified	root	N/A	5.31 %
Terrabacteria group	clade	All Organisms → cellular organisms → Bacteria → Terrabacteria group	0.88 %

Name	Rank	Taxonomy	Distribution
delta/epsilon subdivisions	subphylum	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions	34.51 %
Unclassified	root	N/A	5.31 %
Gammaproteobacteria	class	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria	2.65 %
Alphaproteobacteria	class	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria	0.88 %
Chloroflexi	phylum	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi	0.88 %

Name	Rank	Taxonomy	Distribution
Deltaproteobacteria	class	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria	34.51 %
Unclassified	root	N/A	5.31 %
unclassified Gammaproteobacteria	no rank	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria	1.77 %
Hyphomicrobiales	order	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales	0.88 %
unclassified Chloroflexi	no rank	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi	0.88 %
Pseudomonadales	order	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Pseudomonadales	0.88 %

Name	Rank	Taxonomy	Distribution
unclassified Deltaproteobacteria	no rank	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria	30.09 %
Unclassified	root	N/A	5.31 %
Gammaproteobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium	1.77 %
Chloroflexi bacterium	species	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium	0.88 %
Bradyrhizobiaceae	family	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae	0.88 %
Marinobacteraceae	family	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Pseudomonadales → Marinobacteraceae	0.88 %

Name	Rank	Taxonomy	Distribution
Deltaproteobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium	29.20 %
Unclassified	root	N/A	5.31 %
Gammaproteobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium	1.77 %
Deltaproteobacteria bacterium RIFCSPLOWO2_12_FULL_60_19	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium RIFCSPLOWO2_12_FULL_60_19	0.88 %
Bradyrhizobium	genus	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium	0.88 %
Marinobacter	genus	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Pseudomonadales → Marinobacteraceae → Marinobacter	0.88 %
Chloroflexi bacterium	species	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium	0.88 %

Name	Rank	Taxonomy	Distribution
Deltaproteobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium	29.20 %
Unclassified	root	N/A	5.31 %
Gammaproteobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium	1.77 %
unclassified Marinobacter	no rank	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Pseudomonadales → Marinobacteraceae → Marinobacter → unclassified Marinobacter	0.88 %
Deltaproteobacteria bacterium RIFCSPLOWO2_12_FULL_60_19	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium RIFCSPLOWO2_12_FULL_60_19	0.88 %
Bradyrhizobium	genus	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium	0.88 %
Chloroflexi bacterium	species	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium	0.88 %

Name	Rank	Taxonomy	Distribution
Deltaproteobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium	29.20 %
Unclassified	root	N/A	5.31 %
Gammaproteobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium	1.77 %
Marinobacter sp.	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Pseudomonadales → Marinobacteraceae → Marinobacter → unclassified Marinobacter → Marinobacter sp.	0.88 %
Deltaproteobacteria bacterium RIFCSPLOWO2_12_FULL_60_19	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium RIFCSPLOWO2_12_FULL_60_19	0.88 %
Bradyrhizobium	genus	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium	0.88 %
Chloroflexi bacterium	species	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium	0.88 %

