NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome / Metatranscriptome Family F082214

Metagenome / Metatranscriptome Family F082214

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F082214
Family Type Metagenome / Metatranscriptome
Number of Sequences 113
Average Sequence Length 40 residues
Representative Sequence APVPSSEKFDLVEALRTLATLADRLRQSEQQDLPKERKL
Number of Associated Samples 106
Number of Associated Scaffolds 113

Quality Assessment
Transcriptomic Evidence Yes
Most common taxonomic group Bacteria
% of genes with valid RBS motifs 0.00 %
% of genes near scaffold ends (potentially truncated) 98.23 %
% of genes from short scaffolds (< 2000 bps) 89.38 %
Associated GOLD sequencing projects 103
AlphaFold2 3D model prediction Yes
3D model pTM-score0.44

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Bacteria (100.000 % of family members)
NCBI Taxonomy ID 2
Taxonomy All Organisms → cellular organisms → Bacteria

Most Common Ecosystem
GOLD Ecosystem Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil
(16.814 % of family members)
Environment Ontology (ENVO) Unclassified
(23.894 % of family members)
Earth Microbiome Project Ontology (EMPO) Free-living → Non-saline → Soil (non-saline)
(38.938 % of family members)


 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      

 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Globular Signal Peptide: No Secondary Structure distribution: α-helix: 32.84%    β-sheet: 0.00%    Coil/Unstructured: 67.16%
Feature Viewer
Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer
Per-residue confidence (pLDDT):
  0-50   51-70   71-90   91-100  		pTM-score: 0.44
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.

 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 113 Family Scaffolds
PF01656CbiA 22.12
PF13614AAA_31 13.27
PF02397Bac_transf 3.54
PF08241Methyltransf_11 1.77
PF00535Glycos_transf_2 1.77
PF13480Acetyltransf_6 0.88

Neighboring Clusters of Orthologous Genes (COGs)

COG IDNameFunctional Category % Frequency in 113 Family Scaffolds
COG2148Sugar transferase involved in LPS biosynthesis (colanic, teichoic acid)Cell wall/membrane/envelope biogenesis [M] 3.54

