


| Basic Information | |
|---|---|
| Family ID | F082170 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 113 |
| Average Sequence Length | 43 residues |
| Representative Sequence | MLIALGHKSQIQAQQLRRAEDRKAFDYIFLFEPFEALLTRGQAS |
| Number of Associated Samples | 104 |
| Number of Associated Scaffolds | 113 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 75.22 % |
| % of genes near scaffold ends (potentially truncated) | 34.51 % |
| % of genes from short scaffolds (< 2000 bps) | 80.53 % |
| Associated GOLD sequencing projects | 96 |
| AlphaFold2 3D model prediction | No |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (80.531 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Aquatic → Marine → Intertidal Zone → Estuary → Estuarine (29.203 % of family members) |
| Environment Ontology (ENVO) | Unclassified (47.788 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Water (non-saline) (56.637 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 72.73% β-sheet: 0.00% Coil/Unstructured: 27.27% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 113 Family Scaffolds |
|---|---|---|
| PF01245 | Ribosomal_L19 | 39.82 |
| PF01746 | tRNA_m1G_MT | 36.28 |
| PF05239 | PRC | 8.85 |
| PF00271 | Helicase_C | 5.31 |
| PF00886 | Ribosomal_S16 | 2.65 |
| PF13420 | Acetyltransf_4 | 1.77 |
| PF00929 | RNase_T | 0.88 |
| PF01435 | Peptidase_M48 | 0.88 |
| PF01288 | HPPK | 0.88 |
| PF13371 | TPR_9 | 0.88 |
| PF03186 | CobD_Cbib | 0.88 |
| COG ID | Name | Functional Category | % Frequency in 113 Family Scaffolds |
|---|---|---|---|
| COG0335 | Ribosomal protein L19 | Translation, ribosomal structure and biogenesis [J] | 39.82 |
| COG0228 | Ribosomal protein S16 | Translation, ribosomal structure and biogenesis [J] | 2.65 |
| COG0801 | 7,8-dihydro-6-hydroxymethylpterin pyrophosphokinase (folate biosynthesis) | Coenzyme transport and metabolism [H] | 0.88 |
| COG1270 | Cobalamin biosynthesis protein CobD/CbiB | Coenzyme transport and metabolism [H] | 0.88 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 80.53 % |
| Unclassified | root | N/A | 19.47 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 2199352005|2200032119 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales | 724 | Open in IMG/M |
| 2236876004|none_p0156120 | Not Available | 521 | Open in IMG/M |
| 3300002139|M3t2BS2_1869080 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 804 | Open in IMG/M |
| 3300002447|JGI24768J34885_10005401 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Comamonadaceae | 4191 | Open in IMG/M |
| 3300002835|B570J40625_100003771 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Comamonadaceae | 28428 | Open in IMG/M |
| 3300003388|JGI25910J50241_10078547 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Comamonadaceae | 948 | Open in IMG/M |
| 3300003394|JGI25907J50239_1016259 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Comamonadaceae | 1690 | Open in IMG/M |
| 3300003395|JGI25917J50250_1000110 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Comamonadaceae | 19942 | Open in IMG/M |
| 3300003404|JGI25920J50251_10115243 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 606 | Open in IMG/M |
| 3300003411|JGI25911J50253_10043919 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Comamonadaceae | 1562 | Open in IMG/M |
| 3300003413|JGI25922J50271_10017626 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Comamonadaceae | 1843 | Open in IMG/M |
| 3300003413|JGI25922J50271_10022446 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Comamonadaceae | 1575 | Open in IMG/M |
| 3300003430|JGI25921J50272_10013285 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Comamonadaceae | 2368 | Open in IMG/M |
| 3300003488|JGI25919J51413_1015535 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 591 | Open in IMG/M |
| 3300003490|JGI25926J51410_1001355 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Comamonadaceae → Limnohabitans → unclassified Limnohabitans → Limnohabitans sp. Rim28 | 4726 | Open in IMG/M |
| 3300003493|JGI25923J51411_1002288 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Comamonadaceae | 4072 | Open in IMG/M |
| 3300003497|JGI25925J51416_10003058 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Comamonadaceae → Acidovorax | 4758 | Open in IMG/M |
| 3300003497|JGI25925J51416_10050932 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Comamonadaceae | 1096 | Open in IMG/M |
| 3300003616|JGI25928J51866_1027850 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Comamonadaceae | 1501 | Open in IMG/M |
| 3300004765|Ga0007745_1040519 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Comamonadaceae | 1528 | Open in IMG/M |
| 3300004766|Ga0007747_1000627 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 576 | Open in IMG/M |
| 3300004787|Ga0007755_1036281 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Comamonadaceae | 738 | Open in IMG/M |
| 3300004788|Ga0007742_10083570 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Comamonadaceae | 654 | Open in IMG/M |
| 3300004790|Ga0007758_10162305 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Comamonadaceae | 599 | Open in IMG/M |
| 3300004790|Ga0007758_10162864 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Comamonadaceae | 599 | Open in IMG/M |