Visualization

Powered by ApexCharts

Associated Scaffolds

Scaffold	Taxonomy	Length	IMG/M Link
3300000890\|JGI11643J12802_11506039	All Organisms → cellular organisms → Bacteria	1046	Open in IMG/M
3300004281\|Ga0066397_10010423	All Organisms → cellular organisms → Bacteria → Proteobacteria	1184	Open in IMG/M
3300005166\|Ga0066674_10401363	All Organisms → cellular organisms → Bacteria	635	Open in IMG/M
3300005289\|Ga0065704_10154020	All Organisms → cellular organisms → Bacteria	1405	Open in IMG/M
3300005332\|Ga0066388_104718543	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium	693	Open in IMG/M
3300005458\|Ga0070681_11816592	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium	536	Open in IMG/M
3300005471\|Ga0070698_101210080	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium	705	Open in IMG/M
3300005535\|Ga0070684_102322831	All Organisms → cellular organisms → Bacteria	506	Open in IMG/M
3300005540\|Ga0066697_10508390	All Organisms → cellular organisms → Bacteria	682	Open in IMG/M
3300005556\|Ga0066707_10022203	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria	3388	Open in IMG/M
3300005614\|Ga0068856_101582894	All Organisms → cellular organisms → Bacteria	668	Open in IMG/M
3300005713\|Ga0066905_101051976	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium	720	Open in IMG/M
3300005718\|Ga0068866_10403319	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium	882	Open in IMG/M
3300005764\|Ga0066903_106338911	All Organisms → cellular organisms → Bacteria	617	Open in IMG/M
3300005884\|Ga0075291_1051842	All Organisms → cellular organisms → Bacteria	553	Open in IMG/M
3300006844\|Ga0075428_101183852	All Organisms → cellular organisms → Bacteria → Proteobacteria	806	Open in IMG/M
3300006845\|Ga0075421_101241584	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium	829	Open in IMG/M
3300006852\|Ga0075433_10406255	All Organisms → cellular organisms → Bacteria	1201	Open in IMG/M
3300006903\|Ga0075426_10140492	All Organisms → cellular organisms → Bacteria	1740	Open in IMG/M
3300006904\|Ga0075424_100766657	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria	1030	Open in IMG/M
3300006904\|Ga0075424_101162483	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium	822	Open in IMG/M
3300006904\|Ga0075424_101644408	All Organisms → cellular organisms → Bacteria	681	Open in IMG/M
3300009094\|Ga0111539_11177459	All Organisms → cellular organisms → Bacteria	890	Open in IMG/M
3300009100\|Ga0075418_12290426	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium	589	Open in IMG/M
3300009143\|Ga0099792_11126550	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium	530	Open in IMG/M
3300009156\|Ga0111538_12848916	All Organisms → cellular organisms → Bacteria	605	Open in IMG/M
3300009157\|Ga0105092_10032963	All Organisms → cellular organisms → Bacteria	2751	Open in IMG/M
3300009162\|Ga0075423_10303022	All Organisms → cellular organisms → Bacteria	1675	Open in IMG/M
3300009162\|Ga0075423_11942195	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium	636	Open in IMG/M
3300009810\|Ga0105088_1103450	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium	529	Open in IMG/M
3300009837\|Ga0105058_1077827	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium	762	Open in IMG/M
3300010043\|Ga0126380_10333017	All Organisms → cellular organisms → Bacteria	1096	Open in IMG/M
3300010043\|Ga0126380_11674659	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium	570	Open in IMG/M
3300010046\|Ga0126384_11740353	All Organisms → cellular organisms → Bacteria	590	Open in IMG/M
3300010046\|Ga0126384_11843374	Not Available	575	Open in IMG/M
3300010322\|Ga0134084_10227140	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium	664	Open in IMG/M
3300010366\|Ga0126379_10565351	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium	1218	Open in IMG/M
3300010399\|Ga0134127_10910129	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium	935	Open in IMG/M
3300011269\|Ga0137392_11598032	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium	510	Open in IMG/M
3300011444\|Ga0137463_1168871	All Organisms → cellular organisms → Bacteria	823	Open in IMG/M
3300012152\|Ga0137347_1028305	All Organisms → cellular organisms → Bacteria	864	Open in IMG/M
3300012349\|Ga0137387_10350776	Not Available	1068	Open in IMG/M
3300012359\|Ga0137385_11038894	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium	675	Open in IMG/M
3300012360\|Ga0137375_10895731	All Organisms → cellular organisms → Bacteria	705	Open in IMG/M
3300012902\|Ga0157291_10249494	All Organisms → cellular organisms → Bacteria	590	Open in IMG/M
3300012929\|Ga0137404_10113026	All Organisms → cellular organisms → Bacteria	2209	Open in IMG/M
3300012930\|Ga0137407_10975465	All Organisms → cellular organisms → Bacteria	802	Open in IMG/M
3300012960\|Ga0164301_10471636	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium	898	Open in IMG/M
3300013297\|Ga0157378_10524511	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium	1186	Open in IMG/M
3300013306\|Ga0163162_12618792	All Organisms → cellular organisms → Bacteria	580	Open in IMG/M
3300014876\|Ga0180064_1048992	All Organisms → cellular organisms → Bacteria → Proteobacteria	845	Open in IMG/M
3300014878\|Ga0180065_1075447	All Organisms → cellular organisms → Bacteria	749	Open in IMG/M
3300014884\|Ga0180104_1181382	All Organisms → cellular organisms → Bacteria	628	Open in IMG/M
3300014885\|Ga0180063_1207872	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium	629	Open in IMG/M
3300015077\|Ga0173483_10537098	All Organisms → cellular organisms → Bacteria	631	Open in IMG/M
3300015254\|Ga0180089_1091028	All Organisms → cellular organisms → Bacteria	632	Open in IMG/M
3300015372\|Ga0132256_100267547	All Organisms → cellular organisms → Bacteria	1784	Open in IMG/M
3300015372\|Ga0132256_101501907	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium	784	Open in IMG/M
3300015372\|Ga0132256_101544478	All Organisms → cellular organisms → Bacteria	774	Open in IMG/M
3300015372\|Ga0132256_102705513	All Organisms → cellular organisms → Bacteria	595	Open in IMG/M
3300015373\|Ga0132257_103791157	All Organisms → cellular organisms → Bacteria	550	Open in IMG/M
3300015374\|Ga0132255_106356667	Not Available	500	Open in IMG/M
3300016294\|Ga0182041_10529607	All Organisms → cellular organisms → Bacteria	1026	Open in IMG/M
3300018028\|Ga0184608_10235615	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium	805	Open in IMG/M
3300018056\|Ga0184623_10220625	All Organisms → cellular organisms → Bacteria	870	Open in IMG/M
3300018056\|Ga0184623_10419093	All Organisms → cellular organisms → Bacteria	585	Open in IMG/M
3300018063\|Ga0184637_10126456	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria	1576	Open in IMG/M
3300018075\|Ga0184632_10378705	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium	599	Open in IMG/M
3300018081\|Ga0184625_10318236	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium	811	Open in IMG/M
3300018089\|Ga0187774_11428233	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria	508	Open in IMG/M
3300018422\|Ga0190265_12805108	All Organisms → cellular organisms → Bacteria	582	Open in IMG/M
3300019882\|Ga0193713_1176988	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium RIFCSPLOWO2_12_FULL_60_19	557	Open in IMG/M
3300021081\|Ga0210379_10105543	All Organisms → cellular organisms → Bacteria	1175	Open in IMG/M
3300021081\|Ga0210379_10319341	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium	680	Open in IMG/M
3300022563\|Ga0212128_10097829	All Organisms → cellular organisms → Bacteria	1895	Open in IMG/M
3300022756\|Ga0222622_11058984	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria	596	Open in IMG/M
3300025537\|Ga0210061_1088636	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium	543	Open in IMG/M
3300025903\|Ga0207680_10752308	Not Available	699	Open in IMG/M
3300025917\|Ga0207660_10095704	All Organisms → cellular organisms → Bacteria	2209	Open in IMG/M
3300025919\|Ga0207657_10030472	All Organisms → cellular organisms → Bacteria	4896	Open in IMG/M
3300025922\|Ga0207646_10430269	All Organisms → cellular organisms → Bacteria	1191	Open in IMG/M
3300025925\|Ga0207650_10080564	All Organisms → cellular organisms → Bacteria	2469	Open in IMG/M
3300025925\|Ga0207650_10772457	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium	814	Open in IMG/M
3300025936\|Ga0207670_11379952	All Organisms → cellular organisms → Bacteria	598	Open in IMG/M
3300025936\|Ga0207670_11561567	Not Available	561	Open in IMG/M
3300025972\|Ga0207668_11634765	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium	582	Open in IMG/M
3300026014\|Ga0208776_1026138	All Organisms → cellular organisms → Bacteria	504	Open in IMG/M
3300026088\|Ga0207641_12080677	All Organisms → cellular organisms → Bacteria	569	Open in IMG/M
3300026307\|Ga0209469_1002288	All Organisms → cellular organisms → Bacteria	9311	Open in IMG/M
3300026328\|Ga0209802_1329772	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium	504	Open in IMG/M
3300026523\|Ga0209808_1048826	All Organisms → cellular organisms → Bacteria	1945	Open in IMG/M
3300027252\|Ga0209973_1075673	All Organisms → cellular organisms → Bacteria	531	Open in IMG/M
3300027277\|Ga0209846_1064329	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium	551	Open in IMG/M
3300027364\|Ga0209967_1015688	All Organisms → cellular organisms → Bacteria	1085	Open in IMG/M
3300027533\|Ga0208185_1089716	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium	724	Open in IMG/M
3300027875\|Ga0209283_10531818	All Organisms → cellular organisms → Bacteria	753	Open in IMG/M
3300027903\|Ga0209488_10942022	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium	603	Open in IMG/M
3300027909\|Ga0209382_10309579	All Organisms → cellular organisms → Bacteria	1779	Open in IMG/M
3300027909\|Ga0209382_11051610	All Organisms → cellular organisms → Bacteria	844	Open in IMG/M
3300028828\|Ga0307312_10123700	All Organisms → cellular organisms → Bacteria	1623	Open in IMG/M
3300031547\|Ga0310887_11067092	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium	517	Open in IMG/M
3300031716\|Ga0310813_10121449	All Organisms → cellular organisms → Bacteria	2063	Open in IMG/M
3300031720\|Ga0307469_11486803	Not Available	648	Open in IMG/M
3300031740\|Ga0307468_100525756	All Organisms → cellular organisms → Bacteria	945	Open in IMG/M
3300031890\|Ga0306925_10977181	All Organisms → cellular organisms → Bacteria	865	Open in IMG/M
3300031949\|Ga0214473_10935300	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium	921	Open in IMG/M
3300032001\|Ga0306922_12067913	All Organisms → cellular organisms → Bacteria	553	Open in IMG/M
3300032013\|Ga0310906_10484604	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium	834	Open in IMG/M
3300032180\|Ga0307471_100077830	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Pseudomonadales → Marinobacteraceae → Marinobacter → unclassified Marinobacter → Marinobacter sp.	2899	Open in IMG/M
3300032205\|Ga0307472_100236712	All Organisms → cellular organisms → Bacteria	1420	Open in IMG/M
3300032261\|Ga0306920_101178171	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium	1108	Open in IMG/M
3300033417\|Ga0214471_10596317	All Organisms → cellular organisms → Bacteria	876	Open in IMG/M
3300033433\|Ga0326726_12465009	All Organisms → cellular organisms → Bacteria	505	Open in IMG/M