 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms100.00 %
UnclassifiedrootN/A0.00 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
3300001100|JGI12703J13194_100030All Organisms → cellular organisms → Bacteria3417Open in IMG/M
3300001593|JGI12635J15846_10008965All Organisms → cellular organisms → Bacteria8494Open in IMG/M
3300001661|JGI12053J15887_10341844All Organisms → cellular organisms → Bacteria → Acidobacteria725Open in IMG/M
3300002908|JGI25382J43887_10485583All Organisms → cellular organisms → Bacteria → Acidobacteria523Open in IMG/M
3300004479|Ga0062595_100002238All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae4726Open in IMG/M
3300004619|Ga0068953_1369556All Organisms → cellular organisms → Bacteria → Acidobacteria535Open in IMG/M
3300004631|Ga0058899_11917208All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae1379Open in IMG/M
3300005331|Ga0070670_101180120All Organisms → cellular organisms → Bacteria → Acidobacteria699Open in IMG/M
3300005436|Ga0070713_100540132All Organisms → cellular organisms → Bacteria → Acidobacteria1103Open in IMG/M
3300005440|Ga0070705_100104328All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → unclassified Acidobacteriaceae → Acidobacteriaceae bacterium1797Open in IMG/M
3300005540|Ga0066697_10632842All Organisms → cellular organisms → Bacteria → Acidobacteria590Open in IMG/M
3300005764|Ga0066903_107627629All Organisms → cellular organisms → Bacteria → Acidobacteria557Open in IMG/M
3300006034|Ga0066656_10991439All Organisms → cellular organisms → Bacteria → Acidobacteria539Open in IMG/M
3300007076|Ga0075435_100592224All Organisms → cellular organisms → Bacteria → Acidobacteria961Open in IMG/M
3300007076|Ga0075435_101052641All Organisms → cellular organisms → Bacteria → Acidobacteria711Open in IMG/M
3300007788|Ga0099795_10487768All Organisms → cellular organisms → Bacteria → Acidobacteria573Open in IMG/M
3300009088|Ga0099830_10710297All Organisms → cellular organisms → Bacteria → Acidobacteria828Open in IMG/M
3300009137|Ga0066709_100630163All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae1532Open in IMG/M
3300009137|Ga0066709_103557220All Organisms → cellular organisms → Bacteria → Acidobacteria565Open in IMG/M
3300009156|Ga0111538_10367981All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae1820Open in IMG/M
3300009174|Ga0105241_10001351All Organisms → cellular organisms → Bacteria18654Open in IMG/M
3300009616|Ga0116111_1101251All Organisms → cellular organisms → Bacteria → Acidobacteria728Open in IMG/M
3300009631|Ga0116115_1137365All Organisms → cellular organisms → Bacteria → Acidobacteria622Open in IMG/M
3300009632|Ga0116102_1187861All Organisms → cellular organisms → Bacteria → Acidobacteria558Open in IMG/M
3300009643|Ga0116110_1134422All Organisms → cellular organisms → Bacteria → Acidobacteria823Open in IMG/M
3300009645|Ga0116106_1040107All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae1586Open in IMG/M
3300009762|Ga0116130_1254436All Organisms → cellular organisms → Bacteria → Acidobacteria559Open in IMG/M
3300009764|Ga0116134_1309925All Organisms → cellular organisms → Bacteria → Acidobacteria542Open in IMG/M
3300010043|Ga0126380_11457631All Organisms → cellular organisms → Bacteria → Acidobacteria604Open in IMG/M
3300010359|Ga0126376_13017064All Organisms → cellular organisms → Bacteria → Acidobacteria520Open in IMG/M
3300010366|Ga0126379_13380247All Organisms → cellular organisms → Bacteria → Acidobacteria534Open in IMG/M
3300010399|Ga0134127_10775135All Organisms → cellular organisms → Bacteria → Acidobacteria1006Open in IMG/M
3300011085|Ga0138581_1199954All Organisms → cellular organisms → Bacteria → Acidobacteria545Open in IMG/M
3300011120|Ga0150983_16200081All Organisms → cellular organisms → Bacteria → Acidobacteria861Open in IMG/M
3300011270|Ga0137391_10603855All Organisms → cellular organisms → Bacteria → Acidobacteria919Open in IMG/M
3300011444|Ga0137463_1328818All Organisms → cellular organisms → Bacteria → Acidobacteria553Open in IMG/M
3300012198|Ga0137364_11403859All Organisms → cellular organisms → Bacteria → Acidobacteria517Open in IMG/M
3300012205|Ga0137362_10948853All Organisms → cellular organisms → Bacteria → Acidobacteria734Open in IMG/M
3300012206|Ga0137380_11622198All Organisms → cellular organisms → Bacteria → Acidobacteria531Open in IMG/M
3300012354|Ga0137366_10179609All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae1587Open in IMG/M
3300012363|Ga0137390_11827382All Organisms → cellular organisms → Bacteria → Acidobacteria538Open in IMG/M
3300012493|Ga0157355_1009592All Organisms → cellular organisms → Bacteria → Acidobacteria734Open in IMG/M
3300012917|Ga0137395_10920357All Organisms → cellular organisms → Bacteria → Acidobacteria631Open in IMG/M
3300012924|Ga0137413_10088776All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae1899Open in IMG/M
3300012924|Ga0137413_11473344All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria552Open in IMG/M
3300012929|Ga0137404_10627667All Organisms → cellular organisms → Bacteria → Acidobacteria968Open in IMG/M
3300012929|Ga0137404_11053291All Organisms → cellular organisms → Bacteria → Acidobacteria745Open in IMG/M
3300012930|Ga0137407_10648702All Organisms → cellular organisms → Bacteria → Acidobacteria993Open in IMG/M
3300012960|Ga0164301_10956471All Organisms → cellular organisms → Bacteria → Acidobacteria669Open in IMG/M
3300012977|Ga0134087_10187082All Organisms → cellular organisms → Bacteria → Acidobacteria920Open in IMG/M
3300014169|Ga0181531_10947246All Organisms → cellular organisms → Bacteria → Acidobacteria540Open in IMG/M
3300014201|Ga0181537_10021737All Organisms → cellular organisms → Bacteria4514Open in IMG/M
3300015359|Ga0134085_10362574All Organisms → cellular organisms → Bacteria → Acidobacteria646Open in IMG/M
3300015372|Ga0132256_100656470All Organisms → cellular organisms → Bacteria → Acidobacteria1164Open in IMG/M
3300017659|Ga0134083_10276966All Organisms → cellular organisms → Bacteria → Acidobacteria707Open in IMG/M