| 3300005517|Ga0070374_10471537 | Not Available | 628 | Open in IMG/M |
| 3300005582|Ga0049080_10262699 | Not Available | 561 | Open in IMG/M |
| 3300005941|Ga0070743_10073053 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Comamonadaceae → Acidovorax | 1159 | Open in IMG/M |
| 3300007543|Ga0102853_1032244 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 887 | Open in IMG/M |
| 3300007554|Ga0102820_1058300 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 933 | Open in IMG/M |
| 3300007560|Ga0102913_1054328 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Comamonadaceae | 1306 | Open in IMG/M |
| 3300007597|Ga0102919_1148425 | Not Available | 737 | Open in IMG/M |
| 3300007606|Ga0102923_1051763 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Comamonadaceae | 1288 | Open in IMG/M |
| 3300007606|Ga0102923_1061260 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Comamonadaceae | 1182 | Open in IMG/M |
| 3300007606|Ga0102923_1249225 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 549 | Open in IMG/M |
| 3300007621|Ga0102872_1007658 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Comamonadaceae | 2906 | Open in IMG/M |
| 3300007621|Ga0102872_1185136 | Not Available | 549 | Open in IMG/M |
| 3300007624|Ga0102878_1126950 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 747 | Open in IMG/M |
| 3300007639|Ga0102865_1021066 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Comamonadaceae | 1865 | Open in IMG/M |
| 3300007644|Ga0102902_1224143 | Not Available | 553 | Open in IMG/M |
| 3300007647|Ga0102855_1017445 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Comamonadaceae | 1984 | Open in IMG/M |
| 3300007651|Ga0102900_1082601 | Not Available | 689 | Open in IMG/M |
| 3300007667|Ga0102910_1004108 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Comamonadaceae | 3358 | Open in IMG/M |
| 3300007716|Ga0102867_1094071 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 797 | Open in IMG/M |
| 3300007718|Ga0102852_1012512 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1505 | Open in IMG/M |
| 3300007862|Ga0105737_1028266 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Comamonadaceae | 1316 | Open in IMG/M |
| 3300007863|Ga0105744_1088922 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Comamonadaceae | 762 | Open in IMG/M |
| 3300007962|Ga0102907_1038208 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Comamonadaceae → Acidovorax | 1324 | Open in IMG/M |
| 3300007973|Ga0105746_1134156 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Comamonadaceae | 828 | Open in IMG/M |
| 3300007992|Ga0105748_10201879 | Not Available | 826 | Open in IMG/M |
| 3300008052|Ga0102893_1019052 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Comamonadaceae | 2110 | Open in IMG/M |
| 3300008108|Ga0114341_10488825 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 560 | Open in IMG/M |
| 3300008111|Ga0114344_1018607 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Comamonadaceae | 3515 | Open in IMG/M |
| 3300008119|Ga0114354_1261158 | Not Available | 548 | Open in IMG/M |
| 3300008996|Ga0102831_1180050 | Not Available | 700 | Open in IMG/M |
| 3300009051|Ga0102864_1045215 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Comamonadaceae | 1189 | Open in IMG/M |
| 3300009059|Ga0102830_1012008 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 2788 | Open in IMG/M |
| 3300009080|Ga0102815_10025170 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Comamonadaceae | 3293 | Open in IMG/M |
| 3300009080|Ga0102815_10670240 | Not Available | 585 | Open in IMG/M |
| 3300009141|Ga0102884_1049568 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales | 1048 | Open in IMG/M |
| 3300009151|Ga0114962_10424197 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales | 715 | Open in IMG/M |
| 3300009152|Ga0114980_10037155 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Comamonadaceae | 2991 | Open in IMG/M |
| 3300009152|Ga0114980_10211252 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1140 | Open in IMG/M |
| 3300009158|Ga0114977_10095172 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Comamonadaceae | 1811 | Open in IMG/M |
| 3300009160|Ga0114981_10182642 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Comamonadaceae | 1153 | Open in IMG/M |
| 3300009183|Ga0114974_10104288 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Comamonadaceae | 1820 | Open in IMG/M |
| 3300009184|Ga0114976_10671971 | Not Available | 521 | Open in IMG/M |
| 3300009435|Ga0115546_1190247 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 713 | Open in IMG/M |
| 3300011009|Ga0129318_10185117 | Not Available | 655 | Open in IMG/M |
| 3300012744|Ga0157534_144433 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 641 | Open in IMG/M |
| 3300012751|Ga0138277_1081412 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 903 | Open in IMG/M |
| 3300018790|Ga0187842_1173395 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 635 | Open in IMG/M |
| 3300020159|Ga0211734_10061188 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Comamonadaceae | 914 | Open in IMG/M |
| 3300020161|Ga0211726_10681833 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Comamonadaceae | 1207 | Open in IMG/M |
| 3300020172|Ga0211729_10924740 | Not Available | 797 | Open in IMG/M |