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:

Habitat	Taxonomy	Distribution
Environmental	Environmental	70.80%
Host-Associated	Host-Associated	29.20%

Habitat	Taxonomy	Distribution
Terrestrial	Environmental → Terrestrial	53.10%
Plants	Host-Associated → Plants	29.20%
Aquatic	Environmental → Aquatic	17.70%

Habitat	Taxonomy	Distribution
Soil	Environmental → Terrestrial → Soil	52.21%
Rhizosphere	Host-Associated → Plants → Rhizosphere	21.24%
Sediment	Environmental → Aquatic → Sediment	13.27%
Rhizoplane	Host-Associated → Plants → Rhizoplane	7.96%
Freshwater	Environmental → Aquatic → Freshwater	2.65%
Marine	Environmental → Aquatic → Marine	0.89%
Thermal Springs	Environmental → Aquatic → Thermal Springs	0.89%
Peat	Environmental → Terrestrial → Peat	0.89%

Habitat	Taxonomy	Distribution
Unclassified	Environmental → Terrestrial → Soil → Unclassified	37.17%
Unclassified	Environmental → Aquatic → Sediment → Unclassified	13.27%
Unclassified	Host-Associated → Plants → Rhizosphere → Unclassified	13.27%
Loam	Environmental → Terrestrial → Soil → Loam	9.73%
Soil	Host-Associated → Plants → Rhizosphere → Soil	7.96%
Epiphytes	Host-Associated → Plants → Rhizoplane → Epiphytes	5.31%
Sediment	Environmental → Aquatic → Freshwater → Sediment	2.65%
Wetlands	Environmental → Terrestrial → Soil → Wetlands	2.65%
Sand	Environmental → Terrestrial → Soil → Sand	2.65%
Unclassified	Host-Associated → Plants → Rhizoplane → Unclassified	2.65%
Wetlands	Environmental → Aquatic → Marine → Wetlands	0.89%
Hot (42-90C)	Environmental → Aquatic → Thermal Springs → Hot (42-90C)	0.89%
Unclassified	Environmental → Terrestrial → Peat → Unclassified	0.89%

Habitat	Taxonomy	Distribution
Unclassified	Environmental → Terrestrial → Soil → Unclassified → Unclassified	20.35%
Unclassified	Environmental → Aquatic → Sediment → Unclassified → Unclassified	13.27%
Unclassified	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified	13.27%
Unclassified	Host-Associated → Plants → Rhizosphere → Soil → Unclassified	7.96%
Forest Soil	Environmental → Terrestrial → Soil → Unclassified → Forest Soil	7.08%
Grasslands	Environmental → Terrestrial → Soil → Unclassified → Grasslands	6.19%
Agricultural Soil	Environmental → Terrestrial → Soil → Loam → Agricultural Soil	6.19%
Unclassified	Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified	5.31%
Forest Soil	Environmental → Terrestrial → Soil → Loam → Forest Soil	3.54%
Unclassified	Environmental → Aquatic → Freshwater → Sediment → Unclassified	2.65%
Unclassified	Environmental → Terrestrial → Soil → Wetlands → Unclassified	2.65%
Unclassified	Environmental → Terrestrial → Soil → Sand → Unclassified	2.65%
Unclassified	Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified	2.65%
Agricultural	Environmental → Terrestrial → Soil → Unclassified → Agricultural	1.77%
Uranium Contaminated	Environmental → Terrestrial → Soil → Unclassified → Uranium Contaminated	1.77%
Unclassified	Environmental → Aquatic → Marine → Wetlands → Unclassified	0.89%
Unclassified	Environmental → Aquatic → Thermal Springs → Hot (42-90C) → Unclassified	0.89%
Unclassified	Environmental → Terrestrial → Peat → Unclassified → Unclassified	0.89%

