NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome / Metatranscriptome Family F081745

Metagenome / Metatranscriptome Family F081745

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F081745
Family Type Metagenome / Metatranscriptome
Number of Sequences 114
Average Sequence Length 57 residues
Representative Sequence MKQMDSLGVAGSIGNFEQVFEDMDVKTGDMNAALDNIYSTSIDNGEVMDLLNQMRD
Number of Associated Samples 98
Number of Associated Scaffolds 114

Quality Assessment
Transcriptomic Evidence Yes
Most common taxonomic group Eukaryota
% of genes with valid RBS motifs 43.36 %
% of genes near scaffold ends (potentially truncated) 10.53 %
% of genes from short scaffolds (< 2000 bps) 99.12 %
Associated GOLD sequencing projects 89
AlphaFold2 3D model prediction Yes
3D model pTM-score0.37

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Eukaryota (95.614 % of family members)
NCBI Taxonomy ID 2759
Taxonomy All Organisms → cellular organisms → Eukaryota

Most Common Ecosystem
GOLD Ecosystem Environmental → Aquatic → Marine → Unclassified → Unclassified → Marine
(47.368 % of family members)
Environment Ontology (ENVO) Unclassified
(71.053 % of family members)
Earth Microbiome Project Ontology (EMPO) Free-living → Saline → Water (saline)
(78.070 % of family members)


 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      

 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Globular Signal Peptide: No Secondary Structure distribution: α-helix: 60.71%    β-sheet: 0.00%    Coil/Unstructured: 39.29%
Feature Viewer
Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer
Per-residue confidence (pLDDT):
  0-50   51-70   71-90   91-100  		pTM-score: 0.37
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.

 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 114 Family Scaffolds
PF03357Snf7 20.18

Neighboring Clusters of Orthologous Genes (COGs)

COG IDNameFunctional Category % Frequency in 114 Family Scaffolds
COG5491Archaeal cell division protein CdvB, Snf7/Vps24/ESCRT-III familyCell cycle control, cell division, chromosome partitioning [D] 20.18