| 3300020501|Ga0208590_1010488 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Comamonadaceae | 1152 | Open in IMG/M |
| 3300020523|Ga0208226_1046350 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 540 | Open in IMG/M |
| 3300020574|Ga0208221_1038327 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Comamonadaceae | 913 | Open in IMG/M |
| 3300021282|Ga0210303_1034480 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 649 | Open in IMG/M |
| 3300021312|Ga0210306_1164520 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Comamonadaceae → Acidovorax | 2229 | Open in IMG/M |
| 3300021519|Ga0194048_10272075 | Not Available | 614 | Open in IMG/M |
| 3300021962|Ga0222713_10065584 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Comamonadaceae | 2706 | Open in IMG/M |
| 3300021962|Ga0222713_10244162 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Comamonadaceae | 1174 | Open in IMG/M |
| 3300023174|Ga0214921_10013001 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Comamonadaceae | 9845 | Open in IMG/M |
| 3300023184|Ga0214919_10682078 | Not Available | 586 | Open in IMG/M |
| 3300024343|Ga0244777_10464935 | Not Available | 781 | Open in IMG/M |
| 3300024480|Ga0255223_1039342 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Comamonadaceae | 798 | Open in IMG/M |
| 3300024549|Ga0256308_1089846 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales | 647 | Open in IMG/M |
| 3300024558|Ga0255232_1103551 | Not Available | 589 | Open in IMG/M |
| 3300024567|Ga0256307_1096445 | Not Available | 688 | Open in IMG/M |
| 3300027152|Ga0255100_1022893 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1375 | Open in IMG/M |
| 3300027235|Ga0208804_1000537 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Comamonadaceae | 5970 | Open in IMG/M |
| 3300027259|Ga0208178_1013082 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1538 | Open in IMG/M |
| 3300027278|Ga0208439_1095175 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 535 | Open in IMG/M |
| 3300027281|Ga0208440_1024706 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1399 | Open in IMG/M |
| 3300027538|Ga0255085_1047936 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Comamonadaceae | 937 | Open in IMG/M |
| 3300027563|Ga0209552_1015011 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Comamonadaceae | 2352 | Open in IMG/M |
| 3300027571|Ga0208897_1108355 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Comamonadaceae | 704 | Open in IMG/M |
| 3300027593|Ga0255118_1005949 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Comamonadaceae | 2592 | Open in IMG/M |
| 3300027598|Ga0255121_1071802 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales | 660 | Open in IMG/M |
| 3300027608|Ga0208974_1005534 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Comamonadaceae | 4335 | Open in IMG/M |
| 3300027733|Ga0209297_1221307 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 740 | Open in IMG/M |
| 3300027734|Ga0209087_1131048 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Comamonadaceae | 1027 | Open in IMG/M |
| 3300027757|Ga0208671_10117504 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 973 | Open in IMG/M |
| 3300027798|Ga0209353_10092357 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Comamonadaceae | 1369 | Open in IMG/M |
| 3300027808|Ga0209354_10233397 | Not Available | 741 | Open in IMG/M |
| 3300027969|Ga0209191_1038912 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales | 2234 | Open in IMG/M |
| 3300027973|Ga0209298_10167266 | Not Available | 916 | Open in IMG/M |
| 3300028393|Ga0304728_1053523 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Comamonadaceae | 1663 | Open in IMG/M |
| 3300031758|Ga0315907_10383445 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Comamonadaceae | 1136 | Open in IMG/M |
| 3300032092|Ga0315905_10853494 | Not Available | 785 | Open in IMG/M |
| 3300032116|Ga0315903_10512912 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Comamonadaceae | 943 | Open in IMG/M |
| 3300034107|Ga0335037_0067901 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Comamonadaceae | 1926 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Estuarine | Environmental → Aquatic → Marine → Intertidal Zone → Estuary → Estuarine | 29.20% |
| Freshwater Lake | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lake | 21.24% |
| Freshwater Lake | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake | 11.50% |
| Freshwater | Environmental → Aquatic → Freshwater → River → Unclassified → Freshwater | 7.08% |
| Freshwater | Environmental → Aquatic → Freshwater → Lentic → Epilimnion → Freshwater | 4.42% |
| Freshwater | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater | 3.54% |
| Freshwater | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater | 3.54% |
| Estuary Water | Environmental → Aquatic → Marine → Coastal → Unclassified → Estuary Water | 3.54% |
| Freshwater, Plankton | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater, Plankton | 2.65% |
| Freshwater | Environmental → Aquatic → Freshwater → Unclassified → Unclassified → Freshwater | 2.65% |
| Freshwater Lentic | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lentic | 1.77% |
| Estuarine | Environmental → Aquatic → Marine → Unclassified → Unclassified → Estuarine | 1.77% |