3300017927|Ga0187824_10220951All Organisms → cellular organisms → Bacteria → Acidobacteria650Open in IMG/M
3300017928|Ga0187806_1127590All Organisms → cellular organisms → Bacteria → Acidobacteria828Open in IMG/M
3300017934|Ga0187803_10003948All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae5865Open in IMG/M
3300017936|Ga0187821_10143492All Organisms → cellular organisms → Bacteria → Acidobacteria899Open in IMG/M
3300017948|Ga0187847_10124355All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae1414Open in IMG/M
3300018018|Ga0187886_1130355All Organisms → cellular organisms → Bacteria → Acidobacteria1016Open in IMG/M
3300018034|Ga0187863_10003741All Organisms → cellular organisms → Bacteria11083Open in IMG/M
3300018046|Ga0187851_10458030All Organisms → cellular organisms → Bacteria → Acidobacteria726Open in IMG/M
3300018085|Ga0187772_10217654All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae1288Open in IMG/M
3300018085|Ga0187772_11061991All Organisms → cellular organisms → Bacteria → Acidobacteria593Open in IMG/M
3300021170|Ga0210400_10269103All Organisms → cellular organisms → Bacteria → Acidobacteria1396Open in IMG/M
3300021377|Ga0213874_10044821All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1337Open in IMG/M
3300021403|Ga0210397_10574336All Organisms → cellular organisms → Bacteria → Acidobacteria860Open in IMG/M
3300021433|Ga0210391_10531533All Organisms → cellular organisms → Bacteria → Acidobacteria923Open in IMG/M
3300022521|Ga0224541_1008707All Organisms → cellular organisms → Bacteria → Acidobacteria1091Open in IMG/M
3300022726|Ga0242654_10194914All Organisms → cellular organisms → Bacteria → Acidobacteria701Open in IMG/M
3300025439|Ga0208323_1010939All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae2238Open in IMG/M
3300025619|Ga0207926_1134735All Organisms → cellular organisms → Bacteria → Acidobacteria570Open in IMG/M
3300025898|Ga0207692_10805556All Organisms → cellular organisms → Bacteria → Acidobacteria614Open in IMG/M
3300025925|Ga0207650_11006211All Organisms → cellular organisms → Bacteria → Acidobacteria709Open in IMG/M
3300026035|Ga0207703_10282815All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae1507Open in IMG/M
3300026277|Ga0209350_1006027All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae4167Open in IMG/M
3300026296|Ga0209235_1171014All Organisms → cellular organisms → Bacteria → Acidobacteria820Open in IMG/M
3300026548|Ga0209161_10106976All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae1677Open in IMG/M
3300026557|Ga0179587_10105653All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae1710Open in IMG/M
3300027535|Ga0209734_1097026All Organisms → cellular organisms → Bacteria → Acidobacteria565Open in IMG/M
3300027663|Ga0208990_1017622All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae2351Open in IMG/M
3300027676|Ga0209333_1020247All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae1893Open in IMG/M
3300027678|Ga0209011_1192786All Organisms → cellular organisms → Bacteria → Acidobacteria558Open in IMG/M
3300027737|Ga0209038_10211750All Organisms → cellular organisms → Bacteria → Acidobacteria585Open in IMG/M
3300027738|Ga0208989_10286519All Organisms → cellular organisms → Bacteria → Acidobacteria529Open in IMG/M
3300027738|Ga0208989_10297244All Organisms → cellular organisms → Bacteria517Open in IMG/M
3300027862|Ga0209701_10657364All Organisms → cellular organisms → Bacteria → Acidobacteria547Open in IMG/M
3300027875|Ga0209283_10255370All Organisms → cellular organisms → Bacteria → Acidobacteria1161Open in IMG/M
3300027875|Ga0209283_10574055All Organisms → cellular organisms → Bacteria → Acidobacteria718Open in IMG/M
3300027903|Ga0209488_10440057All Organisms → cellular organisms → Bacteria → Acidobacteria961Open in IMG/M
3300028560|Ga0302144_10164974All Organisms → cellular organisms → Bacteria → Acidobacteria716Open in IMG/M
3300028765|Ga0302198_10302571All Organisms → cellular organisms → Bacteria → Acidobacteria752Open in IMG/M
3300028866|Ga0302278_10406354All Organisms → cellular organisms → Bacteria → Acidobacteria602Open in IMG/M
3300029951|Ga0311371_12624061All Organisms → cellular organisms → Bacteria → Acidobacteria508Open in IMG/M
3300030688|Ga0311345_10166949All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae2309Open in IMG/M
3300031114|Ga0308187_10233915All Organisms → cellular organisms → Bacteria → Acidobacteria660Open in IMG/M
3300031261|Ga0302140_10880110All Organisms → cellular organisms → Bacteria → Acidobacteria629Open in IMG/M
3300031525|Ga0302326_12057559All Organisms → cellular organisms → Bacteria → Acidobacteria735Open in IMG/M
3300031561|Ga0318528_10592615All Organisms → cellular organisms → Bacteria → Acidobacteria595Open in IMG/M
3300031716|Ga0310813_10292688All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae1371Open in IMG/M
3300031718|Ga0307474_10254575All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae1345Open in IMG/M
3300031754|Ga0307475_10197746All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae1606Open in IMG/M
3300031820|Ga0307473_11566279All Organisms → cellular organisms → Bacteria → Acidobacteria501Open in IMG/M
3300031947|Ga0310909_10878003All Organisms → cellular organisms → Bacteria → Acidobacteria737Open in IMG/M
3300032063|Ga0318504_10546830All Organisms → cellular organisms → Bacteria → Acidobacteria555Open in IMG/M
3300032205|Ga0307472_102231151All Organisms → cellular organisms → Bacteria → Acidobacteria553Open in IMG/M
3300032828|Ga0335080_11449046All Organisms → cellular organisms → Bacteria → Acidobacteria681Open in IMG/M
3300032954|Ga0335083_10429634All Organisms → cellular organisms → Bacteria → Acidobacteria1121Open in IMG/M
3300033405|Ga0326727_10118380All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae3341Open in IMG/M
3300033561|Ga0371490_1060305All Organisms → cellular organisms → Bacteria → Acidobacteria1094Open in IMG/M
3300034124|Ga0370483_0036479All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae1512Open in IMG/M
3300034199|Ga0370514_140040All Organisms → cellular organisms → Bacteria → Acidobacteria623Open in IMG/M