 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms95.61 %
UnclassifiedrootN/A4.39 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
3300004112|Ga0065166_10432098All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida552Open in IMG/M
3300006165|Ga0075443_10235488All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida662Open in IMG/M
3300006396|Ga0075493_1528593All Organisms → cellular organisms → Eukaryota509Open in IMG/M
3300006397|Ga0075488_1104504All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Ochrophyta → Bacillariophyta → Bacillariophyceae → Bacillariophycidae → Naviculales → Phaeodactylaceae → Phaeodactylum → Phaeodactylum tricornutum706Open in IMG/M
3300006415|Ga0099654_10324227All Organisms → cellular organisms → Eukaryota652Open in IMG/M
3300006415|Ga0099654_10324228All Organisms → cellular organisms → Eukaryota685Open in IMG/M
3300006641|Ga0075471_10601168All Organisms → cellular organisms → Eukaryota540Open in IMG/M
3300006803|Ga0075467_10267779All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida920Open in IMG/M
3300006803|Ga0075467_10470872All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida648Open in IMG/M
3300006805|Ga0075464_10455221All Organisms → cellular organisms → Eukaryota781Open in IMG/M
3300006917|Ga0075472_10285451All Organisms → cellular organisms → Eukaryota814Open in IMG/M
3300007559|Ga0102828_1086357All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida755Open in IMG/M
3300007725|Ga0102951_1082616All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida918Open in IMG/M
3300007861|Ga0105736_1112309All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida600Open in IMG/M
3300008832|Ga0103951_10320642All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida805Open in IMG/M
3300008938|Ga0103741_1128935All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida515Open in IMG/M
3300008958|Ga0104259_1017454All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida701Open in IMG/M
3300009001|Ga0102963_1325335All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida604Open in IMG/M
3300009152|Ga0114980_10436153All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida749Open in IMG/M
3300009216|Ga0103842_1012954All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida758Open in IMG/M
3300009269|Ga0103876_1058856All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida561Open in IMG/M
3300009274|Ga0103878_1047471All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida510Open in IMG/M
3300009279|Ga0103880_10060067All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida566Open in IMG/M
3300009447|Ga0115560_1241455All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida694Open in IMG/M
3300009544|Ga0115006_10969206All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida753Open in IMG/M
3300009606|Ga0115102_10797892All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida513Open in IMG/M
3300009677|Ga0115104_11053531All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida556Open in IMG/M
3300010981|Ga0138316_10374911All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida506Open in IMG/M
3300012780|Ga0138271_1134125All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida584Open in IMG/M
3300012952|Ga0163180_10768063All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida751Open in IMG/M
3300012953|Ga0163179_11654903All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida580Open in IMG/M
3300013286|Ga0136641_1097294All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida821Open in IMG/M
3300013295|Ga0170791_11304930Not Available629Open in IMG/M
3300013295|Ga0170791_12980432All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida608Open in IMG/M
3300013295|Ga0170791_15750137All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida612Open in IMG/M
3300017166|Ga0186523_111263All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida815Open in IMG/M
3300017782|Ga0181380_1125102All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida883Open in IMG/M
3300017788|Ga0169931_10580883All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida766Open in IMG/M
3300018533|Ga0193523_111007All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida603Open in IMG/M
3300018622|Ga0188862_1018401All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida649Open in IMG/M
3300018657|Ga0192889_1056787All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida533Open in IMG/M
3300018684|Ga0192983_1051392All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida567Open in IMG/M
3300018706|Ga0193539_1048535All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida698Open in IMG/M
3300018713|Ga0192887_1024500All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida781Open in IMG/M
3300018720|Ga0192866_1062401All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida572Open in IMG/M
3300018764|Ga0192924_1036233All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida605Open in IMG/M
3300018765|Ga0193031_1072468All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida582Open in IMG/M
3300018771|Ga0193314_1047590All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida751Open in IMG/M
3300018771|Ga0193314_1062202All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida633Open in IMG/M
3300018796|Ga0193117_1062179All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida616Open in IMG/M
3300018804|Ga0193329_1083372All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida609Open in IMG/M
3300018813|Ga0192872_1074320All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida588Open in IMG/M
3300018813|Ga0192872_1084112All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida543Open in IMG/M
3300018813|Ga0192872_1089078All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida523Open in IMG/M
3300018819|Ga0193497_1061954All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida693Open in IMG/M
3300018838|Ga0193302_1067839All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida594Open in IMG/M
3300018903|Ga0193244_1067900All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida659Open in IMG/M
3300018927|Ga0193083_10044389All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida643Open in IMG/M
3300018929|Ga0192921_10168344All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida673Open in IMG/M
3300018947|Ga0193066_10228853All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida523Open in IMG/M
3300018961|Ga0193531_10245659All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida648Open in IMG/M
3300018964|Ga0193087_10295519Not Available502Open in IMG/M
3300018974|Ga0192873_10266418All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida738Open in IMG/M
3300018989|Ga0193030_10172482All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida707Open in IMG/M
3300018995|Ga0193430_10090088All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida725Open in IMG/M
3300018996|Ga0192916_10137436All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida732Open in IMG/M
3300018996|Ga0192916_10170908All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida644Open in IMG/M
3300018996|Ga0192916_10172915All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida639Open in IMG/M
3300018996|Ga0192916_10209274All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida565Open in IMG/M
3300018996|Ga0192916_10210938All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida562Open in IMG/M
3300018999|Ga0193514_10177616All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida772Open in IMG/M
3300018999|Ga0193514_10266596All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida594Open in IMG/M
3300018999|Ga0193514_10268486All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida591Open in IMG/M
3300018999|Ga0193514_10319191All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida523Open in IMG/M
3300019001|Ga0193034_10109631All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida641Open in IMG/M
3300019007|Ga0193196_10467766All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida516Open in IMG/M
3300019009|Ga0192880_10063932All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida932Open in IMG/M
3300019011|Ga0192926_10292239All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida698Open in IMG/M
3300019011|Ga0192926_10350750All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida629Open in IMG/M
3300019020|Ga0193538_10261925All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida554Open in IMG/M
3300019022|Ga0192951_10181974All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum761Open in IMG/M
3300019035|Ga0192875_10096252All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida808Open in IMG/M
3300019048|Ga0192981_10248618Not Available681Open in IMG/M
3300019049|Ga0193082_10480593All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida687Open in IMG/M
3300019050|Ga0192966_10206015All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida703Open in IMG/M
3300019085|Ga0188830_1014665All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida642Open in IMG/M
3300019133|Ga0193089_1057782All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida943Open in IMG/M
3300019150|Ga0194244_10071962All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida611Open in IMG/M
3300020183|Ga0194115_10260489All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida814Open in IMG/M
3300021898|Ga0063097_1076671All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida553Open in IMG/M
3300021908|Ga0063135_1080952All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida505Open in IMG/M
3300021921|Ga0063870_1057163All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida532Open in IMG/M
3300021925|Ga0063096_1070962All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida631Open in IMG/M
3300024346|Ga0244775_10723981All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida800Open in IMG/M
3300025848|Ga0208005_1155632All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida712Open in IMG/M
3300025872|Ga0208783_10344798All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida584Open in IMG/M
3300025887|Ga0208544_10215412All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida786Open in IMG/M
3300025896|Ga0208916_10243395All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida781Open in IMG/M
3300027754|Ga0209596_1219219All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida800Open in IMG/M
3300027771|Ga0209279_10198171All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida598Open in IMG/M
3300027810|Ga0209302_10241390All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida853Open in IMG/M
3300027885|Ga0209450_10485227All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida904Open in IMG/M
3300028282|Ga0256413_1366482Not Available503Open in IMG/M
3300030653|Ga0307402_10941433All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida502Open in IMG/M
3300031113|Ga0138347_10138272All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida501Open in IMG/M
3300031113|Ga0138347_10860047All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida726Open in IMG/M
3300031638|Ga0302125_10181396All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida658Open in IMG/M
3300031717|Ga0307396_10319817All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea742Open in IMG/M
3300031729|Ga0307391_10626411All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida610Open in IMG/M
3300031739|Ga0307383_10309037All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida766Open in IMG/M
3300031750|Ga0307389_10405705All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida861Open in IMG/M
3300031784|Ga0315899_10861060All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida822Open in IMG/M
3300033572|Ga0307390_11081779All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida509Open in IMG/M