| Estuarine Water | Environmental → Aquatic → Marine → Unclassified → Unclassified → Estuarine Water | 1.77% |
| Freshwater And Sediment | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater And Sediment | 0.89% |
| Anoxic Zone Freshwater | Environmental → Aquatic → Freshwater → Lake → Unclassified → Anoxic Zone Freshwater | 0.89% |
| Freshwater To Marine Saline Gradient | Environmental → Aquatic → Marine → Coastal → Unclassified → Freshwater To Marine Saline Gradient | 0.89% |
| Marine Estuarine | Environmental → Aquatic → Marine → Intertidal Zone → Estuary → Marine Estuarine | 0.89% |
| Pelagic Marine | Environmental → Aquatic → Marine → Pelagic → Unclassified → Pelagic Marine | 0.89% |
| Marine | Environmental → Aquatic → Unclassified → Unclassified → Unclassified → Marine | 0.89% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 2199352005 | Freshwater microbial communities from Lake Mendota, WI - Practice 29OCT2010 epilimnion | Environmental | Open in IMG/M |
| 2236876004 | Estuarine microbial communities from Columbia River, sample from South Channel ETM site, GS313-0p1-ETM-15m | Environmental | Open in IMG/M |
| 3300002139 | M3t2BS2 (117f) | Environmental | Open in IMG/M |
| 3300002447 | Freshwater and sediment microbial communities from Lake Ontario - Sta 18 epilimnion Metagenome | Environmental | Open in IMG/M |
| 3300002835 | Freshwater microbial communities from Lake Mendota, WI - (Lake Mendota Combined Ray assembly, ASSEMBLY_DATE=20140605) | Environmental | Open in IMG/M |
| 3300003388 | Freshwater lake microbial communities from Lake Michigan, USA - Sp13.BD.MM110.SN | Environmental | Open in IMG/M |
| 3300003394 | Freshwater lake microbial communities from Lake Michigan, USA - Sp13.BD.MM15.SN | Environmental | Open in IMG/M |
| 3300003395 | Freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MM110.SN | Environmental | Open in IMG/M |
| 3300003404 | Freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MM110.DCMD | Environmental | Open in IMG/M |
| 3300003411 | Freshwater lake microbial communities from Lake Michigan, USA - Sp13.BD.MM110.SD | Environmental | Open in IMG/M |
| 3300003413 | Freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MLB.DD | Environmental | Open in IMG/M |
| 3300003430 | Freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MLB.SD | Environmental | Open in IMG/M |
| 3300003488 | Freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MM110.DN | Environmental | Open in IMG/M |
| 3300003490 | Freshwater lake microbial communities from Lake Michigan, USA - Fa13.BD.MM110.SN | Environmental | Open in IMG/M |
| 3300003493 | Freshwater lake microbial communities from Lake Michigan, USA - Fa13.BD.MM15.SN | Environmental | Open in IMG/M |
| 3300003497 | Freshwater lake microbial communities from Lake Michigan, USA - Fa13.BD.MM15.DN | Environmental | Open in IMG/M |
| 3300003616 | Freshwater lake microbial communities from Lake Michigan, USA - Fa13.BD.MM110.DN | Environmental | Open in IMG/M |
| 3300004765 | Metatranscriptome of freshwater lake microbial communities from Lake Michigan, USA - Sp13.BD.MM110.SD (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300004766 | Metatranscriptome of freshwater lake microbial communities from Lake Michigan, USA - Sp13.BD.MLB.SN (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300004787 | Metatranscriptome of freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MLB.SD (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300004788 | Metatranscriptome of freshwater lake microbial communities from Lake Michigan, USA - Sp13.BD.MM15.SD (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300004790 | Metatranscriptome of freshwater lake microbial communities from Lake Michigan, USA - Fa13.BD.MM15.SD (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300005517 | Freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MM15.SN (version 4) | Environmental | Open in IMG/M |
| 3300005582 | Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG ER15MSRF | Environmental | Open in IMG/M |
| 3300005941 | Estuarine microbial communities from the Columbia River estuary, USA - metaG S.697 | Environmental | Open in IMG/M |
| 3300007543 | Estuarine microbial communities from the Columbia River estuary - metaG 1370B-3 | Environmental | Open in IMG/M |
| 3300007554 | Estuarine microbial communities from the Columbia River estuary - Ebb tide non-ETM metaG S.709 | Environmental | Open in IMG/M |
| 3300007560 | Estuarine microbial communities from the Columbia River estuary - metaG 1560A-02 | Environmental | Open in IMG/M |
| 3300007597 | Estuarine microbial communities from the Columbia River estuary - metaG 1563A-02 | Environmental | Open in IMG/M |
| 3300007606 | Estuarine microbial communities from the Columbia River estuary - metaG 1569-02 | Environmental | Open in IMG/M |
| 3300007621 | Estuarine microbial communities from the Columbia River estuary - metaG 1547A-3 | Environmental | Open in IMG/M |
| 3300007624 | Estuarine microbial communities from the Columbia River estuary - metaG 1548A-02 | Environmental | Open in IMG/M |
| 3300007639 | Estuarine microbial communities from the Columbia River estuary - metaG 1449C-02 | Environmental | Open in IMG/M |
