NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome / Metatranscriptome Family F081750

Metagenome / Metatranscriptome Family F081750

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F081750
Family Type Metagenome / Metatranscriptome
Number of Sequences 114
Average Sequence Length 99 residues
Representative Sequence MGQKTDARIFRQGVNKKNXEFKHIEKNSEESSLFLYKTLEIQKYLNRFFGLYKIKIHNCKIFYSDNSLQIFISFYITTKTFSVIGKNITKYSKKC
Number of Associated Samples 100
Number of Associated Scaffolds 114

Quality Assessment
Transcriptomic Evidence Yes
Most common taxonomic group Eukaryota
% of genes with valid RBS motifs 7.69 %
% of genes near scaffold ends (potentially truncated) 76.32 %
% of genes from short scaffolds (< 2000 bps) 81.58 %
Associated GOLD sequencing projects 93
AlphaFold2 3D model prediction Yes
3D model pTM-score0.48

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Eukaryota (77.193 % of family members)
NCBI Taxonomy ID 2759
Taxonomy All Organisms → cellular organisms → Eukaryota

Most Common Ecosystem
GOLD Ecosystem Environmental → Aquatic → Marine → Unclassified → Unclassified → Marine
(32.456 % of family members)
Environment Ontology (ENVO) Unclassified
(55.263 % of family members)
Earth Microbiome Project Ontology (EMPO) Free-living → Saline → Water (saline)
(85.965 % of family members)


 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      

 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Globular Signal Peptide: No Secondary Structure distribution: α-helix: 46.34%    β-sheet: 13.82%    Coil/Unstructured: 39.84%
Feature Viewer
Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer
Per-residue confidence (pLDDT):
  0-50   51-70   71-90   91-100  		pTM-score: 0.48
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.

 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 114 Family Scaffolds
PF00203Ribosomal_S19 73.68
PF03947Ribosomal_L2_C 12.28
PF00189Ribosomal_S3_C 4.39
PF00384Molybdopterin 0.88
PF00137ATP-synt_C 0.88
PF00361Proton_antipo_M 0.88
PF00420Oxidored_q2 0.88
PF10588NADH-G_4Fe-4S_3 0.88
PF00302CAT 0.88
PF00252Ribosomal_L16 0.88

Neighboring Clusters of Orthologous Genes (COGs)

COG IDNameFunctional Category % Frequency in 114 Family Scaffolds
COG0185Ribosomal protein S19Translation, ribosomal structure and biogenesis [J] 73.68
COG0090Ribosomal protein L2Translation, ribosomal structure and biogenesis [J] 12.28
COG0092Ribosomal protein S3Translation, ribosomal structure and biogenesis [J] 4.39
COG0197Ribosomal protein L16/L10AETranslation, ribosomal structure and biogenesis [J] 0.88
COG0636FoF1-type ATP synthase, membrane subunit c/Archaeal/vacuolar-type H+-ATPase, subunit KEnergy production and conversion [C] 0.88
COG4845Chloramphenicol O-acetyltransferaseDefense mechanisms [V] 0.88