Habitat	Taxonomy	Distribution
Populus Rhizosphere	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere	12.39%
Vadose Zone Soil	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil	7.96%
Soil	Environmental → Aquatic → Sediment → Unclassified → Unclassified → Soil	7.08%
Soil	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil	6.19%
Soil	Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil	6.19%
Groundwater Sediment	Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment	5.31%
Tropical Forest Soil	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil	4.42%
Soil	Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil	3.54%
Hardwood Forest Soil	Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil	3.54%
Tropical Forest Soil	Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil	3.54%
Switchgrass Rhizosphere	Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere	3.54%
Arabidopsis Rhizosphere	Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Arabidopsis Rhizosphere	3.54%
Corn Rhizosphere	Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere	2.65%
Groundwater Sand	Environmental → Terrestrial → Soil → Sand → Unclassified → Groundwater Sand	2.65%
Groundwater Sediment	Environmental → Aquatic → Freshwater → Sediment → Unclassified → Groundwater Sediment	1.77%
Soil	Environmental → Terrestrial → Soil → Unclassified → Agricultural → Soil	1.77%
Soil	Environmental → Terrestrial → Soil → Unclassified → Uranium Contaminated → Soil	1.77%
Rice Paddy Soil	Environmental → Terrestrial → Soil → Wetlands → Unclassified → Rice Paddy Soil	1.77%
Corn, Switchgrass And Miscanthus Rhizosphere	Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere	1.77%
Switchgrass Rhizosphere	Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Switchgrass Rhizosphere	1.77%
Arabidopsis Rhizosphere	Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere	1.77%
Arabidopsis Thaliana Rhizosphere	Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Arabidopsis Thaliana Rhizosphere	1.77%
Freshwater Sediment	Environmental → Aquatic → Freshwater → Sediment → Unclassified → Freshwater Sediment	0.89%
Natural And Restored Wetlands	Environmental → Aquatic → Marine → Wetlands → Unclassified → Natural And Restored Wetlands	0.89%
Thermal Springs	Environmental → Aquatic → Thermal Springs → Hot (42-90C) → Unclassified → Thermal Springs	0.89%
Groundwater Sediment	Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment	0.89%
Terrestrial Soil	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil	0.89%
Grasslands Soil	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil	0.89%
Tropical Peatland	Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland	0.89%
Peat Soil	Environmental → Terrestrial → Peat → Unclassified → Unclassified → Peat Soil	0.89%
Switchgrass Rhizosphere	Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Switchgrass Rhizosphere	0.89%
Corn Rhizosphere	Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere	0.89%
Switchgrass Rhizosphere	Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere	0.89%
Miscanthus Rhizosphere	Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere	0.89%
Switchgrass Rhizosphere	Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere	0.89%
Miscanthus Rhizosphere	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere	0.89%
Corn Rhizosphere	Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere	0.89%