| 3300007644 | Estuarine microbial communities from the Columbia River estuary - metaG 1555B-02 | Environmental | Open in IMG/M |
| 3300007647 | Estuarine microbial communities from the Columbia River estuary - metaG 1370B-02 | Environmental | Open in IMG/M |
| 3300007651 | Estuarine microbial communities from the Columbia River estuary - metaG 1555C-3 | Environmental | Open in IMG/M |
| 3300007667 | Estuarine microbial communities from the Columbia River estuary - metaG 1558A-3 | Environmental | Open in IMG/M |
| 3300007716 | Estuarine microbial communities from the Columbia River estuary - metaG 1546B-3 | Environmental | Open in IMG/M |
| 3300007718 | Estuarine microbial communities from the Columbia River estuary - metaG 1370A-3 | Environmental | Open in IMG/M |
| 3300007862 | Coastal water column microbial communities from Columbia River Estuary, Oregon, USA - CMOP_DNA_1373A_0.2um | Environmental | Open in IMG/M |
| 3300007863 | Coastal water column microbial communities from Columbia River Estuary, Oregon, USA - CMOP_DNA_1459B_0.2um | Environmental | Open in IMG/M |
| 3300007962 | Estuarine microbial communities from the Columbia River estuary - metaG 1556B-02 | Environmental | Open in IMG/M |
| 3300007973 | Coastal water column microbial communities from Columbia River Estuary, Oregon, USA - CMOP_DNA_1460A_0.2um | Environmental | Open in IMG/M |
| 3300007992 | Coastal water column microbial communities from Columbia River Estuary, Oregon, USA - CMOP_DNA_1461AB_0.2um | Environmental | Open in IMG/M |
| 3300008052 | Estuarine microbial communities from the Columbia River estuary - metaG 1553A-02 | Environmental | Open in IMG/M |
| 3300008108 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE12, Sample E2014-0048-C-NA | Environmental | Open in IMG/M |
| 3300008111 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE4, Sample E2014-0050-C-NA | Environmental | Open in IMG/M |
| 3300008119 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE4, Sample E2014-0110-C-NA | Environmental | Open in IMG/M |
| 3300008996 | Estuarine microbial communities from the Columbia River estuary - Freshwater metaG S.747 | Environmental | Open in IMG/M |
| 3300009051 | Estuarine microbial communities from the Columbia River estuary - metaG 1449B-02 | Environmental | Open in IMG/M |
| 3300009059 | Estuarine microbial communities from the Columbia River estuary - Freshwater metaG S.703 | Environmental | Open in IMG/M |
| 3300009080 | Estuarine microbial communities from the Columbia River estuary - Ebb tide ETM metaG S.759 | Environmental | Open in IMG/M |
| 3300009141 | Estuarine microbial communities from the Columbia River estuary - metaG 1550A-3 | Environmental | Open in IMG/M |
| 3300009151 | Freshwater microbial communities from Lake Croche, Canada to study carbon cycling - C_130820_MF_MetaG | Environmental | Open in IMG/M |
| 3300009152 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_140806_EF_MetaG | Environmental | Open in IMG/M |
| 3300009158 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130805_MF_MetaG | Environmental | Open in IMG/M |
| 3300009160 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_140806_MF_MetaG | Environmental | Open in IMG/M |
| 3300009183 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130206_EF_MetaG | Environmental | Open in IMG/M |
| 3300009184 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130805_EF_MetaG | Environmental | Open in IMG/M |
| 3300009435 | Pelagic marine microbial communities from North Sea - COGITO_mtgs_100413 | Environmental | Open in IMG/M |
| 3300011009 | Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Spr_0.1_0.8_DNA | Environmental | Open in IMG/M |
| 3300012744 | Oligotrophic lake water microbial communities from Sparkling Lake, Wisconsin, USA - GEODES020 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300012751 | Freshwater microbial communities from Lake Montjoie, Canada - M_130821_E_mt (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300018790 | Oligotrophic lake water microbial communities from Sparkling Lake, Wisconsin, USA - SP09_SKY_41 | Environmental | Open in IMG/M |
| 3300020159 | Freshwater lake microbial communities from Lake Erken, Sweden - P4710_108 megahit1 | Environmental | Open in IMG/M |
| 3300020161 | Freshwater lake microbial communities from Lake Erken, Sweden - P4710_101 megahit1 | Environmental | Open in IMG/M |
| 3300020172 | Freshwater lake microbial communities from Lake Erken, Sweden - P4710_102 megahit1 | Environmental | Open in IMG/M |
| 3300020501 | Freshwater microbial communities from Lake Mendota, WI - 27SEP2009 deep hole epilimnion (SPAdes) | Environmental | Open in IMG/M |
| 3300020523 | Freshwater microbial communities from Lake Mendota, WI - 18MAY2011 deep hole epilimnion ns (SPAdes) | Environmental | Open in IMG/M |
| 3300020574 | Freshwater microbial communities from Lake Mendota, WI - 26JUN2009 deep hole epilimnion (SPAdes) | Environmental | Open in IMG/M |
| 3300021282 | Metatranscriptome of estuarine water microbial communities from the Columbia River estuary, Oregon, United States ? R1035 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300021312 | Metatranscriptome of estuarine water microbial communities from the Columbia River estuary, Oregon, United States ? R1072 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300021519 | Anoxic zone freshwater microbial communities from boreal shield lake in IISD Experimental Lakes Area, Ontario, Canada - Jun2016-L222-5m | Environmental | Open in IMG/M |