 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms91.23 %
UnclassifiedrootN/A8.77 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
3300000130|SA_S2_NOR15_50mDRAFT_c10153008All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Ochrophyta → Bacillariophyta → Coscinodiscophyceae → Thalassiosirophycidae → Thalassiosirales → Thalassiosiraceae → Thalassiosira → Thalassiosira pseudonana764Open in IMG/M
3300000133|SA_S1_NOR02_45mDRAFT_c1011922All Organisms → cellular organisms → Bacteria → Spirochaetes → Spirochaetia → Spirochaetales1052Open in IMG/M
3300003555|Ga0008453J51685_118443All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Ochrophyta → Bacillariophyta541Open in IMG/M
3300003683|Ga0008459J53047_1026034All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Ochrophyta → Bacillariophyta563Open in IMG/M
3300005805|Ga0079957_1017993All Organisms → cellular organisms → Bacteria → Proteobacteria5034Open in IMG/M
3300006165|Ga0075443_10000072All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Ochrophyta → Bacillariophyta38320Open in IMG/M
3300006355|Ga0075501_1238051All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Ochrophyta → Bacillariophyta → Coscinodiscophyceae → Thalassiosirophycidae → Thalassiosirales → Thalassiosiraceae → Thalassiosira → Thalassiosira pseudonana570Open in IMG/M
3300006373|Ga0075483_1200666All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Ochrophyta → Bacillariophyta → Coscinodiscophyceae → Thalassiosirophycidae → Thalassiosirales720Open in IMG/M
3300006378|Ga0075498_1370134All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Ochrophyta → Bacillariophyta522Open in IMG/M
3300006383|Ga0075504_1341342All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Ochrophyta → Bacillariophyta → Coscinodiscophyceae → Thalassiosirophycidae → Thalassiosirales538Open in IMG/M
3300006390|Ga0075509_1490729All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Ochrophyta → Bacillariophyta → Coscinodiscophyceae → Thalassiosirophycidae → Thalassiosirales → Thalassiosiraceae → Thalassiosira → Thalassiosira pseudonana580Open in IMG/M
3300006569|Ga0075500_120626All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Ochrophyta → Bacillariophyta → Coscinodiscophyceae → Thalassiosirophycidae → Thalassiosirales → Thalassiosiraceae → Thalassiosira → Thalassiosira pseudonana581Open in IMG/M
3300006571|Ga0075505_1430762All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Ochrophyta → Bacillariophyta → Coscinodiscophyceae → Thalassiosirophycidae → Thalassiosirales → Thalassiosiraceae → Thalassiosira → Thalassiosira nordenskioeldii631Open in IMG/M
3300006869|Ga0075477_10152389All Organisms → cellular organisms → Bacteria965Open in IMG/M
3300007177|Ga0102978_1010607All Organisms → cellular organisms → Bacteria1175Open in IMG/M
3300007240|Ga0075176_1780905All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Ochrophyta → Bacillariophyta508Open in IMG/M
3300007241|Ga0075170_1386495All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Ochrophyta → Bacillariophyta → Coscinodiscophyceae → Thalassiosirophycidae → Thalassiosirales572Open in IMG/M
3300007561|Ga0102914_1080074All Organisms → cellular organisms → Bacteria1023Open in IMG/M
3300007585|Ga0102916_1067464All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Ochrophyta → Bacillariophyta944Open in IMG/M
3300007665|Ga0102908_1019672All Organisms → cellular organisms → Bacteria1263Open in IMG/M
3300007665|Ga0102908_1106704All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Ochrophyta → Bacillariophyta567Open in IMG/M
3300007715|Ga0102827_1013782All Organisms → cellular organisms → Eukaryota1830Open in IMG/M
3300008263|Ga0114349_1000092All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Ochrophyta → Bacillariophyta31159Open in IMG/M
3300008832|Ga0103951_10678586All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Ochrophyta → Bacillariophyta → Coscinodiscophyceae → Thalassiosirophycidae → Thalassiosirales562Open in IMG/M
3300008995|Ga0102888_1007799All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Ochrophyta → Bacillariophyta1974Open in IMG/M
3300009054|Ga0102826_1015901All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Ochrophyta → Bacillariophyta → Coscinodiscophyceae → Thalassiosirophycidae → Thalassiosirales1910Open in IMG/M
3300009055|Ga0102905_1094539All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Ochrophyta → Bacillariophyta616Open in IMG/M
3300009086|Ga0102812_10093895All Organisms → cellular organisms → Eukaryota1649Open in IMG/M
3300009142|Ga0102885_1181387All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Ochrophyta → Bacillariophyta519Open in IMG/M
3300009352|Ga0103865_1013555All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Ochrophyta → Bacillariophyta500Open in IMG/M
3300009432|Ga0115005_10188087All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Ochrophyta → Bacillariophyta → Coscinodiscophyceae → Thalassiosirophycidae → Thalassiosirales → Thalassiosiraceae → Thalassiosira → Thalassiosira pseudonana1607Open in IMG/M
3300009432|Ga0115005_10188102All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Ochrophyta → Bacillariophyta → Coscinodiscophyceae → Thalassiosirophycidae → Thalassiosirales → Thalassiosiraceae → Thalassiosira → Thalassiosira pseudonana1607Open in IMG/M
3300009441|Ga0115007_10380298All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Ochrophyta → Bacillariophyta → Coscinodiscophyceae → Thalassiosirophycidae → Thalassiosirales → Thalassiosiraceae → Thalassiosira → Thalassiosira pseudonana922Open in IMG/M
3300009543|Ga0115099_10228845All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Ochrophyta → Bacillariophyta5852Open in IMG/M
3300009543|Ga0115099_10688494All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Ochrophyta → Bacillariophyta → Coscinodiscophyceae → Thalassiosirophycidae → Thalassiosirales516Open in IMG/M
3300009599|Ga0115103_1299688All Organisms → cellular organisms → Eukaryota1290Open in IMG/M
3300009606|Ga0115102_10869690All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Ochrophyta → Bacillariophyta → Coscinodiscophyceae → Thalassiosirophycidae → Thalassiosirales → Thalassiosiraceae → Thalassiosira → Thalassiosira nordenskioeldii940Open in IMG/M
3300009679|Ga0115105_11067228All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Ochrophyta → Bacillariophyta869Open in IMG/M
3300010354|Ga0129333_10230038All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Ochrophyta → Bacillariophyta → Coscinodiscophyceae → Thalassiosirophycidae → Thalassiosirales1679Open in IMG/M
3300012415|Ga0138263_1165030All Organisms → cellular organisms → Bacteria3393Open in IMG/M
3300012417|Ga0138262_1798746All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Ochrophyta → Bacillariophyta → Coscinodiscophyceae → Thalassiosirophycidae → Thalassiosirales939Open in IMG/M
3300012419|Ga0138260_10182296All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Ochrophyta → Bacillariophyta6721Open in IMG/M
3300012419|Ga0138260_10507919All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Ochrophyta → Bacillariophyta561Open in IMG/M
3300012419|Ga0138260_10537354All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Ochrophyta → Bacillariophyta → Coscinodiscophyceae → Thalassiosirophycidae → Thalassiosirales → Thalassiosiraceae → Thalassiosira → Thalassiosira pseudonana503Open in IMG/M
3300012419|Ga0138260_11095612All Organisms → cellular organisms → Bacteria1615Open in IMG/M
3300012471|Ga0129334_1039925All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Ochrophyta → Bacillariophyta → Coscinodiscophyceae → Thalassiosirophycidae → Thalassiosirales554Open in IMG/M
3300012518|Ga0129349_1215501All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Ochrophyta → Bacillariophyta → Coscinodiscophyceae → Thalassiosirophycidae → Thalassiosirales556Open in IMG/M
3300012935|Ga0138257_1800750All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Ochrophyta → Bacillariophyta → Coscinodiscophyceae → Thalassiosirophycidae → Thalassiosirales → Thalassiosiraceae → Thalassiosira → Thalassiosira pseudonana566Open in IMG/M
3300012965|Ga0129346_1181330All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Ochrophyta → Bacillariophyta → Coscinodiscophyceae → Thalassiosirophycidae → Thalassiosirales620Open in IMG/M
3300012966|Ga0129341_1021257All Organisms → cellular organisms → Bacteria1119Open in IMG/M
3300017764|Ga0181385_1015658All Organisms → cellular organisms → Eukaryota2423Open in IMG/M
3300018515|Ga0192960_106063All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Ochrophyta → Bacillariophyta → Coscinodiscophyceae → Thalassiosirophycidae → Thalassiosirales → Thalassiosiraceae → Thalassiosira → Thalassiosira pseudonana576Open in IMG/M