 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
Vadose Zone SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil16.81%
Forest SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil9.73%
PeatlandEnvironmental → Aquatic → Freshwater → Wetlands → Unclassified → Peatland7.08%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil6.19%
Grasslands SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil4.42%
BogEnvironmental → Terrestrial → Peat → Unclassified → Unclassified → Bog4.42%
PeatlandEnvironmental → Aquatic → Freshwater → Wetlands → Bog → Peatland3.54%
Freshwater SedimentEnvironmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment3.54%
Hardwood Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil3.54%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil2.65%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil2.65%
Grasslands SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil2.65%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Soil2.65%
Corn, Switchgrass And Miscanthus RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere2.65%
Populus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere2.65%
BogEnvironmental → Aquatic → Freshwater → Wetlands → Bog → Bog1.77%
Peatlands SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil1.77%
SoilEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Soil1.77%
Untreated Peat SoilEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Untreated Peat Soil1.77%
Tropical PeatlandEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland1.77%
PalsaEnvironmental → Terrestrial → Peat → Unclassified → Unclassified → Palsa1.77%
Peat SoilEnvironmental → Terrestrial → Peat → Unclassified → Unclassified → Peat Soil1.77%
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere1.77%
Bog Forest SoilEnvironmental → Aquatic → Freshwater → Wetlands → Bog → Bog Forest Soil0.89%
SoilEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Soil0.89%
Terrestrial SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil0.89%
Unplanted SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Unplanted Soil0.89%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil0.89%
Arctic Peat SoilEnvironmental → Terrestrial → Soil → Unclassified → Permafrost → Arctic Peat Soil0.89%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil0.89%
SoilEnvironmental → Terrestrial → Peat → Unclassified → Unclassified → Soil0.89%
Switchgrass RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere0.89%
Plant RootsHost-Associated → Plants → Roots → Unclassified → Unclassified → Plant Roots0.89%
Corn RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere0.89%
Arabidopsis RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Arabidopsis Rhizosphere0.89%