| 3300021962 | Estuarine water microbial communities from San Francisco Bay, California, United States - C33_649D | Environmental | Open in IMG/M |
| 3300023174 | Freshwater microbial communities from Lake Lanier, Atlanta, Georgia, United States - LL-1505 | Environmental | Open in IMG/M |
| 3300023184 | Freshwater microbial communities from Lake Lanier, Atlanta, Georgia, United States - LL-1503 | Environmental | Open in IMG/M |
| 3300024343 | Combined assembly of estuarine microbial communities from Columbia River, Washington, USA >3um size fraction | Environmental | Open in IMG/M |
| 3300024480 | Metatranscriptome of freshwater microbial communities from Columbia River, Oregon, United States - Colum_Cont_RepC_0h (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300024549 | Metatranscriptome of freshwater microbial communities from Columbia River, Oregon, United States - Colum_Atlam_RepC_8d (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300024558 | Metatranscriptome of freshwater microbial communities from Columbia River, Oregon, United States - Colum_Atlam_RepC_8h (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300024567 | Metatranscriptome of freshwater microbial communities from Columbia River, Oregon, United States - Colum_Atlam_RepA_8d (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300027152 | Freshwater microbial communities from Columbia River, Oregon, United States - Colum_Colum_RepB_8d | Environmental | Open in IMG/M |
| 3300027235 | Estuarine microbial communities from the Columbia River estuary - metaG 1553A-3 (SPAdes) | Environmental | Open in IMG/M |
| 3300027259 | Estuarine microbial communities from the Columbia River estuary - metaG 1568A-3 (SPAdes) | Environmental | Open in IMG/M |
| 3300027278 | Estuarine microbial communities from the Columbia River estuary - Freshwater metaG S.703 (SPAdes) | Environmental | Open in IMG/M |
| 3300027281 | Estuarine microbial communities from the Columbia River estuary - metaG 1547B-02 (SPAdes) | Environmental | Open in IMG/M |
| 3300027538 | Freshwater microbial communities from Columbia River, Oregon, United States - Colum_Cont_RepB_8d | Environmental | Open in IMG/M |
| 3300027563 | Freshwater lake microbial communities from Lake Michigan, USA - Fa13.BD.MM15.SD (SPAdes) | Environmental | Open in IMG/M |
| 3300027571 | Estuarine microbial communities from the Columbia River estuary, USA - metaG S.697 (SPAdes) | Environmental | Open in IMG/M |
| 3300027593 | Freshwater microbial communities from St. Lawrence River, New York, United States - Law_Atlam_RepB_8h | Environmental | Open in IMG/M |
| 3300027598 | Freshwater microbial communities from St. Lawrence River, New York, United States - Law_Colum_RepB_8h | Environmental | Open in IMG/M |
| 3300027608 | Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG ER15MSRF (SPAdes) | Environmental | Open in IMG/M |
| 3300027733 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130805_MF_MetaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027734 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130805_EF_MetaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027757 | Estuarine microbial communities from the Columbia River estuary - Ebb tide ETM metaG S.759 (SPAdes) | Environmental | Open in IMG/M |
| 3300027798 | Freshwater lake microbial communities from Lake Michigan, USA - Sp13.BD.MM15.SD (SPAdes) | Environmental | Open in IMG/M |
| 3300027808 | Freshwater lake microbial communities from Lake Michigan, USA - Sp13.BD.MM15.DD (SPAdes) | Environmental | Open in IMG/M |
| 3300027969 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130626_EF_MetaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027973 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_140806_EF_MetaG (SPAdes) | Environmental | Open in IMG/M |
| 3300028393 | Freshwater microbial communities from Lake Croche, Canada to study carbon cycling - C_130625_MF_MetaG (v2) | Environmental | Open in IMG/M |
| 3300031758 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 12 MA123 | Environmental | Open in IMG/M |
| 3300032092 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 4 MA121 | Environmental | Open in IMG/M |
| 3300032116 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 2 MA119 | Environmental | Open in IMG/M |
| 3300034107 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME21Apr2017-rr0133 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| 2200241071 | 2199352005 | Freshwater | MLIAIGHKSQIQAQQLRRAEDRKAFDYIFLFEPFEAPLTRGQAS |
| none_01561202 | 2236876004 | Marine Estuarine | MLIALGHKSQIQAQQLRRAEDRKAFDYIFLFDPFEALLTRGQAS |
| M3t2BS2_18690801 | 3300002139 | Marine | MLIALGQKSQMQPQQLRRAEDRKAFDYIFLFGPFEAPLTRG |
| JGI24768J34885_100054013 | 3300002447 | Freshwater And Sediment | MLIALGHXSQIQTQXLRRAEDRKAFDYIFLFEPFEAPXTRGQAS* |
| B570J40625_1000037718 | 3300002835 | Freshwater | MLIAIGHKSQIQAQQLRRAEDRKAFDYIFLFEPFEAPLTRGQAS* |
| JGI25910J50241_100785472 | 3300003388 | Freshwater Lake | MLIALGHKSQIQAQQLRRAEDRKAFNYIFLFDPFEALLTRGQAS* |
| JGI25907J50239_10162592 | 3300003394 | Freshwater Lake | MLIALGHKSQIQTQRLRRAEDRKAFDYIFLFEPFEAPITRGQAS* |