3300018636|Ga0193377_1016689All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Ochrophyta → Bacillariophyta → Coscinodiscophyceae → Thalassiosirophycidae → Thalassiosirales → Thalassiosiraceae → Thalassiosira → Thalassiosira pseudonana624Open in IMG/M
3300018683|Ga0192952_1007244All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Ochrophyta → Bacillariophyta → Coscinodiscophyceae → Thalassiosirophycidae → Thalassiosirales893Open in IMG/M
3300018692|Ga0192944_1046274All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Ochrophyta → Bacillariophyta → Coscinodiscophyceae → Thalassiosirophycidae → Thalassiosirales → Thalassiosiraceae → Thalassiosira → Thalassiosira pseudonana625Open in IMG/M
3300018692|Ga0192944_1052777All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Ochrophyta → Bacillariophyta → Coscinodiscophyceae → Thalassiosirophycidae → Thalassiosirales577Open in IMG/M
3300018745|Ga0193000_1072081All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Ochrophyta → Bacillariophyta → Coscinodiscophyceae → Thalassiosirophycidae → Thalassiosirales507Open in IMG/M
3300018965|Ga0193562_10056548All Organisms → cellular organisms → Bacteria1070Open in IMG/M
3300018968|Ga0192894_10306440All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Ochrophyta → Bacillariophyta533Open in IMG/M
3300018969|Ga0193143_10217763All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Ochrophyta → Bacillariophyta546Open in IMG/M
3300018974|Ga0192873_10349332All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Ochrophyta → Bacillariophyta → Coscinodiscophyceae → Thalassiosirophycidae → Thalassiosirales → Thalassiosiraceae → Thalassiosira → Thalassiosira pseudonana613Open in IMG/M
3300018974|Ga0192873_10369884All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Ochrophyta → Bacillariophyta587Open in IMG/M
3300018980|Ga0192961_10044347All Organisms → cellular organisms → Bacteria1259Open in IMG/M
3300018981|Ga0192968_10160218All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Ochrophyta → Bacillariophyta → Coscinodiscophyceae → Thalassiosirophycidae → Thalassiosirales579Open in IMG/M
3300018982|Ga0192947_10008576All Organisms → cellular organisms → Eukaryota2264Open in IMG/M
3300019000|Ga0192953_10005354All Organisms → cellular organisms → Bacteria1602Open in IMG/M
3300019001|Ga0193034_10160521All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Ochrophyta → Bacillariophyta → Coscinodiscophyceae → Thalassiosirophycidae → Thalassiosirales → Thalassiosiraceae → Thalassiosira → Thalassiosira pseudonana550Open in IMG/M
3300019010|Ga0193044_10062338All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Ochrophyta → Bacillariophyta1222Open in IMG/M
3300019010|Ga0193044_10242753All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Ochrophyta → Bacillariophyta → Coscinodiscophyceae → Thalassiosirophycidae → Thalassiosirales → Thalassiosiraceae → Thalassiosira → Thalassiosira pseudonana557Open in IMG/M
3300019021|Ga0192982_10278985All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Ochrophyta → Bacillariophyta → Coscinodiscophyceae → Thalassiosirophycidae → Thalassiosirales → Thalassiosiraceae → Thalassiosira → Thalassiosira pseudonana600Open in IMG/M
3300019022|Ga0192951_10083823All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Ochrophyta → Bacillariophyta → Coscinodiscophyceae → Thalassiosirophycidae → Thalassiosirales1009Open in IMG/M
3300019032|Ga0192869_10374735All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Ochrophyta → Bacillariophyta → Coscinodiscophyceae → Thalassiosirophycidae → Thalassiosirales → Thalassiosiraceae → Thalassiosira → Thalassiosira pseudonana620Open in IMG/M
3300019040|Ga0192857_10344767All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Ochrophyta → Bacillariophyta517Open in IMG/M
3300019049|Ga0193082_10800688All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Ochrophyta → Bacillariophyta531Open in IMG/M
3300019214|Ga0180037_1174967All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Ochrophyta → Bacillariophyta → Coscinodiscophyceae → Thalassiosirophycidae → Thalassiosirales → Thalassiosiraceae → Thalassiosira → Thalassiosira nordenskioeldii508Open in IMG/M
3300019726|Ga0193974_1025262All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Ochrophyta → Bacillariophyta697Open in IMG/M
3300020048|Ga0207193_1873352All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Ochrophyta → Bacillariophyta512Open in IMG/M
3300020074|Ga0194113_10683177All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Ochrophyta → Bacillariophyta714Open in IMG/M
3300021299|Ga0210302_1115470All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Ochrophyta → Bacillariophyta → Coscinodiscophyceae → Thalassiosirophycidae → Thalassiosirales560Open in IMG/M
3300021323|Ga0210295_1192068All Organisms → cellular organisms → Eukaryota1312Open in IMG/M
3300021353|Ga0206693_1311040All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Ochrophyta → Bacillariophyta → Coscinodiscophyceae → Thalassiosirophycidae → Thalassiosirales → Thalassiosiraceae → Thalassiosira → Thalassiosira pseudonana586Open in IMG/M
3300021368|Ga0213860_10034391All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Ochrophyta → Bacillariophyta → Coscinodiscophyceae → Thalassiosirophycidae → Thalassiosirales2138Open in IMG/M
3300021373|Ga0213865_10332880All Organisms → cellular organisms → Bacteria696Open in IMG/M
3300021425|Ga0213866_10078123All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Ochrophyta → Bacillariophyta1831Open in IMG/M
3300021961|Ga0222714_10548891All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Ochrophyta → Bacillariophyta → Coscinodiscophyceae → Thalassiosirophycidae → Thalassiosirales585Open in IMG/M
3300022367|Ga0210312_116723All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Ochrophyta → Bacillariophyta573Open in IMG/M
3300022375|Ga0210313_1006082All Organisms → cellular organisms → Bacteria1363Open in IMG/M
3300022375|Ga0210313_1038567All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Ochrophyta → Bacillariophyta570Open in IMG/M
(restricted) 3300024062|Ga0255039_10529458All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Ochrophyta → Bacillariophyta515Open in IMG/M
3300024346|Ga0244775_10165444All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Ochrophyta → Bacillariophyta → Coscinodiscophyceae → Thalassiosirophycidae → Thalassiosirales1863Open in IMG/M
3300024544|Ga0255294_1067415All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Ochrophyta → Bacillariophyta637Open in IMG/M
3300024573|Ga0256337_1189999All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Ochrophyta → Bacillariophyta → Coscinodiscophyceae → Thalassiosirophycidae → Thalassiosirales509Open in IMG/M
3300025684|Ga0209652_1043746All Organisms → cellular organisms → Bacteria1707Open in IMG/M
3300025701|Ga0209771_1170814All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Ochrophyta → Bacillariophyta → Coscinodiscophyceae → Thalassiosirophycidae → Thalassiosirales652Open in IMG/M
3300025848|Ga0208005_1001919All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Ochrophyta → Bacillariophyta → Coscinodiscophyceae → Thalassiosirophycidae → Thalassiosirales6721Open in IMG/M
3300027230|Ga0208171_1014431All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Ochrophyta → Bacillariophyta792Open in IMG/M
3300027230|Ga0208171_1018236All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Ochrophyta → Bacillariophyta697Open in IMG/M
3300027245|Ga0208445_1029419All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Ochrophyta → Bacillariophyta570Open in IMG/M
3300027249|Ga0208175_1024223All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Ochrophyta → Bacillariophyta644Open in IMG/M
3300027714|Ga0209815_1075636All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Ochrophyta → Bacillariophyta → Coscinodiscophyceae → Thalassiosirophycidae → Thalassiosirales → Thalassiosiraceae → Thalassiosira → Thalassiosira nordenskioeldii1159Open in IMG/M
3300027753|Ga0208305_10188460All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Ochrophyta → Bacillariophyta745Open in IMG/M
3300031569|Ga0307489_10021140All Organisms → cellular organisms → Bacteria → Proteobacteria3670Open in IMG/M
3300032136|Ga0316201_11777450All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Ochrophyta → Bacillariophyta → Coscinodiscophyceae → Thalassiosirophycidae → Thalassiosirales508Open in IMG/M
3300032272|Ga0316189_10590385All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Ochrophyta → Bacillariophyta851Open in IMG/M

Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).


 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
MarineEnvironmental → Aquatic → Marine → Unclassified → Unclassified → Marine32.46%
EstuarineEnvironmental → Aquatic → Marine → Intertidal Zone → Estuary → Estuarine19.30%
AqueousEnvironmental → Aquatic → Marine → Coastal → Unclassified → Aqueous14.04%
Polar MarineEnvironmental → Aquatic → Marine → Unclassified → Unclassified → Polar Marine6.14%
MarineEnvironmental → Aquatic → Marine → Oceanic → Unclassified → Marine2.63%
SeawaterEnvironmental → Aquatic → Marine → Oceanic → Unclassified → Seawater2.63%
SeawaterEnvironmental → Aquatic → Marine → Coastal → Unclassified → Seawater2.63%
Freshwater LakeEnvironmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake1.75%
FreshwaterEnvironmental → Aquatic → Freshwater → River → Unclassified → Freshwater1.75%
Worm BurrowEnvironmental → Aquatic → Marine → Coastal → Sediment → Worm Burrow1.75%
MarineEnvironmental → Aquatic → Marine → Intertidal Zone → Unclassified → Marine1.75%
MarineEnvironmental → Aquatic → Marine → Intertidal Zone → Sediment → Marine1.75%
SeawaterEnvironmental → Aquatic → Marine → Strait → Unclassified → Seawater1.75%
Wastewater EffluentEngineered → Wastewater → Nutrient Removal → Unclassified → Unclassified → Wastewater Effluent1.75%
SedimentEnvironmental → Aquatic → Freshwater → Sediment → Unclassified → Sediment0.88%
Freshwater, PlanktonEnvironmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater, Plankton0.88%
LakeEnvironmental → Aquatic → Freshwater → Lake → Unclassified → Lake0.88%
Freshwater Lake SedimentEnvironmental → Aquatic → Freshwater → Lake → Sediment → Freshwater Lake Sediment0.88%
River WaterEnvironmental → Aquatic → Freshwater → Unclassified → Unclassified → River Water0.88%
Sackhole BrineEnvironmental → Aquatic → Marine → Coastal → Unclassified → Sackhole Brine0.88%
Freshwater To Marine Saline GradientEnvironmental → Aquatic → Marine → Coastal → Unclassified → Freshwater To Marine Saline Gradient0.88%
EstuarineEnvironmental → Aquatic → Marine → Unclassified → Unclassified → Estuarine0.88%
Estuarine WaterEnvironmental → Aquatic → Marine → Unclassified → Unclassified → Estuarine Water0.88%

Visualization
Powered by ApexCharts



Associated Samples

Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).