Visualization
Powered by ApexCharts



Associated Samples

Taxon OIDSample NameHabitat TypeIMG/M Link
3300001100Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM3_M1EnvironmentalOpen in IMG/M
3300001593Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM2_M2EnvironmentalOpen in IMG/M
3300001661Mediterranean Blodgett CA OM1_O3 (Mediterranean Blodgett coassembly)EnvironmentalOpen in IMG/M
3300002908Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 08_20_2013_1_40cmEnvironmentalOpen in IMG/M
3300004479Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of All WPAsEnvironmentalOpen in IMG/M
3300004619Peat soil microbial communities from Weissenstadt, Germany - Metatranscriptome 45 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300004631Forest soil microbial communities from Harvard Forest Long Term Ecological Research site in Petersham, Massachusetts, USA - MetaT HF234 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300005331Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaGHost-AssociatedOpen in IMG/M
3300005436Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaGEnvironmentalOpen in IMG/M
3300005440Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaGEnvironmentalOpen in IMG/M
3300005540Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_146EnvironmentalOpen in IMG/M
3300005764Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2)EnvironmentalOpen in IMG/M
3300006034Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_105EnvironmentalOpen in IMG/M
3300007076Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4Host-AssociatedOpen in IMG/M
3300007788Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2EnvironmentalOpen in IMG/M
3300009088Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H3.8 metaGEnvironmentalOpen in IMG/M
3300009137Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_158EnvironmentalOpen in IMG/M
3300009156Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD1 (version 2)Host-AssociatedOpen in IMG/M
3300009174Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaGHost-AssociatedOpen in IMG/M
3300009616Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_8_100EnvironmentalOpen in IMG/M
3300009631Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_10_100EnvironmentalOpen in IMG/M
3300009632Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_4_40EnvironmentalOpen in IMG/M
3300009643Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_8_40EnvironmentalOpen in IMG/M
3300009645Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_6_40EnvironmentalOpen in IMG/M
3300009762Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_17_40EnvironmentalOpen in IMG/M
3300009764Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_19_40EnvironmentalOpen in IMG/M
3300010043Tropical forest soil microbial communities from Panama - MetaG Plot_26EnvironmentalOpen in IMG/M
3300010359Tropical forest soil microbial communities from Panama - MetaG Plot_15EnvironmentalOpen in IMG/M
3300010366Tropical forest soil microbial communities from Panama - MetaG Plot_24EnvironmentalOpen in IMG/M
3300010399Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-3EnvironmentalOpen in IMG/M
3300011085Peat soil microbial communities from Weissenstadt, Germany - Metatranscriptome 71 (Metagenome Metatranscriptome) (version 2)EnvironmentalOpen in IMG/M
3300011120Combined assembly of Microbial Forest Soil metaTEnvironmentalOpen in IMG/M
3300011270Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h2.4B metaGEnvironmentalOpen in IMG/M
3300011444Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMGT800_2EnvironmentalOpen in IMG/M
3300012198Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_20_16 metaGEnvironmentalOpen in IMG/M
3300012205Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_100_16 metaGEnvironmentalOpen in IMG/M
3300012206Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_100_16 metaGEnvironmentalOpen in IMG/M
3300012354Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_60_16 metaGEnvironmentalOpen in IMG/M
3300012363Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h2.4A metaGEnvironmentalOpen in IMG/M
3300012493Unplanted soil (control) microbial communities from North Carolina - M.Soil.10.yng.090610EnvironmentalOpen in IMG/M
3300012917Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czobulk2.16 metaGEnvironmentalOpen in IMG/M
3300012924Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_16fungal (Illumina Assembly)EnvironmentalOpen in IMG/M
3300012929Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_16fungal (Illumina Assembly)EnvironmentalOpen in IMG/M
3300012930Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_2_16fungal (Illumina Assembly)EnvironmentalOpen in IMG/M
3300012960Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_231_MGEnvironmentalOpen in IMG/M
3300012977Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Glu_20cm_5_24_1 metaGEnvironmentalOpen in IMG/M
3300014169Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin11_10_metaGEnvironmentalOpen in IMG/M
3300014201Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin23_10_metaGEnvironmentalOpen in IMG/M
3300015359Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_2_09182015EnvironmentalOpen in IMG/M
3300015372Soil combined assemblyHost-AssociatedOpen in IMG/M
3300017659Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Met_40cm_5_24_1 metaGEnvironmentalOpen in IMG/M
3300017927Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SourceSoil_4EnvironmentalOpen in IMG/M
3300017928Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - ASW_1EnvironmentalOpen in IMG/M
3300017934Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - Control_3EnvironmentalOpen in IMG/M
3300017936Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SourceSoil_1EnvironmentalOpen in IMG/M
3300017948Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_4_10EnvironmentalOpen in IMG/M
3300018018Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_20_150EnvironmentalOpen in IMG/M
3300018034Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_11_10EnvironmentalOpen in IMG/M
3300018046Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_6_10EnvironmentalOpen in IMG/M
3300018085Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP15_20_MGEnvironmentalOpen in IMG/M
3300021170Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-26-MEnvironmentalOpen in IMG/M
3300021377Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7Host-AssociatedOpen in IMG/M
3300021403Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-OEnvironmentalOpen in IMG/M
3300021433Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-12-OEnvironmentalOpen in IMG/M
3300022521Peat soil microbial communities from Stordalen Mire, Sweden - 717 E3 20-24EnvironmentalOpen in IMG/M
3300022726Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-C-30-M (Metagenome Metatranscriptome) (v2)EnvironmentalOpen in IMG/M
3300025439Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_10_100 (SPAdes)EnvironmentalOpen in IMG/M
3300025619Arctic peat soil from Barrow, Alaska - NGEE Surface sample 210-1 deep-072012 (SPAdes)EnvironmentalOpen in IMG/M
3300025898Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025925Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300026035Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300026277Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 09_27_2013_2_20cm (SPAdes)EnvironmentalOpen in IMG/M
3300026296Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 09_25_2013_1_20cm (SPAdes)EnvironmentalOpen in IMG/M
3300026548Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_155 (SPAdes)EnvironmentalOpen in IMG/M
3300026557Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_08_16fungalEnvironmentalOpen in IMG/M
3300027535Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM1_M2 (SPAdes)EnvironmentalOpen in IMG/M
3300027663Forest soil microbial communities from El Dorado National Forest, California, USA - Mediterranean Blodgett CA Ref_M3 (SPAdes)EnvironmentalOpen in IMG/M
3300027676Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM2_O3 (SPAdes)EnvironmentalOpen in IMG/M
3300027678Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM1_M3 (SPAdes)EnvironmentalOpen in IMG/M
3300027737Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP03_OM3 (SPAdes)EnvironmentalOpen in IMG/M
3300027738Forest soil microbial communities from El Dorado National Forest, California, USA - Mediterranean Blodgett CA OM3_M1 (SPAdes)EnvironmentalOpen in IMG/M
3300027862Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H3.8 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300027875Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H1.8 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300027903Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_2 (SPAdes)EnvironmentalOpen in IMG/M
3300028560Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Bog_E2_2EnvironmentalOpen in IMG/M
3300028765Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Bog_N2_2EnvironmentalOpen in IMG/M
3300028866Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - III_Bog_N3_2EnvironmentalOpen in IMG/M
3300029951III_Palsa_N1 coassemblyEnvironmentalOpen in IMG/M
3300030688II_Bog_N2 coassemblyEnvironmentalOpen in IMG/M
3300031114Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_182 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300031261Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Bog_E1_1EnvironmentalOpen in IMG/M
3300031525Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Palsa_T0_3EnvironmentalOpen in IMG/M
3300031561Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.052b4f26EnvironmentalOpen in IMG/M
3300031716Soil microbial communities from experimental microcosm in Duke University, North Carolina, United States - YN3EnvironmentalOpen in IMG/M
3300031718Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM1C_05EnvironmentalOpen in IMG/M
3300031754Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM1C_515EnvironmentalOpen in IMG/M
3300031820Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_515EnvironmentalOpen in IMG/M
3300031947Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.T000HEnvironmentalOpen in IMG/M
3300032063Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.084b2f17EnvironmentalOpen in IMG/M
3300032205Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_05EnvironmentalOpen in IMG/M
3300032828Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.4EnvironmentalOpen in IMG/M
3300032954Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.2EnvironmentalOpen in IMG/M
3300033405Lab enriched peat soil microbial communities from McLean, Ithaca, NY, United States - MB29MYEnvironmentalOpen in IMG/M
3300033561Lab enriched peat soil microbial communities from McLean, Ithaca, NY, United States - MB28FN SIP fractionEnvironmentalOpen in IMG/M
3300034124Peat soil microbial communities from wetlands in Alaska, United States - Goldstream_06D_14EnvironmentalOpen in IMG/M
3300034199Peat soil microbial communities from wetlands in Alaska, United States - Goldstream_01D_14EnvironmentalOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap


 ⦗Top⦘

Family Sequences

Protein ID Sample Taxon ID Habitat Sequence
JGI12703J13194_10003013300001100Forest SoilPVPASDKFDLVEALRTLATLADRLRQSERQDVPKEGKL*
JGI12635J15846_1000896513300001593Forest SoilAMTAPVPASDKFDLVEALRTLATLADRLRQSERQDVPKEGKL*
JGI12053J15887_1034184413300001661Forest SoilSEKFDLVEALRTLATLADRLRQNEQQDVPKEGKL*
JGI25382J43887_1048558313300002908Grasslands SoilAPQATSTEKFDLVEALRSLATLADRLRQSEQDLPKERKI*
Ga0062595_10000223853300004479SoilSSKTTDFVSSGAEKFDLLEALKTLATLADRLRQSEQDAPKERKI*
Ga0068953_136955613300004619Peatlands SoilNAAAAMTAPVPPSEKFDLVEALRTLATLADRLRQSEQQDLPKERKL*
Ga0058899_1191720813300004631Forest SoilASGAMTVPAPPAPSNGEKFDLVEALRTLATLADRLRQSEQDLPKERKS*
Ga0070670_10118012013300005331Switchgrass RhizosphereASAAMTPGAPAPASEKFDVAEALKTLATLADRLRQSEPDLPKERKI*
Ga0070713_10054013213300005436Corn, Switchgrass And Miscanthus RhizosphereVAAPAAPAAEKFDLVDALRTLATLADRLRQSEQEMSKERKS*
Ga0070705_10010432833300005440Corn, Switchgrass And Miscanthus RhizosphereMTPSNPAPNEKFDVAEALKTLATLADRLRQSESDLPKERKI*
Ga0066697_1063284213300005540SoilPQASSAEKFDLVEALRTLATLADRLRHSDQELAKERKL*
Ga0066903_10762762913300005764Tropical Forest SoilVVPPAPEKFDLVEALRTLATLADRLRQSEQELPKERKI*
Ga0066656_1099143913300006034SoilTPVVPLASPEKFDLVEALRTLATLADKLRQSEQDLPKERKL*
Ga0075435_10059222413300007076Populus RhizosphereAMTPSNPAPNEKFDVAEALKTLATLADRLRQSESDLPKERKI*
Ga0075435_10105264113300007076Populus RhizosphereAPAGNLEKFDVVEALRTLATLAERLRESDQDLPKERKL*
Ga0099795_1048776823300007788Vadose Zone SoilPPNPEKLDVVEALRTLATLADRLRRPETELSKEGKI*
Ga0099830_1071029713300009088Vadose Zone SoilASTEKFDLVEALKTLATLADRLRQSEQDLPKERKL*
Ga0066709_10063016313300009137Grasslands SoilDTTSQVLTTPPQPNSAEKFDLVEALRTLATLADRLRQSEQPELAKERKL*
Ga0066709_10355722013300009137Grasslands SoilSAEKFDLVEALRTLATLADRLRHSDQELAKERKL*
Ga0111538_1036798133300009156Populus RhizospherePANPAPNEKFDVAEALKTLATLADRLRQSESDLPKERKI*
Ga0105241_1000135113300009174Corn RhizosphereAASAAMTPSNPAPNEKFDVAEALKTLATLADRLRQSESDLPKERKI*
Ga0116111_110125123300009616PeatlandAAMTAPAPPSSEKFDLVEALRTLATLADRLRQSEQQDLPKERKL*
Ga0116115_113736513300009631PeatlandTAPVPPSSEKFDLVEALRTLATLADRLRQSEQQDLPKERKL*
Ga0116102_118786123300009632PeatlandAMIAPAPPSSEKFDLVEALRTLATLADRLRQSEQQDLPKERKL*
Ga0116110_113442213300009643PeatlandGAMIAPAPPSSEKFDLVEALRTLATMADRLRQSEQQDLPKERKL*
Ga0116106_104010733300009645PeatlandAMIASAPPSSEKFDLVEALRTLATLADRLRHSEEQDLPKERKL*
Ga0116130_125443613300009762PeatlandAPVPSSEKFDLVEALRTLATLADRLRQSEQQDLPKERKL*
Ga0116134_130992513300009764PeatlandSEKFDLVEALRTLATLADRLRQSEQQDLPKERKL*
Ga0126380_1145763123300010043Tropical Forest SoilGAERFDLVEALRTLATLADRLRQSEQDLPKERKS*
Ga0126376_1301706423300010359Tropical Forest SoilTAEKFDVVEALRTLATIADRLRQSEPDLPKERKL*
Ga0126379_1338024713300010366Tropical Forest SoilTTPAAVPEKFDLVEALRTLATLADRVRQSEEELPKERKL*
Ga0134127_1077513513300010399Terrestrial SoilAPNEKFDVAEALKTLATLADRLRQSESDLPKERKI*
Ga0138581_119995423300011085Peatlands SoilPSPEKFDLVEALRTLATLADRLRQSEQQDLPKERKL*
Ga0150983_1620008113300011120Forest SoilPPSSEKFDLVEALRTLATLADRLRQSEQQDLPKEGKL*
Ga0137391_1060385523300011270Vadose Zone SoilPSSEKFDLVEALRTLATLADRLRQSEQQDLPKEGKL*
Ga0137463_132881813300011444SoilVPSSEKFDLVEALRTLATLADRLRQSEPQDLPKERKL*
Ga0137364_1140385913300012198Vadose Zone SoilTPAAPPSPNGAEKFDLVEALRTLATLADRLRQSEQDVSKERKS*