 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
MarineEnvironmental → Aquatic → Marine → Unclassified → Unclassified → Marine47.37%
MarineEnvironmental → Aquatic → Marine → Oceanic → Unclassified → Marine14.04%
AqueousEnvironmental → Aquatic → Marine → Coastal → Unclassified → Aqueous9.65%
FreshwaterEnvironmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater3.51%
Freshwater LakeEnvironmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lake2.63%
Freshwater LakeEnvironmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake2.63%
Surface Ocean WaterEnvironmental → Aquatic → Marine → Oceanic → Unclassified → Surface Ocean Water2.63%
LakeEnvironmental → Aquatic → Freshwater → Lake → Unclassified → Lake1.75%
SeawaterEnvironmental → Aquatic → Marine → Oceanic → Unclassified → Seawater1.75%
Freshwater Lake SedimentEnvironmental → Aquatic → Freshwater → Lentic → Sediment → Freshwater Lake Sediment0.88%
FreshwaterEnvironmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater0.88%
Freshwater LakeEnvironmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake0.88%
FreshwaterEnvironmental → Aquatic → Freshwater → Unclassified → Unclassified → Freshwater0.88%
River WaterEnvironmental → Aquatic → Freshwater → Unclassified → Unclassified → River Water0.88%
SeawaterEnvironmental → Aquatic → Marine → Coastal → Unclassified → Seawater0.88%
Estuary WaterEnvironmental → Aquatic → Marine → Coastal → Unclassified → Estuary Water0.88%
EstuarineEnvironmental → Aquatic → Marine → Intertidal Zone → Estuary → Estuarine0.88%
EstuarineEnvironmental → Aquatic → Marine → Unclassified → Unclassified → Estuarine0.88%
Pelagic MarineEnvironmental → Aquatic → Marine → Pelagic → Unclassified → Pelagic Marine0.88%
SeawaterEnvironmental → Aquatic → Marine → Strait → Unclassified → Seawater0.88%
Pond WaterEnvironmental → Aquatic → Non-Marine Saline And Alkaline → Saline → Unclassified → Pond Water0.88%
WaterEnvironmental → Aquatic → Non-Marine Saline And Alkaline → Saline → Unclassified → Water0.88%
Host-AssociatedHost-Associated → Human → Digestive System → Large Intestine → Fecal → Host-Associated0.88%
Ocean WaterEnvironmental → Aquatic → Marine → Oceanic → Unclassified → Ocean Water0.88%
Ice Edge, Mcmurdo Sound, AntarcticaEnvironmental → Aquatic → Marine → Oceanic → Unclassified → Ice Edge, Mcmurdo Sound, Antarctica0.88%