Taxon OIDSample NameHabitat TypeIMG/M Link
3300000130Marine microbial communities from chronically polluted sediments in Adventfjord, Norway - Svalbard Archipelago station 2 sample NOR 15_50mEnvironmentalOpen in IMG/M
3300000133Marine microbial communities from chronically polluted sediments in Adventfjord, Norway - Svalbard Archipelago station 1 sample NOR 02_45mEnvironmentalOpen in IMG/M
3300003555Ammonia-oxidizing marine microbial communities from Monterey Bay, California, USA - Metatranscriptome CAN11_17_M020 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300003683Ammonia-oxidizing marine microbial communities from Monterey Bay, California, USA - Metatranscriptome CAN11_54_BLW_10 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300005805Microbial and algae communities from Cheney Reservoir in Wichita, Kansas, USAEnvironmentalOpen in IMG/M
3300006165Marine microbial communities from the West Antarctic Peninsula - Coastal water metaG006-DNAEnvironmentalOpen in IMG/M
3300006355Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_0.19_N_>0.8_RNA2 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300006373Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Fall_15_>0.8_RNA1 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300006378Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_0.19_D_>0.8_RNA1 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300006383Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_22_D_>0.8_RNA1 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300006390Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_22_N_>0.8_RNA2 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300006393Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_29_N_>0.8_RNA2 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300006394Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Spr_20_>0.8_RNA1 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300006569Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_0.19_N_<0.8_RNA (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300006571Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_22_D_>0.8_RNA2 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300006869Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_22_N_>0.8_DNAEnvironmentalOpen in IMG/M
3300007177Combined Assembly of cyanobacterial bloom in Marina Bay water reservoir, Singapore (Diel cycle-Surface and Bottom layers) 16 sequencing projectsEnvironmentalOpen in IMG/M
3300007240Wastewater effluent complex algal communities from Wisconsin, to seasonally profile nutrient transformation and Carbon sequestration - JI 8/11/14 B green RNA (Eukaryote Community Metatranscriptome)EngineeredOpen in IMG/M
3300007241Wastewater effluent complex algal communities from Wisconsin, to seasonally profile nutrient transformation and Carbon sequestration - JI 7/17/14 B RNA (Eukaryote Community Metatranscriptome)EngineeredOpen in IMG/M
3300007561Estuarine microbial communities from the Columbia River estuary - metaG 1561A-3EnvironmentalOpen in IMG/M
3300007585Estuarine microbial communities from the Columbia River estuary - metaG 1562A-3EnvironmentalOpen in IMG/M
3300007665Estuarine microbial communities from the Columbia River estuary - metaG 1557A-3EnvironmentalOpen in IMG/M
3300007715Estuarine microbial communities from the Columbia River estuary - metaG S.751EnvironmentalOpen in IMG/M
3300008263Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE2, Sample E2014-0106-53-LTREnvironmentalOpen in IMG/M
3300008832Eukaryotic communities of water collected during the Tara Oceans expedition - TARA_A200000150EnvironmentalOpen in IMG/M
3300008995Estuarine microbial communities from the Columbia River estuary - metaG 1551A-3EnvironmentalOpen in IMG/M
3300009054Estuarine microbial communities from the Columbia River estuary - metaG S.737EnvironmentalOpen in IMG/M
3300009055Estuarine microbial communities from the Columbia River estuary - metaG 1556B-3EnvironmentalOpen in IMG/M
3300009086Estuarine microbial communities from the Columbia River estuary - Flood tide ETM metaG S.713EnvironmentalOpen in IMG/M
3300009142Estuarine microbial communities from the Columbia River estuary - metaG 1550B-3EnvironmentalOpen in IMG/M
3300009352Microbial communities of water from Amazon river, Brazil - RCM18EnvironmentalOpen in IMG/M
3300009432Marine eukaryotic phytoplankton communities from Arctic Ocean - Arctic Ocean - Greenland ARC118M MetagenomeEnvironmentalOpen in IMG/M
3300009441Marine eukaryotic phytoplankton communities from Arctic Ocean - Arctic Ocean ARC135M MetagenomeEnvironmentalOpen in IMG/M
3300009543Marine eukaryotic communities from Pacific Ocean to study complex ecological interactions - MBTS_20Mar14_M2_3um Metatranscriptome (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300009599Marine eukaryotic communities from Pacific Ocean to study complex ecological interactions - MBTS_5May14_M1_3um Metatranscriptome (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300009606Marine eukaryotic communities from Pacific Ocean to study complex ecological interactions - MBTS_5May14_M2_3um Metatranscriptome (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300009679Marine eukaryotic communities from Pacific Ocean to study complex ecological interactions - CN13ID_155_C17_100m_0.8um Metatranscriptome (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300010354Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Sum_0.6_0.8_DNAEnvironmentalOpen in IMG/M
3300012415Metatranscriptomics of polar marine prokaryotic and eukaryotic communities from Arthur Harbor ice station, Antarctica - RNA15.ICE_1m.20151115 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300012417Metatranscriptomics of polar marine prokaryotic and eukaryotic communities from Palmer Station, Antarctica after 72hr light incubation - RNA13.B_72.20151113 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300012419Metatranscriptomics of polar marine prokaryotic and eukaryotic communities from Palmer Station, Antarctica after 24hr light incubation - RNA10.B_24.20151111 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300012471Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Sum_0.6_0.8_RNA1 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300012504Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Sum_20_0.8_RNA2 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300012518Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Sum_27_0.8_RNA1 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300012935Metatranscriptomics of polar marine prokaryotic and eukaryotic communities from Arthur Harbor ice station, Antarctica - RNA5.ICE_1m.20151110 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300012965Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Sum_20_0.8_RNA1 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300012966Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Sum_15_0.8_RNA2 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300017764Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 8 SPOT_SRF_2010-02-11EnvironmentalOpen in IMG/M
3300018515Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_083 - TARA_N000001372 (ERX1782216-ERR1712231)EnvironmentalOpen in IMG/M
3300018635Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_122 - TARA_N000001943 (ERX1782126-ERR1712207)EnvironmentalOpen in IMG/M
3300018636Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_122 - TARA_N000001943 (ERX1782245-ERR1711897)EnvironmentalOpen in IMG/M
3300018683Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_082 - TARA_N000001394 (ERX1782475-ERR1712204)EnvironmentalOpen in IMG/M
3300018692Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_082 - TARA_N000001382 (ERX1782155-ERR1712153)EnvironmentalOpen in IMG/M
3300018745Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_110 - TARA_N000001746 (ERX1782385-ERR1712134)EnvironmentalOpen in IMG/M
3300018767Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_041 - TARA_N000000075 (ERX1782420-ERR1711944)EnvironmentalOpen in IMG/M
3300018965Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_149 - TARA_N000002141EnvironmentalOpen in IMG/M
3300018968Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_068 - TARA_N000000713 (ERX1782205-ERR1712096)EnvironmentalOpen in IMG/M
3300018969Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_022 - TARA_A100000539 (ERX1782234-ERR1712179)EnvironmentalOpen in IMG/M
3300018974Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_066 - TARA_N000000809 (ERX1782160-ERR1711971)EnvironmentalOpen in IMG/M
3300018980Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_083 - TARA_N000001372 (ERX1782312-ERR1712127)EnvironmentalOpen in IMG/M
3300018981Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_084 - TARA_N000001440 (ERX1782157-ERR1712238)EnvironmentalOpen in IMG/M
3300018982Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_082 - TARA_N000001384 (ERX1782271-ERR1711935)EnvironmentalOpen in IMG/M
3300018995Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_128 - TARA_N000002299 (ERX1782426-ERR1711902)EnvironmentalOpen in IMG/M
3300019000Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_082 - TARA_N000001394 (ERX1782320-ERR1712129)EnvironmentalOpen in IMG/M
3300019001Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_009 - TARA_X000001043 (ERX1782383-ERR1712007)EnvironmentalOpen in IMG/M
3300019010Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_081 - TARA_N000001428 (ERX1809462-ERR1739838)EnvironmentalOpen in IMG/M
3300019021Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_085 - TARA_N000001034 (ERX1782268-ERR1711957)EnvironmentalOpen in IMG/M
3300019022Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_082 - TARA_N000001390 (ERX1782474-ERR1712194)EnvironmentalOpen in IMG/M
3300019032Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_066 - TARA_N000000805 (ERX1782188-ERR1712216)EnvironmentalOpen in IMG/M
3300019040Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_065 - TARA_N000000963 (ERX1782167-ERR1712154)EnvironmentalOpen in IMG/M
3300019049Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_064 - TARA_N000000531 (ERX1782179-ERR1712232)EnvironmentalOpen in IMG/M
3300019103Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_082 - TARA_N000001384 (ERX1782358-ERR1712021)EnvironmentalOpen in IMG/M
3300019214Estuarine microbial communities from the Columbia River estuary - R.1189 metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300019726Sediment microbial communities from the Broadkill River, Lewes, Delaware, United States ? BRT_10-11_MGEnvironmentalOpen in IMG/M
3300020048Microbial communities from Manganika and McQuade lakes, Minnesota, USA Combined Assembly of Gp0225457, Gp0225456, Gp0225455, Gp0225454, Gp0225453, Gp0224915EnvironmentalOpen in IMG/M
3300020074Freshwater microbial communities from Lake Tanganyika, Tanzania - TA2015017 Mahale Deep Cast 200mEnvironmentalOpen in IMG/M
3300021299Metatranscriptome of estuarine water microbial communities from the Columbia River estuary, Oregon, United States ? R1034 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300021323Metatranscriptome of estuarine water microbial communities from the Columbia River estuary, Oregon, United States ? R9.63AS (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300021353Metatranscriptome of ammonia-oxidizing marine archaeal communities from Monterey Bay, California, United States - M2 80m 12015 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300021368Coastal seawater microbial communities near Pivers Island, North Carolina, United States - PICO550EnvironmentalOpen in IMG/M
3300021373Coastal seawater microbial communities near Pivers Island, North Carolina, United States - PICO282EnvironmentalOpen in IMG/M
3300021425Coastal seawater microbial communities near Pivers Island, North Carolina, United States - PICO284EnvironmentalOpen in IMG/M
3300021961Estuarine water microbial communities from San Francisco Bay, California, United States - C33_3DEnvironmentalOpen in IMG/M
3300022367Metatranscriptome of estuarine water microbial communities from the Columbia River estuary, Oregon, United States ? R1161 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300022375Metatranscriptome of estuarine water microbial communities from the Columbia River estuary, Oregon, United States ? R1183 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300024062 (restricted)Seawater microbial communities from Strait of Georgia, British Columbia, Canada - BC1_12_1EnvironmentalOpen in IMG/M
3300024346Whole water sample coassemblyEnvironmentalOpen in IMG/M
3300024544Metatranscriptome of freshwater microbial communities from Mississippi River, Louisiana, United States - Miss_Yuk_RepA_8h (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300024573Metatranscriptome of freshwater microbial communities from Altamaha River, Georgia, United States - Atl_Atl_RepA_8h (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300025684Marine microbial communities from expanding oxygen minimum zones in the Saanich Inlet - ESP_74LU_5_DNA (SPAdes)EnvironmentalOpen in IMG/M
3300025701Marine microbial communities from expanding oxygen minimum zones in the Saanich Inlet - ESP_59LU_5_DNA (SPAdes)EnvironmentalOpen in IMG/M
3300025848Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_0.19_N_<0.8_DNA (SPAdes)EnvironmentalOpen in IMG/M
3300027230Estuarine microbial communities from the Columbia River estuary - metaG 1551A-3 (SPAdes)EnvironmentalOpen in IMG/M
3300027245Estuarine microbial communities from the Columbia River estuary - metaG 1556B-3 (SPAdes)EnvironmentalOpen in IMG/M
3300027249Estuarine microbial communities from the Columbia River estuary - metaG 1557A-3 (SPAdes)EnvironmentalOpen in IMG/M
3300027714Marine microbial communities from the West Antarctic Peninsula - Coastal water metaG002-DNA (SPAdes)EnvironmentalOpen in IMG/M
3300027753Estuarine microbial communities from the Columbia River estuary - Flood tide ETM metaG S.741 (SPAdes)EnvironmentalOpen in IMG/M
3300031569Sea-ice brine microbial communities from Beaufort Sea near Barrow, Alaska, United States - SB 1.2EnvironmentalOpen in IMG/M
3300032136Coastal sediment microbial communities from Delaware Bay, Delaware, United States - CS-6 worm burrowEnvironmentalOpen in IMG/M
3300032272Coastal sediment microbial communities from Maine, United States - Lowes Cove worm burrowEnvironmentalOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap


 ⦗Top⦘

Family Sequences

Note: Some of these sequences are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).

Protein ID Sample Taxon ID Habitat Sequence
SA_S2_NOR15_50mDRAFT_1015300833300000130MarineMGQKTDARIFRQGIAKKN*ELKYSEKNYEESSLYLYKTLEIQKYLNRFFGLYKMKVHNCKIFYSDNSLRIFVSFYITTKTISIINKNLTEYSKKITTYTRRTSSKKKGGWKE
SA_S1_NOR02_45mDRAFT_101192233300000133MarineMGQKTDARIFRQGIAKKN*ELKYSEKNYEESSLYLYKTLEIQKYLNRFFGLYKMKVHNCKIFYSDNSLRIFVSFYITTKTIS
Ga0008453J51685_11844323300003555SeawaterMGQKTDARIFRQGVGKKKLRIENIEKNNEESSLYLYKTLEIQKYITRFFGLYKMKIHNCKIFYSESSLQIFISFYVTKKTIYIINKTLTKYSKKL
Ga0008459J53047_102603423300003683SeawaterMGQKTDARIFRQGVGKKN*ELKHIEKNNEESSLYLYKTLEIQKYITRFFGLYKMKIHNCKIFYSESSLQIFISFYVTKKTIYIINKTLTKYSKKLSIRT
Ga0079957_1017993113300005805LakeMGQKTDARIFRQGYIEKTENLRHIAKNDEESSLFLYKTLEVQRYLNRFFGLYKMKIHNCKIFYSHGFLQVFVSFYITTKTIYIIRKNLTRYSKKLSTQIKRTSSKKKN*
Ga0075443_10000072563300006165MarineMGQKTDARIFRQGVNKKNWELKHIDKNNEESSLFLYKTLEVQKYLNRFFKLYKIKVHNCKIFYSDSSLQVFVSFYVTPKTFYAINKDVTKYSKEFLVPSRSAASNKQRIS*
Ga0075501_123805123300006355AqueousMGQKVDARIFRLGVCKKT*EQKYIEKKSEESSFYLYKTLEIRKYIYRIFDLYKIKIHNCKIFYSENSIQIFISFYLTEKTINIIDKNLTRYQKKFSIRIKQLR
Ga0075483_120066613300006373AqueousMGQKTDARIFRQGITKKNWEFKYIEKNNEESSLFLYKTLEIQKYVHRFFGLYKIKIHHCKILYSDSSLQIFVSFYLTTKTFYTINKNIIKYSKVFIVPSPLGFSNKKTKRKKS*
Ga0075498_137013413300006378AqueousMGQKTDARIFRLGVIKKNWELKYIEKNIEESSLYLYEILEIQKYLNRFFGLYKIKIHNCKICYSDSCLHLFISFYSLILSFFLFLLF
Ga0075504_134134223300006383AqueousMGQKTDARIFRLGVTRKN*ESKYIEKNNEESSLYLYKTLEIQKYLNRFFGLYKIKIHNCKIFYSENVLQIFISFYLTAKTLYIINRNLTKYSKKS
Ga0075509_149072923300006390AqueousMGQKTDARIFRQGVHKKS*ESKYIEKNNEESSLYLYRTLEIQKYLNRFFELYKIKIHNCRIFYSDSSLCIFVSFYLTTKTIHIINKDLIKYSKKFLSRTKRPFSK
Ga0075517_102687443300006393AqueousMGQKIDARIFRQGVNKKN*EFKYIEKNNEESSLYLYKTLEIQKYVNRFFGLYRIKIHNCKIFYSDSSLQIFVSFYLTTKTFYIINKHVVKYSSKFLVPSQSVPSKRKRGIRKGKS*GKKGKKVCNFHYL*
Ga0075492_106226143300006394AqueousMGQKTDARIFRLGVTKKNWESKYIEKNNEESSLYLYKTLEIQKYLSRFFGLYKIKIHTCKLFYSENTLQVFISFYLTTKTLYVISKHLTKYSKRSLTCFKRLQTHVRINEKNNKKKKNL
Ga0075500_12062623300006569AqueousMGQKTDARIFRQGIHKKN*ESKYIEKNNEESSLYLYKTLEIQKYLNRFFELYKIKIHNCRIFYSNGSLYVFVSFYLTAKTIYAINKDLIRYSKKFLLRAKRASSKK
Ga0075505_143076223300006571AqueousMGQKTDARIFRKGVKKKN*EIKYIEKNNEDVSLYIYKTLEIQKYLNRFFGLYKMKIHSYKIFYSDSSLQIFISFYFTTKTMYVLKRKLKKQGTITKPKNIK
Ga0075477_1015238933300006869AqueousMGQKTDARIFRLGVTRKN*ESKYIEKNNEESSLYLYKTLEIQKYLNRFFGLYKIKIHNCKIFYSENVLQIFISFYLTAKTLYIINRNLTKYSKKSLAY
Ga0102978_101060733300007177Freshwater LakeMGQKVDARIFRLGICKKN*EQKYIEKNNEESSLYLYKTLEIQKYINRIFELYKIKIHNSKIFYSNDSLQIFISFYITEKTIHIIDKSLTK
Ga0075176_178090513300007240Wastewater EffluentMGQKVDARIFRLGICKKN*EQKYIEKNNEESSLYLYKTLEIQKYINRIFDLYKIKIHNCKIFYSDNSLQIFISF
Ga0075170_138649523300007241Wastewater EffluentMGQKINANLFRLGVQKKNWELKYIEKNNEESSFYLYKNLEIQKYLDRFFKLYKIKIHNSKVHYSSDSLQIFVSFYITEKAISIIDKINIKKRTSSYQKNFSVIYRRW
Ga0102914_108007413300007561EstuarineMGQKTDARIFRQGVAKKN*EFRHIEKNNEESSLFLYKTLEVQRYLNRFFGLYKMKIHNCKIFYSHSSLQVFISFYVTAKTIYVLRKNLTKYSKKLSTLIKRTSSK
Ga0102916_106746433300007585EstuarineMGQKTDARIFRQGIHKKN*EFRHIAKNNEESSLFLYKTLEVQRYLNRFFGLYKMKIHSCKIFYSHGSLQVFVSFYITAKTIYAIRKNLTKYSKKLSTQVK
Ga0102908_101967233300007665EstuarineMGQKIDARIFRQGVNKKN*EFKYIEKNNEESSLYLYKTLEIQKYVNRFFGLYRIKIHNCKIFYSDSSLQIFVSFYLTTKTFYIINK
Ga0102908_110670413300007665EstuarineMGQKTNASIFRQGLLKKN*EIKTLEKNKEESSFFLYKTLEIQKYINRFFGLYEIKIHNCKIFYSDNSLQIFVSFYTTIKTIYIINKKVVKKIKPS
Ga0102827_101378213300007715EstuarineMGQKTDARIFRQGLNQKN*ELKHIEKNNEESSLYLYKTLEIQKYLNRFFELYKMKIHNCRIFYSDGSLQIFISFYLTAKTVYIINK
Ga0114349_1000092313300008263Freshwater, PlanktonMGQKTDARIFRLGVTKKNWESKYIEKNNEESSLYLYKTLEIQKYLSRFFSLYKIKIHTCKIFYSENTLQVFISFYLTTKTLYIVSKNLTKYSKKSLAYFKRLQTHIKINKKYQKKKKFFAERILF*
Ga0103951_1067858623300008832MarineMGQKTDARIFRQGRYKKNWEFKYIEKNNEESSLFLYKTLEIQKYLNRFFGLYKIKIHNCKIFYSDSSLQVLVFFYLTTKTFYAINKKAVKYSKKLLVPSQFLLS
Ga0102888_100779913300008995EstuarineMGQKTNASIFRQGLLKKN*EIKTLEKNKEESSFFLYKTLEIQKYINRFFGLYEIKIHNCKIFYSDNSLQIFVSFYTTIKTIYIINKKVVKKI
Ga0102826_101590123300009054EstuarineMGQKTDARIFRQGIHKKTWELKHIEKNNEELSLYLYKTLKIQEYINRFFKLYKIKIHNCKISYSESSLQIYISFYITTKVFSAINKNITKYSEECLILSRFLPSNEKKRNWKRN*
Ga0102905_109453913300009055EstuarineMGQKIDARIFRQGVNKKN*EFKYIEKNNEESSLYLYKTLEIQKYVNRFFGLYRIKIHNCKIFYSDSSLQIFVSFYLTTKTFYIINKHVVKYSSKFLVPSQS
Ga0102812_1003514793300009086EstuarineMGQKTEARIFRQGLNQKN*ELKHIEKNNEESSLYLYKTLEIQKYLNRFFELYKMKIHNCRIFYSDGSLQIFISF
Ga0102812_1009389523300009086EstuarineMGQKTDARIFRQGVLKKD*DLKYIAKNNEESSLYLYKTLEIQKYLNRFFELYRIKVHNCQILYSDTSLQIFVSFYLTTKTI
Ga0102885_118138713300009142EstuarineMGQKIDARIFRQGVNKKN*EFKYIEKNNEESSLYLYKTLEIQKYVNRFFGLYRIKIHNCKIFYSDSSLQIFVSFYLTTKTFYIINKHVVKY
Ga0103865_101355513300009352River WaterMGQKVDARIFRLGICKKN*EQKYIEKNNEESSLYLYKTLEIQKYINRIFDLYKIKIHNCKIFYSESSLHVFISFYVTTKTISIISKNLTK
Ga0115005_1018808743300009432MarineRQGVNKKNWELKHIEKNNEESSLYLYKTLEIQKYLNRFFGLYKIKIHNCKIFYSDSSLQIFVSFYVTTKTFYVIKKNVTKYSKEFSTEFHPVLSNEQKKN*
Ga0115005_1018810243300009432MarineRQGVNKKNWELKHIEKNNEESSLYLYKTLEIQKYLNRFFGLYKIKIHNCKIFYSDSSLQIFVSFYITTKTFYVIKKNVTKYSKEFSTEFHPTLSNEQKKNWKKKN*
Ga0115007_1038029813300009441MarineMGQKTEERIFRQGVNKKNWELKHIEKNNEESSLYLYKTLEIQKYLNRFFGLYKIKIHNCKIFYSDSSLQIFVSFYITTKTFYVIKKN
Ga0115099_1003629643300009543MarineMGQKTDARIFRLGVTKKN*ESKYIEKNNEESSLYLYKTLEIQKYLNRFFGLYKIKIHNCKIFYSENVLQIFISFYL
Ga0115099_10228845143300009543MarineMGQKTDARIFRQGRYKKNWEFKYIEKNNEESSLFLYKTLEIQKYLNRFFGLYKIKIHNCKIFYSDSSLQVLVFFYLTTKTFYAINKKAVKYSKKLLVPSQFLLSNKKTKP*