Ga0137362_1094885313300012205Vadose Zone SoilAGAMIAPVPPSSEKFDLVEALRTLATLADRLRQSEQQDLPKERKL*
Ga0137380_1162219813300012206Vadose Zone SoilPAQTSPVEKFDVVEVLRTLATLADRLRDSPQDFPKERKL*
Ga0137366_1017960933300012354Vadose Zone SoilTPAPQATSTEKFDLVEALRSLATLADRLRQSEQDLPKERKI*
Ga0137390_1182738213300012363Vadose Zone SoilMIAPVPPSSEKFDLVEALRTLATLADRLRQSEQQDLPKERKL*
Ga0157355_100959213300012493Unplanted SoilPAPNEKFDVAEALKTLATLADRLRQSESDLPKERKI*
Ga0137395_1092035723300012917Vadose Zone SoilLTTPPQANSAEKFDLVEALRTLATLADRLRHSDQELAKERKL*
Ga0137413_1008877633300012924Vadose Zone SoilVPEVSSERFDLVEALRTLATLADKIRQSEQELPKERKI*
Ga0137413_1147334413300012924Vadose Zone SoilAMTAAAPQPTTGAEKFDLVEALRTLATLADRLRQSEQDVSKERKS*
Ga0137404_1062766723300012929Vadose Zone SoilSPEKFDLVEALRTLATLADKLRQSEQDLPKERKL*
Ga0137404_1105329113300012929Vadose Zone SoilAAAMIAPVPSSEKFDLVEALRTLATLADRLRQSEQQDLPKERKL*
Ga0137407_1064870213300012930Vadose Zone SoilQTSPVEKFDVVEVLRTLATLADRLRDSPQDFPKERKL*
Ga0164301_1095647113300012960SoilAQTNSNGKFDVVEALRTLATLADRLRDSEQDLPKERKI*
Ga0134087_1018708213300012977Grasslands SoilPLNGSEKFDLVEALKTLASLADRLRQSEQHLPKERKL*
Ga0181531_1094724613300014169BogAGAMMPAAPAPAGKFDLVEALRTLATLADRLRESEQQDLPKERKL*
Ga0181537_1002173753300014201BogMTMAAPTAPGAEKFDLVEALRSLATIADRLREEDKDLPKEGKL*
Ga0134085_1036257423300015359Grasslands SoilTPPPTNPVEKFDLVEALRTLATLADRLRQSEQPELAKERKL*
Ga0132256_10065647013300015372Arabidopsis RhizosphereASAAMTPQPTTGAEKFDLVDALRTLATLADRLRQSEQDLSKERKS*
Ga0134083_1027696623300017659Grasslands SoilAMTPAPQATSTEKFDLVEALRSLATLADRLRQSEQDLPKERKI
Ga0187824_1022095113300017927Freshwater SedimentAAPPPPPGVEKFDVVEALRTLATLADRLRQSEQDLPKERKS
Ga0187806_112759013300017928Freshwater SedimentAMTAPVPPSEKFDLVEALRTLATLADRLRQSEQQDLPKERKL
Ga0187803_1000394863300017934Freshwater SedimentTTAVPRDATAPKFDLVEALRTLATLADRLRQSEEDLPKERKL
Ga0187821_1014349213300017936Freshwater SedimentKPVNGTEKFDVVEALRTLATLADRLRQTEPDLPKERKS
Ga0187847_1012435513300017948PeatlandPVPSSEKFDLVEALRTLATLADRLRQSEQHDLPKEGKL
Ga0187886_113035523300018018PeatlandAAGAMIAPVPPSSEKFDLVEALRTLATLADRLRQSEQQDLPKERKL
Ga0187863_10003741103300018034PeatlandSPEKFDLVEALRTLATLADRLRQSEPQDLPKERKL
Ga0187851_1045803013300018046PeatlandPVPPSSEKFDLVEALRTLATLADRLRQSEQQDLPKERKL
Ga0187772_1021765413300018085Tropical PeatlandAPPNPEKFDLVEALRTLATLADKLRQPEQTDLSKERKL
Ga0187772_1106199123300018085Tropical PeatlandAAMMAPVPRSEKFDLVEALRTLATLADRLRQSEQQDLPKEGKL
Ga0210400_1026910313300021170SoilAAMIAPVPPSSEKFDLVEALRTLATLADRLRQSEQQDLPKEGKL
Ga0213874_1004482133300021377Plant RootsEGAGTEKFDLVEALKTLSTLADRLREPEAETAPKERK
Ga0210397_1057433613300021403SoilASSSNDKFDLVEALKTLATLADRLRQSEQDLPKERKL
Ga0210391_1053153313300021433SoilGNAAAAMTAPVPSSEKFDLVEALRTLATLADRLRQSEQQDLPKERKL
Ga0224541_100870723300022521SoilMMAPLPASPEKFDLVEALRTLATLADRLRQSEQQDLPKERKL
Ga0242654_1019491413300022726SoilSAAAAMIAPVPPSSEKFDLVEALRTLATLADRLRQSEQQDLPKEGKL
Ga0208323_101093913300025439PeatlandSSEKFDLVEALRTLATMADRLRQSEQQDLPKERKL
Ga0207926_113473523300025619Arctic Peat SoilNAAAAMIAPAPPSSEKFDLVEALRTLATLADRLRQSEQQDLPKERKL
Ga0207692_1080555613300025898Corn, Switchgrass And Miscanthus RhizospherePAQPAPSNGEKFDLVEALRTLATLADRLRQSEQDLPKERKS