| JGI25917J50250_100011019 | 3300003395 | Freshwater Lake | MLIALGHKSQIQAQQLRRAEDRKAFDYIFLFEPFEALLTRGQAS* |
| JGI25920J50251_101152432 | 3300003404 | Freshwater Lake | MLIAXGHKSQIQAQQLRRAEDRKAFXYIFLFGPFEAPPHS |
| JGI25911J50253_100439192 | 3300003411 | Freshwater Lake | MLIAIGHKSQIQAQQLRRAEDRKAFDYIFLFGPFEALLTRGQAS* |
| JGI25922J50271_100176263 | 3300003413 | Freshwater Lake | MLIALGHKSQIQTQRLRRAEDRKAFDYIFLFEPFEAPLTRGQAS* |
| JGI25922J50271_100224461 | 3300003413 | Freshwater Lake | MLIALGQKSQIQPQQLRRAEDRKAFDYIFLFEPFEALLTRGHAS* |
| JGI25921J50272_100132854 | 3300003430 | Freshwater Lake | MLIALGHKSXIQTQQLRRAEDRKAFDYIFLFEPFEAPXTRGQAS* |
| JGI25919J51413_10155352 | 3300003488 | Freshwater Lake | MLIALGHKSQIQTQRLRRAEDRKAFDYIFLFEPFEALLTRG |
| JGI25926J51410_10013555 | 3300003490 | Freshwater Lake | MLIALGHKSQIQAQQLRRAEDRKAFDYIFLFDPFEALLTRGQAS* |
| JGI25923J51411_10022888 | 3300003493 | Freshwater Lake | MLIALGHKSQIQAQQLRRAEDRKAFXYIFLFXPFEALLTRGQAX* |
| JGI25925J51416_100030586 | 3300003497 | Freshwater Lake | MLIALGHKSQIQAQQLRRAEDRKAFDYIFLFXPFEALLTRGQAX* |
| JGI25925J51416_100509321 | 3300003497 | Freshwater Lake | ATLKAASMLIALGHKSQIQTQRLRRAEDRKAFDYIFLFEPFEAPLTRGQAS* |
| JGI25928J51866_10278503 | 3300003616 | Freshwater Lake | LGHKSQIQAQQLRRAEDRKAFDYIFLFEPFEALLTRGQAS* |
| Ga0007745_10405191 | 3300004765 | Freshwater Lake | GHKSQIQAQQLRRAEDRKAFNYIFLFEPFEALLTRGQAS* |
| Ga0007747_10006272 | 3300004766 | Freshwater Lake | MLIALGHKSQIQTQQLRRAEDRKAFDYIFLFEPFEAPLTRGQAS* |
| Ga0007755_10362812 | 3300004787 | Freshwater Lake | MLIALGHKSQIQTQQLRRAEDRKAFDYIFLFEPFEAPITRGQAS* |
| Ga0007742_100835702 | 3300004788 | Freshwater Lake | MLIALGHKSQIQPQQLRRAEDRKAFDYIFLFEPFEALLTRGQAS* |
| Ga0007758_101623052 | 3300004790 | Freshwater Lake | MLIALGHKSQIQAQQLRRAEDRKAFNYIFLFEPFEALLTRGQAS* |
| Ga0007758_101628642 | 3300004790 | Freshwater Lake | MLIALGHKSQIQAQQLRRAEDRKDFDYIFLFEPFEALLTRGQAS* |
| Ga0070374_104715372 | 3300005517 | Freshwater Lake | SMLISLRQESQVQPQQLRRAEDRKAFDYIFIYEPFGALLT* |
| Ga0049080_102626991 | 3300005582 | Freshwater Lentic | HNATLKAVSMLIAIGHKSQIQAQQLRRAEDRKALDYIFLFEPFEAPLTRGQAS* |
| Ga0070743_100730532 | 3300005941 | Estuarine | MLIALGHKSQIQTQQLRRAEDRKAFDYIFLFEPFEALLTRGQAS* |
| Ga0102853_10322441 | 3300007543 | Estuarine | MLIALGHKSQIQAQQLRRAEDRKAFDYIFLFEPFEALLTRGHAS* |
| Ga0102820_10583002 | 3300007554 | Estuarine | MLIAIGHKSQIQAQQLRRAEDRKAFDYIFLFEPFEALLTRGQAS* |
| Ga0102913_10543283 | 3300007560 | Estuarine | MLIALGQKSQIQAQQLRRAEDRKAFDYIFLFEPFEALLTRGQAS* |
| Ga0102919_11484252 | 3300007597 | Estuarine | SMLIALGHKSQIQAQQLRRAEDRKAFDYIFLFEPFEAPIARGQAS* |
| Ga0102923_10517633 | 3300007606 | Estuarine | ALGHKSQIQAQQLRRAEDRKAFDYIFLFEPFEALLTRGQAS* |
| Ga0102923_10612602 | 3300007606 | Estuarine | MLIALGRKSQIQPQQLRRAEDRKAFDYSFLFEPLTALVTRGQAS* |
| Ga0102923_12492251 | 3300007606 | Estuarine | MLIALGHKSQIQAQQLRRAEDRKAFDYIFLFEPFEALLTRGQA |
| Ga0102872_10076581 | 3300007621 | Estuarine | MLIALGHKSQIQAQQLRRAEDRKAFNYIFLFEPFEALLTR |
| Ga0102872_11851361 | 3300007621 | Estuarine | ALGHKSQIQAQQLRRAEDRKAFDYIFLFEPFEALIAQGQAS* |
| Ga0102878_11269503 | 3300007624 | Estuarine | MLVALGLKSQIQPQQLRRAEDRKAFDYIFLFEPFEALLTR |
| Ga0102865_10210663 | 3300007639 | Estuarine | MLIALGQKSQIQAQQLRRAEDRKAFDYIFLFEPFEALLTRG |
| Ga0102902_12241432 | 3300007644 | Estuarine | LGRKSQIQPQQLRRAEDRKAFDYIFLLEPLTALVTRGQAT* |
| Ga0102855_10174451 | 3300007647 | Estuarine | SQIQAQQLRRAEDRKAFDYIFLFEPFEALLTRGQAS* |
| Ga0102900_10826012 | 3300007651 | Estuarine | MLIALGHKSQIQTQRLRRAEDRKAFDYIFLFEPFEAPLTLGQAS* |
| Ga0102910_10041082 | 3300007667 | Estuarine | MLVALGHKSQIQAQQLRRAEDRKAFNYIFVLEPFEALLTRGQAS* |
| Ga0102867_10940713 | 3300007716 | Estuarine | MLVALGHKSQIQAQQLRRAEDRKAFDYIFLFEPFEALLTR |
| Ga0102852_10125122 | 3300007718 | Estuarine | MLIALGHKSQAQPQQLRRAEDRKAFDYIFLFQPFEALLTRGQAS* |
| Ga0105737_10282663 | 3300007862 | Estuary Water | IALGRKSQIQPQQLRRAEDRKAFDYIFLFEPFEALLTRGQAS* |
| Ga0105744_10889222 | 3300007863 | Estuary Water | MLIALGHKSQIQAQQLRRAEDRKSFDYIFLFGPFEAPLTRGQAS* |
| Ga0102907_10382082 | 3300007962 | Estuarine | MLIALGHKSQIQPQQLRRAEARKAIDYIFLFEPFEALLTRGQAS* |
| Ga0105746_11341562 | 3300007973 | Estuary Water | MLVALGHKSQIQAQQLRRAEDRKAFDYIFLFEPFEALLTRGQAS* |
| Ga0105748_102018791 | 3300007992 | Estuary Water | ILHNATLKAASMLIALGHKSQIQTQQLRRAEDRKAFDYIFLFEPFEAPITRGQAS* |
| Ga0102893_10190524 | 3300008052 | Estuarine | MLVALGQKSQIQAQQLRRAEDRKAFDYIFLFEPFEALLTRGQAS* |
| Ga0114341_104888252 | 3300008108 | Freshwater, Plankton | MLIALGHKSQAQPQQLRRAEDRKAFDYIFLFQPFEALTT* |
| Ga0114344_10186073 | 3300008111 | Freshwater, Plankton | MLIALGHKSQAQPQQLRRAEDRKAFDYIFLFEPFEAPLTRGQAS* |
| Ga0114354_12611581 | 3300008119 | Freshwater, Plankton | TLKAVSMLIAIGHKSQIQAQQLRRAEDRKAFDYIFLFEPFEAPLTRGQAS* |
| Ga0102831_11800501 | 3300008996 | Estuarine | IQTQQLRRAEDRKAFDCIFLFEPFEAPIARGQAS* |
| Ga0102864_10452152 | 3300009051 | Estuarine | MLIALGHKSQIQAQQLRRAEDRKAFDYIFIFEPFGALLT* |
| Ga0102830_10120082 | 3300009059 | Estuarine | MLIALGQKSQIQPQQLRRAEDRKAFDYIFLFEPFEALLTRGQAS* |
| Ga0102815_100251702 | 3300009080 | Estuarine | MLIALGHKSQIQAQQLRRAEDRKAFDYIFLFEPFEAPITRGQAS* |
| Ga0102815_106702401 | 3300009080 | Estuarine | KSQIQAQQLRRAEDRKAFDYIFLFEPFEALLTRGQAS* |
| Ga0102884_10495683 | 3300009141 | Estuarine | MLIALGHKSQAQPQQLRRAEDRKAFDYIFLFEPFEALLTRGQAS* |