Ga0115099_1068849413300009543MarineMGQKVDARIFRQSLIKKN*EFKYIGKNNEESSLFLYKIVQIQQYLNRFFGLYKIKIHNCKIFYSNSTLQLFISFYVTQQTIALVNKKLVKH
Ga0115103_129968843300009599MarineMGQKTDARIFRQGINKKN*EIKNMEKTGEESSLFLYKTLEIQKYLNRFFGLYKIKIHNCKIFYSATSLQIFLSFYITT
Ga0115102_1086969013300009606MarineFKYIEKNNEESSLYLYKTLEIQKYVNRFFGLYRIKIHNCKIFYSDSSLQIFVSFYLTTKTFYIINKHVVKYSSKFLVPSQSVPSKRKRGIRKGKS*
Ga0115105_1106722813300009679MarineMAQKTDARIFRQNIIKKN*QIKHNEKNNEESSFYLYKTLEIQKYLNRFFELYKIKTHNCKIFYSSNSLKVFISFYISSKAALQRR
Ga0129333_1023003843300010354Freshwater To Marine Saline GradientMGQKTDARIFRLGVTKKNWESKYIEKNNEESSLYLYKTLEIQKYLSRFFGLYKIKIHTCKIFYSENSLQVFISFYLTTKTLY
Ga0138263_116503053300012415Polar MarineMGQKVDARVFREGVNKKNWEFKYIEKNKEDSSLFLYKTLEIQKYLNRFFGLYKIKIHNCKIFYSDSSLQIFISFYVTTRTFYAISKNITKYSKKMYRSF*
Ga0138262_179874623300012417Polar MarineMGQKTDARIFRQGVNKKNWELKHIDKNNEESSLFLYKTLEIQKYLNRFFKLYKIKVHNCKVFYSDSSLQVFVSFYVTPKIFYVINKDVTKYSKEFLVPSRTAASNKQRIS*
Ga0138260_10182296123300012419Polar MarineMGQKTDARIFRKGVKKNN*EVKYIEKSNEDFSLYVYKTLEIQKYLNRFFGLYKIKIHSCKIFYSDSSLQIFISFYVTTKTMYVIKKN*
Ga0138260_1050791923300012419Polar MarineMGQKTDARIFRQGVNKKN*EFKYIEKNIEESSLYLYKTLEIQKYINRFFGLYGIKIHNCKIFYSDSSLQIFVSVYVTTKIFYIINKNVVKYSSKFLVPS
Ga0138260_1053735423300012419Polar MarineMGQKTDARIFRLGVSKKN*ESKHVEKNNEESSLFLYKTLEIQKYLNRFFGLYKIKIHNCKIFYSDGSLQIFLSFYITTRTFYVISKNVTKYSKECTATFKP
Ga0138260_1109561243300012419Polar MarineMGQKTDARIFRQGVNKKNWELKHIDKNNEESSLFLYKTLEVQKYLNRFFKLYKIKVHNCKIFYSDSSLQVFVSFYVTPKTFYAINKDVTKYSKEFLVPSRSAASNK
Ga0129334_103992513300012471AqueousMGQKTDARIFRLGVTKKNWESKYIEKNNEESSLYLYKTLEIQKYLSRFFSLYKIKIHTCKIFYSENTLQVFISFYLTTKTLYIVSKNLTKYSKKSLTYFKRL
Ga0129347_114420113300012504AqueousMGQKTDARIFRLGVTRKN*ESKYIEKNNEESSLYLYKTLEIQKYLNRFFGLYKIKIHNCKIFYSENVLQIFISFYLTAKTLYIINRNLTKYSKKSLAYFKRLQTQAKMGKKNKKSLSHKKFF
Ga0129349_121550123300012518AqueousMGQKTDARIFRLGILKKT*EQKYIEKNKEESSLYLYNTLEIQKYINRIFDLYKIKIHNCKIFFSHNFLQIFISFYLTEKTIQVIDKNIVKHQKKVLVKII
Ga0138257_180075023300012935Polar MarineMGQKVDARVFREGVNKKNWEFKYIEKNKEDSSLFLYKTLEIQKYLNRFFGLYKIKIHNCKIFYSDSSLQIFISFYVTTRTFYAISKNITKYSKKCTAVFKPAFSNR
Ga0129346_118133023300012965AqueousMGQKTDARIFRLGVTRKN*ESKYIEKNNEESSLYLYKTLEIQKYLNRFFGLYKIKIHNCKIFYSENVLQIFISFYLTAKTLYIINRNLTKYSKKSLAYFKRLQTQAKMDKKNKKSL*
Ga0129341_102125713300012966AqueousMGQKVDARIFRLGVCKKI*EQKYIEKKNEESSLYLYNSLEIRKYIHRIFDTYKIKIHNCKIFYSDNSIQIFISFYVTKKTINIIDTNLTKY
Ga0181385_101565813300017764SeawaterMGQKIDARIFRQGVNKKNXEFKYIEKNNEESSLYLYKTLEIQKYVNRFFGLYRIKIHNCKIFYSDSSLQIFVSFYLTTKTFYIINKHVVKYSSKFLVPS
Ga0192960_10606323300018515MarineMGQKIDARIFRQGVNKKNXELKYLEKNMEDSSLFLYKTLEIQKYLNRFFGLYKIKIHNCKIFYSDSSLQIFISFYVTTRTFYAISKNITKYSKRCSATFKPIF
Ga0193376_101672013300018635MarineMGQKTDARIFRQGVNKKNXEFKYIEKNKEDSSLFLYKTLEIQRYLNRFFKLYKIKIHNCKILYSENLLQIFLSFYVTTATFYIIKKNLTKYSKECKKTFKPLFSNKYKQIKKIYPNKLNILNTK
Ga0193377_101668913300018636MarineMGQKTDARIFRQGINKKNXEIKNMEKTGEESSLFLYRTLEIQKYLNRFFGLYKVKIHNCKIFYSTTSLQIFLSFYITTKTFYILRKNITKYPKKWLTTFKPIFSKKYNRKTRR
Ga0192952_100724423300018683MarineMGQKTDARIFRQGVNKKNWELKHIDKNNEESSLFLYKTLEIQKYLNRFFKLYKIKVHNCKVFYSDSSLQVFVSFYVTPKIFYVINKDVTKYSKEFLMPSRTAASNKQRIS
Ga0192944_104627423300018692MarineMGQKTDARIFRQGVHKKDXELKYIEKNNEESSLYVYKTLEIQKYINRFFGLYKIKIHKCKIFYSDSSLQIFISFYISTKTFYKISKNLTKYSKKLXILSLSPNTLFSKKKKK
Ga0192944_105277713300018692MarineMGQKTDARIFRQGVNKKNWELKHIDKNNEESSLFLYKTLEIQKYLNRFFKLYKIKVHNCKVFYSDSSLQVFVSFYVTPKIFYVINKDVTKYSKEFLMPSR
Ga0193000_107208123300018745MarineMGQKIDARIFRQGINKKDXESKYIEKNNEESSLYLYKTLEIQKYINRFFGLYKIKVHKCKILYSDSSLQIFISFYISTKTFYAISKNLTKYSKRLXTLSLSSKTFFNKKRKNXKKREIL
Ga0193212_107459113300018767MarineMGQKTDARIFRQGINKSXKTKYLEKNNEESSLYLYKTLEILKYLNRFFELYKIKVHRCRIFYSDSSLKIFVSIYTST
Ga0193562_1005654833300018965MarineMGQKTDARIFRQNVNKKDXELKYIEKNDEESSLYVYKTLEIQKYISRFFGLYKIKVHKCKILYSDSSLQIFISFYVSTKTFYTINKNLTKYSKKLXTLSLSSKTLFKKK
Ga0192894_1030644023300018968MarineMGQKTDARIFRQGINKKNXEIKNIEKTGEESSLFLYKTLEIQKYLNRFFGLYKIKIHNCKIFYSATSLQIFLSFYITTKTFYILRKNITRY
Ga0193143_1021776313300018969MarineMGQKVDARIFRLGICKKIXEQKYIEKKNEESSLYLYNSLEIRKYIYRIFDTYKIKIHNCKIFYSDNSIQIFISFYITGKTINIMDTN
Ga0192873_1034933213300018974MarineMGQKTDARIFRQGVNNKNXKLKYIDKNNEESSLFLYKTLEIKKYLDRFFEVYKMKVHNCKIFYSDSSLHVFVSFYLTTKIIYIINKNLTKYSKKLSTRTKLPFFKESKKKRL
Ga0192873_1036988423300018974MarineMGQKTDARIFRQNVNKKDXELKYIEKNDEESSLYVYKTLEIQKYISRFFGLYKIKVHKCKILYSDSSLQIFISFYVSTKTFYTI
Ga0192961_1004434733300018980MarineMGQKTDARIFRQGVNKKNXEFKHIEKNSEESSLFLYKTLEIQKYLNRFFGLYKIKIHNCKIFYSDNSLQIFISFYITTKTFSVIGKNITKYSKKC
Ga0192961_1022460013300018980MarineMGQKTDARIFRQGVSKKNXEIKHIEKNNEESSLYLYKTIEIQKYLNRFFGLYKVKIHNCKIFYSDTSLQIFVSFYLTTKTAYVINKKLTLNSGLLAANYKSTILNNQKNSKKTAILGKQPNISTVLGRKKFSKNKN
Ga0192968_1016021813300018981MarineMGQKTDARIFRQGVNKKNWELKHIDKNSEESSLFLYKTLEIQKYLNRFFKLYKIKVHNCKVFYSDSSLQVFVSFYVTPKIFYVINKDVTKYSKEFLVP
Ga0192947_1000857633300018982MarineMGQKTDARIFRQGVHKKDXELKYIEKNNEESSLYVYKTLEIQKYINRFFGLYKIKIHKCKIFYSDSSLQIFISFYISTKTFYKISKNLTKYSKKLXILSLSPNTLFSKKKKLKRNIEEKK
Ga0193430_1016397313300018995MarineMAQKTDARIFRQNINKKNWQIKHNEKSNEESSFYLYKTLEIQKYVNRFFGLYKIKIHNCKIFYSSNSLRIFVSFYICNEKVPSKRKKKN
Ga0192953_1000535413300019000MarineMGQKTDARIFRQGVHKKDXELKYIEKNNEESSLYVYKTLEIQKYINRFFGLYKIKIHKCKIFYSDSSLQIFISFYISTKTFYKISKNLTKYSKKLXILSLSPNTLFSKKKKNXKE
Ga0193034_1016052113300019001MarineMGQKTDARIFRQNVNKKDXELKYIEKNDEESSLYVYKTLEIQKYISRFFGLYKIKVHKCKILYSDSSLQIFISFYVSTKTFYTINKNLTKYSKKLXTLSLSSKTLFRKKKKNXKE