Visualization

Powered by ApexCharts

Associated Samples

Taxon OID	Sample Name	Habitat Type	IMG/M Link
3300000890	Soil microbial communities from Great Prairies - Iowa, Continuous Corn soil	Environmental	Open in IMG/M
3300004281	Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 30 MoBio	Environmental	Open in IMG/M
3300005166	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_123	Environmental	Open in IMG/M
3300005289	Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2	Host-Associated	Open in IMG/M
3300005332	Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly)	Environmental	Open in IMG/M
3300005458	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG	Environmental	Open in IMG/M
3300005471	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG	Environmental	Open in IMG/M
3300005535	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG	Environmental	Open in IMG/M
3300005540	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_146	Environmental	Open in IMG/M
3300005556	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_156	Environmental	Open in IMG/M
3300005614	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2	Host-Associated	Open in IMG/M
3300005713	Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 36 (version 2)	Environmental	Open in IMG/M
3300005718	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2	Host-Associated	Open in IMG/M
3300005764	Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2)	Environmental	Open in IMG/M
3300005884	Rice paddy soil microbial communities from Twitchell Island, California, USA - SF_Rice_20C_80N_302	Environmental	Open in IMG/M
3300006844	Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2	Host-Associated	Open in IMG/M
3300006845	Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD5	Host-Associated	Open in IMG/M
3300006852	Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2	Host-Associated	Open in IMG/M
3300006903	Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD5	Host-Associated	Open in IMG/M
3300006904	Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD3	Host-Associated	Open in IMG/M
3300009094	Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2)	Host-Associated	Open in IMG/M
3300009100	Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD2	Host-Associated	Open in IMG/M
3300009143	Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_2	Environmental	Open in IMG/M
3300009156	Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD1 (version 2)	Host-Associated	Open in IMG/M
3300009157	Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (1) Depth 19-21cm March2015	Environmental	Open in IMG/M
3300009162	Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD2	Host-Associated	Open in IMG/M
3300009810	Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW S3_20_30	Environmental	Open in IMG/M
3300009837	Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW N1_20_30	Environmental	Open in IMG/M
3300010043	Tropical forest soil microbial communities from Panama - MetaG Plot_26	Environmental	Open in IMG/M
3300010046	Tropical forest soil microbial communities from Panama - MetaG Plot_36	Environmental	Open in IMG/M
3300010322	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Glu_20cm_2_24_1 metaG	Environmental	Open in IMG/M
3300010366	Tropical forest soil microbial communities from Panama - MetaG Plot_24	Environmental	Open in IMG/M
3300010399	Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-3	Environmental	Open in IMG/M
3300011269	Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h3.4A metaG	Environmental	Open in IMG/M
3300011444	Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMGT800_2	Environmental	Open in IMG/M
3300012152	Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMLT590_2	Environmental	Open in IMG/M
3300012349	Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Sage2_R_115_16 metaG	Environmental	Open in IMG/M
3300012359	Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_80_16 metaG	Environmental	Open in IMG/M
3300012360	Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_113_16 metaG	Environmental	Open in IMG/M
3300012902	Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S169-409C-1	Environmental	Open in IMG/M
3300012929	Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_16fungal (Illumina Assembly)	Environmental	Open in IMG/M
3300012930	Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_2_16fungal (Illumina Assembly)	Environmental	Open in IMG/M
3300012960	Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_231_MG	Environmental	Open in IMG/M
3300013297	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG	Host-Associated	Open in IMG/M
3300013306	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG	Host-Associated	Open in IMG/M
3300014876	Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River metaG ERMLT200_16_10D	Environmental	Open in IMG/M
3300014878	Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River metaG ERMLT200A_16_10D	Environmental	Open in IMG/M
3300014884	Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River metaG ERMLT730_16_1Da	Environmental	Open in IMG/M
3300014885	Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River metaG ERMLIBT47_16_10D	Environmental	Open in IMG/M
3300015077	Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S178-409R-2 (version 2)	Environmental	Open in IMG/M
3300015254	Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River metaG ERMLT860_16_10D	Environmental	Open in IMG/M
3300015372	Soil combined assembly	Host-Associated	Open in IMG/M
3300015373	Combined assembly of cpr5 rhizosphere	Host-Associated	Open in IMG/M
3300015374	Col-0 rhizosphere combined assembly	Host-Associated	Open in IMG/M
3300016294	Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.178	Environmental	Open in IMG/M
3300018028	Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_30_coex	Environmental	Open in IMG/M
3300018056	Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_100_b1	Environmental	Open in IMG/M
3300018063	Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3_127_b2	Environmental	Open in IMG/M
3300018075	Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3-1_50_b1	Environmental	Open in IMG/M
3300018081	Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3_30_b1	Environmental	Open in IMG/M
3300018089	Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_BV02_MP05_20_MG	Environmental	Open in IMG/M
3300018422	Populus adjacent soil microbial communities from riparian zone of Indian Creek, Utah, USA - 124 T	Environmental	Open in IMG/M
3300019882	Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? H3a2	Environmental	Open in IMG/M
3300021081	Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM4_32_coex redo	Environmental	Open in IMG/M
3300022563	OV2_combined assembly	Environmental	Open in IMG/M
3300022756	Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM2_5_b1	Environmental	Open in IMG/M
3300025537	Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - MayberryNW_CattailC_D1 (SPAdes)	Environmental	Open in IMG/M
3300025903	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes)	Host-Associated	Open in IMG/M
3300025917	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes)	Environmental	Open in IMG/M
3300025919	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes)	Host-Associated	Open in IMG/M
3300025922	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes)	Environmental	Open in IMG/M
3300025925	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes)	Host-Associated	Open in IMG/M
3300025936	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes)	Environmental	Open in IMG/M
3300025972	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes)	Host-Associated	Open in IMG/M
3300026014	Rice paddy soil microbial communities from Twitchell Island, California, USA - SF_Rice_20C_0N_205 (SPAdes)	Environmental	Open in IMG/M
3300026088	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes)	Host-Associated	Open in IMG/M
3300026307	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_123 (SPAdes)	Environmental	Open in IMG/M
3300026328	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_129 (SPAdes)	Environmental	Open in IMG/M
3300026523	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_157 (SPAdes)	Environmental	Open in IMG/M
3300027252	Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co S PM (SPAdes)	Host-Associated	Open in IMG/M
3300027277	Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW S3_20_30 (SPAdes)	Environmental	Open in IMG/M
3300027364	Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co AM (SPAdes)	Host-Associated	Open in IMG/M
3300027533	Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMLT700 (SPAdes)	Environmental	Open in IMG/M
3300027875	Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H1.8 metaG (SPAdes)	Environmental	Open in IMG/M
3300027903	Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_2 (SPAdes)	Environmental	Open in IMG/M
3300027909	Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD5 (SPAdes)	Host-Associated	Open in IMG/M
3300028828	Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_202	Environmental	Open in IMG/M
3300031547	Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T60D4	Environmental	Open in IMG/M
3300031716	Soil microbial communities from experimental microcosm in Duke University, North Carolina, United States - YN3	Environmental	Open in IMG/M
3300031720	Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM2C_515	Environmental	Open in IMG/M
3300031740	Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gases AM2C_05	Environmental	Open in IMG/M
3300031890	Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.176 (v2)	Environmental	Open in IMG/M
3300031949	Soil microbial communities from uranium-contaminated site in the Upper Colorado River Basin, Wyoming, United States - RVT98D197	Environmental	Open in IMG/M
3300032001	Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.082 (v2)	Environmental	Open in IMG/M
3300032013	Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C48D3	Environmental	Open in IMG/M
3300032180	Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_515	Environmental	Open in IMG/M
3300032205	Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_05	Environmental	Open in IMG/M
3300032261	Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170 (v2)	Environmental	Open in IMG/M
3300033417	Soil microbial communities from uranium-contaminated site in the Upper Colorado River Basin, Wyoming, United States - RVT142D155	Environmental	Open in IMG/M
3300033433	Lab enriched peat soil microbial communities from Michigan Hollow, Ithaca, NY, United States - MHF15MN	Environmental	Open in IMG/M

Geographical Distribution

Zoom:	Powered by OpenStreetMap

Structure Viewer


Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100	pTM-score: 0.23
Secondary Structure: α-helix β-sheet Coil Turn	pTM-score: 0.23
Powered by PDBe Molstar

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

Metagenome Family F082314

Overview

Multiple Sequence Alignments

Structure & Topology

Predicted Secondary Structure and Topology

Predicted 3D Structure

Low Quality Model:

Gene Neighborhood

Neighboring Pfam domains

Neighboring Clusters of Orthologous Genes (COGs)