Ga0207650_1100621123300025925Switchgrass RhizosphereASAAMTPGAPAPASEKFDVAEALKTLATLADRLRQSEPDLPKERKI
Ga0207703_1028281513300026035Switchgrass RhizosphereSNPAPNEKFDVAEALKTLATLADRLRQSESDLPKERKI
Ga0209350_100602713300026277Grasslands SoilTPPQASSAEKFDLVEALRTLATLADRLRHSDQELAKERKL
Ga0209235_117101423300026296Grasslands SoilMTPAPQATSTEKFDLVEALRSLATLADRLRQSEQDLPKERKI
Ga0209161_1010697613300026548SoilANSAEKFDLVEALRTLATLADRLRHSDQELAKERKL
Ga0179587_1010565313300026557Vadose Zone SoilVPSSEKFDLVEALRTLATLADRLRQSEQQDLPKERKL
Ga0209734_109702623300027535Forest SoilPAVPASSEKFDLVEALRTLATLADRLRQNEQQDVPKEGKL
Ga0208990_101762233300027663Forest SoilVPPSSEKFDLVEALRTLATLADRLRQSEQQDLPKEGKL
Ga0209333_102024733300027676Forest SoilAMTAPVPSSEKFDLVEALRTLATLADKLRQSEQQQLPKEGKI
Ga0209011_119278613300027678Forest SoilAAAAMIAPVPPSSEKFDLVEALRTLATLADRLRQSEQQDLPKEGKL
Ga0209038_1021175013300027737Bog Forest SoilIAPVPPSEKFDLVDALRTLATLADRLRQSEQQDLPKERKI
Ga0208989_1028651913300027738Forest SoilAASEKFDLVEALRTLATLADRLRQNEQQDVPKEGKL
Ga0208989_1029724413300027738Forest SoilTPPQNGSPEKFDLVEALRSLATLADRLRDEEKDLPKERKL
Ga0209701_1065736423300027862Vadose Zone SoilPAPQSNGAEKFDVVEALRTLATLAERLRQPEQDLPKERKI
Ga0209283_1025537013300027875Vadose Zone SoilTPAPHSNTTEKFDVVEALRTLATLAERLRQSDPDLPKERKI
Ga0209283_1057405523300027875Vadose Zone SoilPPPPPQTASTEKFDLVEALKTLATLADRLRQSEQDLPKERKL
Ga0209488_1044005723300027903Vadose Zone SoilAMTTPLPQQTGSSEKFDLVEALRSLATLADRLREEEKDLPKERKL
Ga0302144_1016497423300028560BogSNASAAMTAPVPSSEKFDLVEALRTLATLADRLRQSEQQNLPKEGKL
Ga0302198_1030257113300028765BogSSEKFDLVEALRTLATLADRLRQSEQQNLPKEGKL
Ga0302278_1040635413300028866BogAAMTAPVPPSEKFDLVEALRTLATLADRLRQSEQQNLPKEGKL
Ga0311371_1262406113300029951PalsaAPVPSSEKFDLVEALRTLATLADRLRQSEEQDLPKERKL
Ga0311345_1016694933300030688BogAMTAPVPSSEKFDLVEALRTLATLADRLRQSEQHDLPKEGKL
Ga0308187_1023391523300031114SoilASAAMTAPAQTSPVEKFDVVEVLRTLATLADRLRDSPQDFPKERKL
Ga0302140_1088011023300031261BogPSSEKFDLVEALRTLATLADRLRQSEQHDLPKEGKL
Ga0302326_1205755923300031525PalsaSTPATNAEKFDLVEALRTLATLADKLRQSEPQELPKEGKI
Ga0318528_1059261513300031561SoilPASSNGEKFDLVEALRTLATLADRLRQSEQDLPKERKS
Ga0310813_1029268813300031716SoilPAPNEKFDVAEALKTLATLADRLRQSESDLPKERKI
Ga0307474_1025457533300031718Hardwood Forest SoilADGTAGAMMPAAPASSEKFDLVEALRTLATLADRLRESEGQDLPKERKL
Ga0307475_1019774613300031754Hardwood Forest SoilPSDKFDLVEALRTLATLADRLRQSEQQDLPKEGKI
Ga0307473_1156627923300031820Hardwood Forest SoilAAMTAPAQTSPVEKFDVVEVLRTLATLADRLRDSPQDFPKERKL
Ga0310909_1087800313300031947SoilTVAAQAAAAGAEKFDVVEALRTLATLADRLRQSETELPKERKS
Ga0318504_1054683013300032063SoilAAGAEKFDVVEALRTLATLADRLRQSETELPKERKS
Ga0307472_10223115113300032205Hardwood Forest SoilAAAMTAPAPPSSEKFDLVEALRTLATLADRLRQSEQQDLPKERKL
Ga0335080_1144904623300032828SoilMPAAPPAAESKFDLVEALRTLATLADKLRESERQELPKERKL
Ga0335083_1042963413300032954SoilAGAMMPAPSPSPEKFDLVEALRTLATLADRLRESERQELPKEGKL
Ga0326727_1011838013300033405Peat SoilPPSSEKFDLVEALRTLATLADRLRQSEEQDLPKERKL
Ga0371490_106030513300033561Peat SoilPPSSEKFDLVEALRTLATLADRLRQSEQQDLPKERKL
Ga0370483_0036479_1377_15023300034124Untreated Peat SoilMMAPVPSSEKFDLVEALRTLATLADRLRQSEQQDLPKERKL
Ga0370514_140040_1_1203300034199Untreated Peat SoilAPVPSSEKFDLVEALRTLATLADRLRQSEQHDLPKEGKL

 ⦗Top⦘


Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.