Ga0193044_1006233843300019010MarineMGQKTDARIFRQGVNKKNWELKHIDKNNEESSLFLYKTLEVQKYLNRFFKLYKIKVHNCKIFYSDSSLQVFVSFYVTPKTFYAINKDVTKYSKEFLVPSRSAASNKQRIS
Ga0193044_1024275323300019010MarineMGQKTDARIFRLGVSKKNXESKHVEKNNEESSLFLYKTLEIQKYLNRFFGLYKIKIHNCKIFYSDGSLQIFLSFYITTRTFYVISKNVTKYSKECAATFKPAFLNKQKRIKKKMK
Ga0192982_1027898523300019021MarineMGQKIDARIFRLGVNKKNXELKYIEKNMEDSSLFLYKTLEIQKYLNRFFGLYKIKIHNCKIFYSDSSLQIFVSFYVTTRTFYAISKNITKYSKRCSATFKPIFSRR
Ga0192951_1008382323300019022MarineMGQKTDARIFRQGVNKKNWELKHIDKNNEESSLFLYKTLEIQKYLNRFFKLYKIKVHNCKVFYSDSSLQVFVSFYVTPKIFYVINKDVTKYSKEFLVPSRTAASNKQRIS
Ga0192869_1037473523300019032MarineMGQKTDARIFRQNVNKKDXELKYIEKNDEESSLYVYKTLEIQKYISRFFGLYKIKVHKCKILYSDSSLQIFISFYVSTKTFYTINKNLTKYSKKLXTLSLSSKTLFRKKKKK
Ga0192857_1034476713300019040MarineMGQKTDARIFRQCLNKSXKTKYLEKNDEESSLYLYKTLEIQNYLNRFFGLYKIKVHKCRIFYSESSLQIFVSIYTTTKTL
Ga0193082_1080068823300019049MarineMGQKVDARIFRQGVNKKNXELRHIAKTDEESSLYLYKTLEIQKYLNRFFGLYKIKVQNCKIFYSDSTLCIFVSFYFTTKTVYI
Ga0192946_104423113300019103MarineMGQKVDARVFREGVNKKNWEFKYIEKNKEDSSLFLYKTLEIQKYLNRFFGLYKIKIHNCKIFYSDSSLQIFISFYVTTRTFYAISKNITKYSKKCTAVFKPAFSNRHKKVKSHRLRKIVMKSVKAYA
Ga0180037_117496713300019214EstuarineMGQKTDARIFRQGVAKKNXDLKYIEKSDEDSSIYIYKTLEIKKYLNRFFGLYKIKIHNCKIFYSDSSLQVFVSFYLTTKTKYVINKKIIKYSKEFSIPRKR
Ga0193974_102526213300019726SedimentMAQKTDARIFRQSVEKKNXELKHIEKNNEESSLYLYNTLEIQKYLNRFFELYKIKIHNCRIFYSDNSLHVFVSFYLTTKTISVINKNLVKYSKK
Ga0207193_187335213300020048Freshwater Lake SedimentMGQKVDARIFRLGICKKNXEQKYIEKNNEESSLYLYKTLEIQKYINRIFDLYKIKIHNCKIFYSDNSLQIFISFYVTEKTIHIIDKNLIK
Ga0194113_1068317713300020074Freshwater LakeMGQKTDARIFRQGITKKNXEFRNIEKNNEESSLFLYKTLEVQRYLNRFFGLYKMKIHNCKIFYSHSSLQVFISFYITEKTIYVLRKNLTKYSK
Ga0210302_111547023300021299EstuarineMGQKTDARIFRQGVYRKNXEFRHVAKNDEESSLFLYKTLEVQRYLNRFFGLYKIKIHNCKIFYSHGFLLIFVSFYLTAKTIYVIRKSLTKYSKKLSTQVK
Ga0210295_119206843300021323EstuarineMGQKVDARIFRLGVCKKTXEHKYIEKKSEESSLYLYKTLEIRKYIYRIFDLYKIKIHNCKVSYSENSIQIVISFYLTE
Ga0206693_131104023300021353SeawaterMGQKTDARIFRQGVGKKNXELKHIEKNNEESSLYLYKTLEIQKYITRFFGLYKMKIHNCKIFYSESSLQIFISFYVTKKTIYIINKTLTKYSKKLSIRTRRAFSKKKNXKRRNWL
Ga0213860_1003439143300021368SeawaterMGQKTDARIFRKGVKKKNXEIKYIEKNNEDVSLYIYKTLEIQKYLNRFFGLYKMKIHSYKIFYSDSSLQIFISFYFTTKTMYVIKRKLKKQGTITKPKNIK
Ga0213865_1033288033300021373SeawaterMGQKTDARIFRLGVTRKNXESKYIEKNNEESSLYLYKTLEIQKYLNRFFGLYKIKIHNCKIFYSENVLQIFISFYLTAKTLYIINRNLTKYSKKS
Ga0213866_1007812343300021425SeawaterMGQKTDARIFRLGVTRKNXESKYIEKNNEESSLYLYKTLEIQKYLNRFFGLYKIKIHNCKIFYSENVLQIFISFYLTAKTLYIINRNLTKYS
Ga0222714_1054889113300021961Estuarine WaterMGQKTDARIFRQGILKKNXNFKYSDKNLEESSFCLYKTFEIQKYLHRFFDLYKIKVYNCKVFYSTHSLKIFISFYITRKTIFLI
Ga0210312_11672313300022367EstuarineMGQKTDARIFRQGLNQKNXELKHIEKNKEESFVYLYKRLEMQKYLNRFFELYKMKIHNCRIFYSDGSLQIFISFYLTAKTVYIINKHLTKYSKKLLLTRVSRA
Ga0210313_100608243300022375EstuarineMGQKVDARIFRLGVCKKTXEHKYIEKKSEESSLYLYKTLEIRKYIYRIFDLYKIKIHNCKVSYSENSIQIVISFYLTEKTINIIDKNLTRYQKKFSIRIK
Ga0210313_103856713300022375EstuarineMGQKTDARIFRQGLNQKNXELKHIEKNNEESSLYLYKTLEIQKYLNRFFELYKMKIHNCRIFYSDGSLQIFISFYLTAKTVYIINKHLTKYSKKLLLTRVSR
(restricted) Ga0255039_1052945813300024062SeawaterMGQKTDARIFRLGVAKKNXESKYIEKNNEESSLYLYKTLEIQKYLNRFFGLYKIKIHNCKLFYSENSLQIFISFYLTTKTLYAINKHL
Ga0244775_1016544443300024346EstuarineMGQKTDARIFRQGIHKKTWELKHIEKNNEELSLYLYKTLKIQEYINRFFKLYKIKIHNCKISYSESSLQIYISFYITTKVFSAINKNITKYSEECLILSRFLPSNEKKRNWKRN
Ga0255294_106741513300024544FreshwaterMGQKVDARIFRLGICKKNXEQKYIEKNNEESSLYLYKTLEIQKYINRIFDLYKIKIHNCKIFYSDNSLQIFISFYLTEKTIQIIDKN
Ga0256337_118999923300024573FreshwaterMGQKVDARIFRLGVCKKTXEQKYIEKKSEESSFYLYKTLEIRKYIYRIFDLYKIKIHNCKIFYSENSIQIFISFYLTEKTINIIDKNL
Ga0209652_104374613300025684MarineMGQKVDARIFRLGVGKKNXELKHIEKNNEESSLYLYKTLEIQKYLNRFFGLYKIKIHNCKLFYSENSLQIFISFYLTTKTLYAINKHLTKYSKKYSTYFKRLQARLKI
Ga0209771_117081413300025701MarineMGQKTDARIFRLGVTKKNXESKYIEKNNEESSLYLYKTLEIQKYLSRFFGLYKIKIHTCKLFYSENTLQVFISFYLTTKTLYVISKHLTKYSKRSLTCFKRLQTHVRIN
Ga0208005_100191913300025848AqueousMGQKTDARIFRQGIHKKNXESKYIEKNNEESSLYLYKTLEIQKYLNRFFELYKIKIHNCRIFYSNGSLYVFVSFYLTAKTIYAINKDLIRYSKKFLLRTKRASSKKK
Ga0208171_101443113300027230EstuarineMGQKIDARIFRQGVNKKNXEFKYIEKNNEESSLYLYKTLEIQKYVNRFFGLYRIKIHNCKIFYSDSSLQIFVSFYLTTKTFYIINKHVVKYSSKFLV
Ga0208171_101823613300027230EstuarineMGQKTNASIFRQGLLKKNXEIKTLEKNKEESSFFLYKTLEIQKYINRFFGLYEIKIHNCKIFYSDNSLQIFVSF
Ga0208445_102941913300027245EstuarineMGQKIDARIFRQGVNKKNXEFKYIEKNNEESSLYLYKTLEIQKYVNRFFGLYRIKIHNCKIFYSDSSLQIFVSFYLTTKTFYIINKHVVKYSSKFLVPSQS
Ga0208175_102422323300027249EstuarineMGQKTNASIFRQGLLKKNXEIKTLEKNKEESSFFLYKTLEIQKYINRFFGLYEIKIHNCKIFYSDNSLQIFVSFYTTIKTIYIINKMQV
Ga0209815_107563633300027714MarineELKHIDKNNEESSLFLYKTLEVQKYLNRFFKLYKIKVHNCKIFYSDSSLQVFVSFYVTPKTFYAINKDVTKYSKEFLVPSRSAASNKQRIS
Ga0208305_1018846023300027753EstuarineMGQKTDARIFRQGLNQKNXELKHIEKNNEESSLYLYKTLEIQKYLNRFFELYKMKIHNCRIFYSDGSLQIFISFYLTAKTVYIINKHLTKYSKKLLLTRVSRAS
Ga0307489_1002114023300031569Sackhole BrineMGQKTDARIFRQGVNKKNWELKHIEKNNEESSLYLYKTLEIQKYLNRFFGLYKIKIHNCKIFYSDSSLQIFVSFYITTKTFYVIKKNVTKYSKEFSTEFHPTLSNEQKKNWKKKN
Ga0316201_1177745013300032136Worm BurrowMGQKTDARIFRLGVTRKNXESKYIEKNNEESSLYLYKTLEIQKYLNRFFGLYKIKIHNCKIFYSENVLQIFISFYLTAKTLYII
Ga0316189_1059038523300032272Worm BurrowMGQKTNARIFRQGLIKKNXEIKTLEKNKEESSLFLYKTLEIQKYINRFFGLYEIKIHNCKIFYSDNSLQIFVSFYTTIKTIYIINKKVVKKI

 ⦗Top⦘


Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.