Phylogeny

NCBI Taxonomy

Associated Scaffolds

Environmental Properties

Associated Habitat Types

Associated Samples

Family Sequences

Protein ID	Sample Taxon ID	Habitat	Sequence
JGI11643J12802_115060392	3300000890	Soil	KTLRTPEKAMANALKFIDHPKAKQYDVTQSFDNSLVNEGIK*
Ga0066397_100104231	3300004281	Tropical Forest Soil	PSLKVIERAMANALKFVDHPKARQFDVRQSFDNSFIEEAMR*
Ga0066674_104013631	3300005166	Soil	FSSTLKVTEKEMANALKFIEHPKAKQADAKQFYDNSLVDEAMKSF*
Ga0065704_101540202	3300005289	Switchgrass Rhizosphere	AFSSTLRVVEKSMANALKFVEHPKAKGADVKQFYDNSLVDEVK*
Ga0066388_1047185432	3300005332	Tropical Forest Soil	TLRVVEKSMANALKFVEHPKAKGADVKQFYDNSLVDEAMKQ*
Ga0070681_118165922	3300005458	Corn Rhizosphere	PSSIRVIEKAMANALKFVEHPKAKQFDIRQSFDNSLVDEISK*
Ga0070698_1012100801	3300005471	Corn, Switchgrass And Miscanthus Rhizosphere	FPSSLRVIEKAMANALKFVDHPKAKQFDVRQSFDNSFVDEAMK*
Ga0070684_1023228311	3300005535	Corn Rhizosphere	QSIRVNEKAMSNALKFVEHPKAKQFDVRQSFDNTFVDEAIK*
Ga0066697_105083901	3300005540	Soil	IRVVEKAMANALKFVDHPKAKQYDVRQSYDNSYVDEAMK*
Ga0066707_100222031	3300005556	Soil	STLKVTEKEMANALKFIEHPKAKQADAKQFYDNSLVDEAMKSF*
Ga0068856_1015828941	3300005614	Corn Rhizosphere	KAMANALKFVEHPKAKQFDVRQSFDNSFVDEAMK*
Ga0066905_1010519762	3300005713	Tropical Forest Soil	VEKSMANALKFVEHPKAKGADVKQFYDNSLVEEAMK*
Ga0068866_104033192	3300005718	Miscanthus Rhizosphere	RVVEKSMANALKFVEHPKAKQYDVRQSFDNSLVDEAMR*
Ga0066903_1063389113	3300005764	Tropical Forest Soil	YYRGAFPPSLKVIERAMANALKFVDHPKAKQFDVRQSFDNSFIDEAMK*
Ga0075291_10518421	3300005884	Rice Paddy Soil	RTREKVMTNALKFIDHPKAKQYDVTQSFDNSLVDEIK*
Ga0075428_1011838521	3300006844	Populus Rhizosphere	YYKDAFSPTLRVVEKAMANALKFVDHPKAKQFDVKQSFDNSLLDEAMKQ*
Ga0075421_1012415842	3300006845	Populus Rhizosphere	FPASLRVIEKAMANALKFVDHPKAKQTDVKQSFDNSYVDEAMKQ*
Ga0075433_104062551	3300006852	Populus Rhizosphere	AEKAMANALKFVDHPKAKGTDVKQFYDNSLVEEAMR*
Ga0075426_101404921	3300006903	Populus Rhizosphere	FPRNIRVNEKAMANALKFVEHPKAKQFDVRQSFDNSFVDEAMK*
Ga0075424_1007666571	3300006904	Populus Rhizosphere	LRVIEKAMANALKFVDHPKAKQADVKQSFDNSYVDEAMKQ*
Ga0075424_1011624831	3300006904	Populus Rhizosphere	EEKSFTNMLRFLEHPKAKQVDPRQFFDNSLVEEISKRN*
Ga0075424_1016444082	3300006904	Populus Rhizosphere	IRVNEKAMANALKFVEHPKAKQFDVRQSFDNSFVDEAMK*
Ga0111539_111774591	3300009094	Populus Rhizosphere	ERAMANALKFIDHPKARQFDVRQSFDNSFIDEAMR*
Ga0075418_122904261	3300009100	Populus Rhizosphere	RVIEKAMANALKFVDHPKAKQADIKQTFDNSFVDEAIK*
Ga0099792_111265502	3300009143	Vadose Zone Soil	LRVIEKAMANALKFVDHPKAKQADIKQTFDNSFVDEAIK*
Ga0111538_128489161	3300009156	Populus Rhizosphere	IERAMANALKFVDHPKARQFDVRQSFDNSFIDEAMR*
Ga0105092_100329634	3300009157	Freshwater Sediment	DAFSPTLRTVEKSMANALKFVEHPKAKGADAKQFYDNSLVEEAMR*
Ga0075423_103030221	3300009162	Populus Rhizosphere	RAMVNALKFIDHPKARQFDVRQSFDNSFIDEAMR*
Ga0075423_119421952	3300009162	Populus Rhizosphere	AEKAMANALKFVDHPKAKGVDVKQFYDNSLVDEAIK*
Ga0105088_11034501	3300009810	Groundwater Sand	SNLKVVEKSMANALKFVEHPKAKGADVKQFYDNSLVEEAMK*
Ga0105058_10778272	3300009837	Groundwater Sand	RVVEKAMANALKFVEHPKAKGADVKQFYDNSLVEEAMR*
Ga0126380_103330172	3300010043	Tropical Forest Soil	VEKSMANALKFVEHPKAKGADVKQFYDNSIVDEAMKQ*
Ga0126380_116746592	3300010043	Tropical Forest Soil	VRPGGGRVIDKAKANALKFVDHPKAKQADVKQSFDNTFVDEAMQQ*
Ga0126384_117403531	3300010046	Tropical Forest Soil	RAMANALKFVDHPKAKQFDVRQSFDNSFIGDAMK*
Ga0126384_118433742	3300010046	Tropical Forest Soil	YYKDAFPSSLRVIEKAMANALKFVDHPKAKQADVKQSFDNRYVDEAMKQ*
Ga0134084_102271401	3300010322	Grasslands Soil	KEMANALKFIEHPKAKQADAKQFYDNSLVDEAMKSF*