| Ga0114962_104241972 | 3300009151 | Freshwater Lake | MLIALGRKSQIQPQQLRRAEDRKAFDYSFLLEPFTALVTRGQAT* |
| Ga0114980_100371553 | 3300009152 | Freshwater Lake | MLVALGHKSQIQAQQLRRAEDRKAFDYIFLFEPFEALIT* |
| Ga0114980_102112522 | 3300009152 | Freshwater Lake | MLIALGRKSQIQPQQLRRAEDRKAFDYIFLLEPLTALVTRGQAT* |
| Ga0114977_100951722 | 3300009158 | Freshwater Lake | MLIALGHISQIQAQQLRRAEDRKAFDYIFLFEPFEALLTRGQAS* |
| Ga0114981_101826423 | 3300009160 | Freshwater Lake | MLIALGRKSQIQPQQLRRAEDRKAFDYIFLLEPFTALVTRGQAT* |
| Ga0114974_101042881 | 3300009183 | Freshwater Lake | KAVSMLIALGHKSQIQAQQLRRAEDRKAFDYIFLFEPFEALIT* |
| Ga0114976_106719712 | 3300009184 | Freshwater Lake | LKAVSMLIALGQKSQIQAQQLRRAEDRKAFDYIFLFEPFEALLTRGQAS* |
| Ga0115546_11902472 | 3300009435 | Pelagic Marine | MLIALGQKSQMQPQQLRRAEDRKAFDYIFLFEPFEALLTRGHAS* |
| Ga0129318_101851171 | 3300011009 | Freshwater To Marine Saline Gradient | MLISLRQESQVQSQQLRRAEDRKAFDYIFVLEPFEALLTRGQAS* |
| Ga0157534_1444332 | 3300012744 | Freshwater | MLIALGHKSQIQAQQLRRAEDRKAFDYIFLLEPFEALIT* |
| Ga0138277_10814122 | 3300012751 | Freshwater Lake | MLIALGHKSQIQAQQLRRAEDRKAFDYIFLFEPFEALIT* |
| Ga0187842_11733951 | 3300018790 | Freshwater | MLIALGHKSQIQAQQLRRAEDRKAFDYIFLFEPFEALLTRGQAS |
| Ga0211734_100611882 | 3300020159 | Freshwater | MLIALGHKSQIQTQQLRRAEDRKAFDYIFLFEPFEAPITRGQAS |
| Ga0211726_106818332 | 3300020161 | Freshwater | MLIALGQKSQIQPQQLRRAEDRKAFDYIFLFEPFEALLTRGHAS |
| Ga0211729_109247402 | 3300020172 | Freshwater | VSMLIALGHKSQDQPQQLRRAEDRKAFDYIFLFQPFEALTT |
| Ga0208590_10104881 | 3300020501 | Freshwater | MLIAIGHKSQIQAQQLRRAEDRKAFDYIFLFEPFEAPLTR |
| Ga0208226_10463502 | 3300020523 | Freshwater | MLIAIGHKSQIQAQQLRRAEDRKAFDYIFLFQPFEAL |
| Ga0208221_10383272 | 3300020574 | Freshwater | MLIAIGHKSQIQAQQLRRAEDRKAFDYIFLFEPFEAPITRGQAS |
| Ga0210303_10344802 | 3300021282 | Estuarine | MLIALGHKSQIQTQRLRRAEDRKAFDYIFLFEPFEALLTRGQAS |
| Ga0210306_11645204 | 3300021312 | Estuarine | MLIALGHKSQIQAQQLRRAEDRKAFDYIFLFEPFEALLTRGHAS |
| Ga0194048_102720752 | 3300021519 | Anoxic Zone Freshwater | IVHNATLKAASMLIALGRKSQIQPQQLRRAEDRKAFDYSFLLEPLTALVTRGQAT |
| Ga0222713_100655845 | 3300021962 | Estuarine Water | MLIALGHKSQIQTQRLRRAEDRKAFDYIFLFEPFEAPLTRGQAS |
| Ga0222713_102441622 | 3300021962 | Estuarine Water | MLVALGHKSQIQAQQLRRAEDRKAFDYIFLFEPFEALLTRGQAS |
| Ga0214921_100130019 | 3300023174 | Freshwater | MLIALGHISQIQAQQLRRAEDRKAFDYIFLFEPFEALIT |
| Ga0214919_106820781 | 3300023184 | Freshwater | HNATLKAASMLIALGRKSQIQPQQLRRAEDRKAFDYSFLLELLTALVSRGQAS |
| Ga0244777_104649352 | 3300024343 | Estuarine | ASMLISLRQESQVQSQQLRRAEDRKAFDYSFLFEPLTALVTRGQAS |
| Ga0255223_10393421 | 3300024480 | Freshwater | MLIALGHKSQIQAQQLRRAEDRKAFDYIFLFEPFE |
| Ga0256308_10898462 | 3300024549 | Freshwater | MLIALGHKSQIQPQQLRRAEDRKAFDYIFVLEPFEALLTL |
| Ga0255232_11035511 | 3300024558 | Freshwater | MLIALGHKSQIQTQQLRRAEDRKAFDYIFLFEPFEAPLTLGQAS |
| Ga0256307_10964451 | 3300024567 | Freshwater | NATLKAASMLIALGHKSQIQTQQLRRAEDRKAFDYIFLFEPFEAPIARGQAS |
| Ga0255100_10228932 | 3300027152 | Freshwater | MLIALGQKSQIQPQQLRRAEDRKAFDYIFLFEPFEAPLTLGQAS |
| Ga0208804_10005373 | 3300027235 | Estuarine | MLIAFGHKSQIQAQQLRRAEDRKAFDYIFLFEPFEALLTRGQAS |
| Ga0208178_10130822 | 3300027259 | Estuarine | MLIAFGHKSQIQAQQLRRAEDRKAFNYIFLFEPFEALLTRGQAS |
| Ga0208439_10951751 | 3300027278 | Estuarine | MLIALGQKSQIQPQQLRRAEDRKAFDYIFLFEPFEALLTRGQAS |
| Ga0208440_10247062 | 3300027281 | Estuarine | MLIALGHKSQIQAQQLRRAEDRKAFNYIFLFEPFEALLTRGQAS |
| Ga0255085_10479362 | 3300027538 | Freshwater | MLIALGHKSQIQTQQLRRAEDRKAFDYIFLFEPFEAPITLGQAS |
| Ga0209552_10150115 | 3300027563 | Freshwater Lake | MLIALGHKSQIQAQQLRRAEDRKAFNYIFLFDPFEALLTRGQAS |
| Ga0208897_11083552 | 3300027571 | Estuarine | MLIALGHKSQIQTQQLRRAEDRKAFDYIFLFEPFEVPLTRGQAS |
| Ga0255118_10059492 | 3300027593 | Freshwater | MLIALGHKSQIQAQQLRRAEDRKAFDYIFLFEPFEAPLTRGQAS |
| Ga0255121_10718022 | 3300027598 | Freshwater | MLIAIGHKSQIQAQQLRRAEDRKALDYIFLFEPFEAPLTRGQAS |
| Ga0208974_10055344 | 3300027608 | Freshwater Lentic | MLIAIGHKSQIQAQKLRRAEDRKAFDYIFLFGPFEAPLTRGQAS |
| Ga0209297_12213072 | 3300027733 | Freshwater Lake | MLIALGHISQIQAQQLRRAEDRKAFDYIFLLEPLTALVTRGQAT |
| Ga0209087_11310482 | 3300027734 | Freshwater Lake | MLIALGRKSQIQPQQLRRAEDRKAFDYIFLLEPLTALVTRGQAT |
| Ga0208671_101175041 | 3300027757 | Estuarine | MLIALGHKSQIQAQQLRRAEDRKAFDYIFLFEPFEAPITRGQAS |
| Ga0209353_100923573 | 3300027798 | Freshwater Lake | KAVSMLIAIGHKSQIQAQKLRRAEDRKAFDYIFLFGPFEAPLTRGQAS |
| Ga0209354_102333971 | 3300027808 | Freshwater Lake | NATLKAVSMLIAIGHKSQIQAQQLRRAEDRKALDYIFLFEPFEAPLTRGQAS |
| Ga0209191_10389123 | 3300027969 | Freshwater Lake | MLIALGHISQIQAQQLRRAEDRKAFDYIFLFEPFEALLTRGQAS |
| Ga0209298_101672662 | 3300027973 | Freshwater Lake | KAVSMLIALGHISQIQAQQLRRAEDRKAFDYIFLFEPFEALIT |
| Ga0304728_10535233 | 3300028393 | Freshwater Lake | MLIALGRKSQIQPQQLRRAEDRKAFDYSFLLEPFTALVTRGQAT |
| Ga0315907_103834452 | 3300031758 | Freshwater | MLIALGHKSQAQPQQLRRAEDRKAFDYIFLFQPFEALTT |
| Ga0315905_108534942 | 3300032092 | Freshwater | ATLKAVSMLIALGHKSQAQPQQLRRAEDRKAFDYIFLFQPFEALTT |
| Ga0315903_105129122 | 3300032116 | Freshwater | MLIALGHKSQIQTQQLRRAEDRKAFDYIFLFEPFEAPSP |
| Ga0335037_0067901_1716_1850 | 3300034107 | Freshwater | MLIALGQKSQIQPQQLRRAEDRKAFDYIFLFEPFEALLIRGQAS |
| ⦗Top⦘ |