Ga0126379_105653511	3300010366	Tropical Forest Soil	RAMANALKFVDHPKARQFDVRQSFDNSFIDEAMR*
Ga0134127_109101291	3300010399	Terrestrial Soil	FPASLRVLEKAMSNALKFIDHPKAKQFDVRQSFDNSFVDEAIK*
Ga0137392_115980322	3300011269	Vadose Zone Soil	YYKDAFPSSLRVIEKAMANALKFIDHPKAKQFDVKQSFDNSLVDEAMRQ*
Ga0137463_11688712	3300011444	Soil	RVIERAMANALKFIDHPKARQFDVRQSFDNSFIDEAMR*
Ga0137347_10283052	3300012152	Soil	LRTPESAMVNALKFLDHPKAKQADAKQSFDNSLVEEAMR*
Ga0137387_103507762	3300012349	Vadose Zone Soil	SNTLKVTEKEMANALKFIEHPKAKQADAKQFYDNSLVLLCQ*
Ga0137385_110388941	3300012359	Vadose Zone Soil	RTAEKSMANALKFVDHPKEKGADVKQFYDNSLVEEAMK*
Ga0137375_108957311	3300012360	Vadose Zone Soil	KDAFPSSLRVIEKAMANALKFVDHPKAKQFDVRQSFDNSFVDEAIK*
Ga0157291_102494942	3300012902	Soil	RVNEKAMANALKFVEHPKAKQFDVRQSFDNSFVDEAMK*
Ga0137404_101130263	3300012929	Vadose Zone Soil	FPSSLRVIEKAMANALKFVDHPKAKEFDVRQSFDNSFVDEAMK*
Ga0137407_109754651	3300012930	Vadose Zone Soil	PPSLRVIERAMANALKFVDHPKAKQFDVRQSFDNSFIDEAMR*
Ga0164301_104716361	3300012960	Soil	YYREAFPQSIRVNEKAMSNALKFVEHPKAKQFDVRQSFDNTFVDEAIK*
Ga0157378_105245111	3300013297	Miscanthus Rhizosphere	ATPDKAMTNALKFVEHPKAKGYDVRQSFDNALVNEIK*
Ga0163162_126187921	3300013306	Switchgrass Rhizosphere	RDAFPPSLRVIERAMANALKFIDHPKARQFDVRQSFDNSFIDEAMR*
Ga0180064_10489924	3300014876	Soil	DAFPKTLRVEEKAMANALKFVDHPKAKGADVRQFFDNSLVEEAMK*
Ga0180065_10754471	3300014878	Soil	VEEKAMANAQKFVEHPKAKGADVKQFYDNSLVEEAMK*
Ga0180104_11813821	3300014884	Soil	NTLRTPEKAMANALKFVDHPKAKGADVKQSFDNSMVDEAFK*
Ga0180063_12078721	3300014885	Soil	IEKAMANALKFVEHPKAKGADVRQSFDNSFVDEAMR*
Ga0173483_105370981	3300015077	Soil	NEKAMANALKFVEHPKAKQFDVRQSFDNSFVDEAMK*
Ga0180089_10910281	3300015254	Soil	TLRVIEKAMANALKFVDHPKAKGSDVRQSFDNNFVDEAMRQ*
Ga0132256_1002675471	3300015372	Arabidopsis Rhizosphere	YRDAFPPSLRVIERAMANALKFIDHPKARQFDVRQSFDNSFIDEAMR*
Ga0132256_1015019072	3300015372	Arabidopsis Rhizosphere	EYYREAFPRSIRVNEKAMSNALKFVEHPKAKQFDVRQSFDNTFVDEAIK*
Ga0132256_1015444782	3300015372	Arabidopsis Rhizosphere	SLKVIERAMANALKFVDHPKARQFDVRQSFDNSLIDEAMR*
Ga0132256_1027055131	3300015372	Arabidopsis Rhizosphere	SERAMANALKFIDHPKARQFDVRQSFDNSFIDEAMR*
Ga0132257_1037911572	3300015373	Arabidopsis Rhizosphere	YREAFPNTLRTPEKAMANALKFVDHPKAKQADVKQSFDNSLVDEAIK*
Ga0132255_1063566671	3300015374	Arabidopsis Rhizosphere	SAFPPSLKVIERAMANALKFVDHPKARQFDVRQSFDNSFIDEALK*
Ga0182041_105296071	3300016294	Soil	FPSSLRVIEKAMANALKFVDHPKAKQFDVRQSFDNSFVDEAMRQ
Ga0184608_102356153	3300018028	Groundwater Sediment	FYREAFPSTLRTPEKAMANALKFVDHPKAKQADVKQSFDNSLVDEAIK
Ga0184623_102206251	3300018056	Groundwater Sediment	SSLRVIEKAMANALKFIEHPKAKQFDVRQSFDNSYVEEAMK
Ga0184623_104190932	3300018056	Groundwater Sediment	TLRTPEKAMANALKFIDHPKAKQYDVRQSFDNSFVDEAMKQ
Ga0184637_101264561	3300018063	Groundwater Sediment	EKAIANALRFLDHPKAKGADPKQFYDNSLVDEAIK
Ga0184632_103787052	3300018075	Groundwater Sediment	AFPSTLRTAEKSMANALKFVDHPKAKGADVKQFYDNSLVDEAMR
Ga0184625_103182361	3300018081	Groundwater Sediment	LRVVEKSMANALKFVEHPKAKGADVKQFYDNSLVDEAMK
Ga0187774_114282332	3300018089	Tropical Peatland	SLRVIEKAMANALKFVDHPKAKQADVKQSFDNSYVDEAMKQ
Ga0190265_128051082	3300018422	Soil	VEYFCDVFPKTLTTTEKAMANALKFIDHPKAKQYDVTQSFDNSLVAEAIK
Ga0193713_11769881	3300019882	Soil	YKDAFPSSLRVIEKAMANALKFVDHSKAKQFDVKQSFDNSFVDEATK
Ga0210379_101055433	3300021081	Groundwater Sediment	IERAMANALKFVDHPKARQFDVRQSFDNSFIDEAMR
Ga0210379_103193412	3300021081	Groundwater Sediment	FPPSLRVIEKAMANALKFVEHPKAKGADVRQSFDNSFVEEAMR
Ga0212128_100978291	3300022563	Thermal Springs	TEPKIIANALKFLDHPKAKQADPTQFYDNSLVEEAIK
Ga0222622_110589841	3300022756	Groundwater Sediment	SLRVIEKAMANALKFVDHPKAKQADVKQSFDNTYVDEAMKQ
Ga0210061_10886361	3300025537	Natural And Restored Wetlands	RVVDKAMVNALKFVDHPKAKTADVKQSYDNRYVDEALK
Ga0207680_107523083	3300025903	Switchgrass Rhizosphere	SAFPPSLKVIERAMANALKFVDHPKARQFDVRQSFDNSFIDEALK
Ga0207660_100957041	3300025917	Corn Rhizosphere	FPSSIRVIEKAMANALKFVEHPKAKQFDIRQSFDNSLVDEISK
Ga0207657_100304721	3300025919	Corn Rhizosphere	ERAMANALKFVDHPKARQFDVRQSFDNSFIDEAMR
Ga0207646_104302691	3300025922	Corn, Switchgrass And Miscanthus Rhizosphere	SSLKVVEKAMANALKFIDHPKAKQFDVKQSFDNSLVDEMMK
Ga0207650_100805641	3300025925	Switchgrass Rhizosphere	RVNEKAMANALKFVEHPKAKQFDVRQSFDNSFVDEAMK
Ga0207650_107724572	3300025925	Switchgrass Rhizosphere	IRVNEKAMANALKFVEHPKAKQFDVRQSFDNTFVDEAIK
Ga0207670_113799522	3300025936	Switchgrass Rhizosphere	SIRVNEKAMANALKFVEHPKAKQFDVRQSFDNSFVDEAMK
Ga0207670_115615671	3300025936	Switchgrass Rhizosphere	LSLKVNERAMANALKFVDHPKARQFDVRQSFDNSFIDEAMR
Ga0207668_116347651	3300025972	Switchgrass Rhizosphere	YYRDAFPSSLRVIEKAMANALKFVDHPKAKQADIKQTFDNSFVDEAIK
Ga0208776_10261382	3300026014	Rice Paddy Soil	PSTLRTREKVMTNALKFIDHPKAKQYDVTQSFDNSLVDEIK
Ga0207641_120806771	3300026088	Switchgrass Rhizosphere	IERAMVNALKFIDHPKARQFDVRQSFDNSFIDEAMR
Ga0209469_10022888	3300026307	Soil	KSAFSSTLKVTEKEMANALKFIEHPKAKQADAKQFYDNSLVDEAMKSF
Ga0209802_13297722	3300026328	Soil	EKEMANALKFIEHTKAKQADPKQFYDNSLVDEAMKSF
Ga0209808_10488263	3300026523	Soil	TEKEMANALKFIEHPKAKQADAKQFYDNSLVDEAMKSF
Ga0209973_10756731	3300027252	Arabidopsis Thaliana Rhizosphere	STLRTREKVMTNALKFIDHPKAKQYDVTQSFDNSLVDEIK
Ga0209846_10643291	3300027277	Groundwater Sand	SNLKVVEKSMANALKFVEHPKAKGADVKQFYDNSLVEEAMK
Ga0209967_10156882	3300027364	Arabidopsis Thaliana Rhizosphere	REKVMTNALKFIDHPKAKQYDVTQSFDNSLVDEIK
Ga0208185_10897164	3300027533	Soil	EKAMANAQKFVDHPKARGADVTQFYDKSLIEEAMK
Ga0209283_105318181	3300027875	Vadose Zone Soil	FPSTLRTVEKTMANALKFIDHPKAKQADAKQFYDNSLVNEAMK
Ga0209488_109420222	3300027903	Vadose Zone Soil	YRDAFPSSLRVIEKAMANALKFVDHPKAKQADIKQTFDNSFVDEAIK
Ga0209382_103095794	3300027909	Populus Rhizosphere	RVIEKAMANALKFVDHPKAKQADIKQTFDNSFVDEAVR
Ga0209382_110516102	3300027909	Populus Rhizosphere	AEKAMANALKFVDHPKAKGTDVKQFYDNSLVEEAMR
Ga0307312_101237001	3300028828	Soil	YYKDAFPSSLRVIEKAMANALKFVDHSKTKQFDVKQSFDNSFVDEAMK
Ga0310887_110670921	3300031547	Soil	YKSAFPNTLRTTEKSMANALKFVDHPKARGADVKQFYDNSLVEEAMK
Ga0310813_101214491	3300031716	Soil	PSSIRVIEKAMANALKFVEHPKAKQFDIRQSFDNSLVDEISK
Ga0307469_114868032	3300031720	Hardwood Forest Soil	RGAFPPSLKVTERAMANALKFVDHPKARQFDVRQSFDNSFIDEAMR
Ga0307468_1005257561	3300031740	Hardwood Forest Soil	IERAMANALKFVDHPKAKQFDVRQSFDNSFIDEAMR
Ga0306925_109771812	3300031890	Soil	RSIRVNEKAMANALKFVEHPKAKQFDVRQSFDNSFVDEAVK
Ga0214473_109353002	3300031949	Soil	KDAFPPSLRVIEKAMANALKFVEHPKAKGADVRQSFDNSFVEEAMR
Ga0306922_120679131	3300032001	Soil	RVIEKAMANALKFVDHPKAKQFDVRQLFDNNFVDEAMR
Ga0310906_104846041	3300032013	Soil	NTLRTTEKSMANALKFVDHPKARGADVKQFYDNSLVEEAMK
Ga0307471_1000778303	3300032180	Hardwood Forest Soil	AFPSSLRVIEKAMANALKFVDHPKAKQADVKQSFDNSYVDEAMKQ
Ga0307472_1002367122	3300032205	Hardwood Forest Soil	FPSSLKVVEKAMANALKFIDHPKAKQFDVKQSFDNSLVDEMMK
Ga0306920_1011781712	3300032261	Soil	VFSSSLRTTDKSMANALKFIDHPKAKQADLKQFYDNSLVDEAMR
Ga0214471_105963171	3300033417	Soil	FPATLRTPEKAMANALKFIDHPKAKQFDVKQSFDNSLVDEAIK
Ga0326726_124650091	3300033433	Peat Soil	YRGAFPPSLRVIERAMANALKFVDHPKAKQFDVRQSFDNSFIDEAMR

Hidden Markov Model


Click on a Sequence Logo column to get its information.
Powered by Skylign