Visualization
Powered by ApexCharts



Associated Samples

Taxon OIDSample NameHabitat TypeIMG/M Link
3300004112Freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MLB.SD (version 2)EnvironmentalOpen in IMG/M
3300006165Marine microbial communities from the West Antarctic Peninsula - Coastal water metaG006-DNAEnvironmentalOpen in IMG/M
3300006396Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Spr_20_>0.8_RNA2 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300006397Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Fall_30_>0.8_RNA2 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300006415Algae and Fungi communities from freshwater lake (pre-blooming) in Auvergne, France - collected by filtering lake water, a 'reference genome' of the lake communityEnvironmentalOpen in IMG/M
3300006641Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_0.19_D_>0.8_DNAEnvironmentalOpen in IMG/M
3300006803Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Spr_20_>0.8_DNAEnvironmentalOpen in IMG/M
3300006805Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Spr_0.19_<0.8_DNAEnvironmentalOpen in IMG/M
3300006917Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_0.19_N_<0.8_DNAEnvironmentalOpen in IMG/M
3300007559Estuarine microbial communities from the Columbia River estuary - Freshwater metaG S.541EnvironmentalOpen in IMG/M
3300007725Water microbial communities from South San Francisco under conditions of wetland restoration - Salt Pond MetaG R2A_B_H2O_MGEnvironmentalOpen in IMG/M
3300007861Coastal water column microbial communities from Columbia River Estuary, Oregon, USA - CMOP_DNA_1372B_3umEnvironmentalOpen in IMG/M
3300008832Eukaryotic communities of water collected during the Tara Oceans expedition - TARA_A200000150EnvironmentalOpen in IMG/M
3300008938Eukaryotic and microbial communities from ice edge, McMurdo Sound, Antarctica - 4AEnvironmentalOpen in IMG/M
3300008958Marine microbial communities from eastern North Pacific Ocean - P1 particle-associatedEnvironmentalOpen in IMG/M
3300009001Salt pond water microbial communities from South San Francisco under conditions of wetland restoration - Salt Pond MetaG SF2_C_H2O_MGEnvironmentalOpen in IMG/M
3300009152Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_140806_EF_MetaGEnvironmentalOpen in IMG/M
3300009216Microbial communities of water from the North Atlantic ocean - ACM47EnvironmentalOpen in IMG/M
3300009269Eukaryotic communities of water from the North Atlantic ocean - ACM28EnvironmentalOpen in IMG/M
3300009274Eukaryotic communities of water from the North Atlantic ocean - ACM10EnvironmentalOpen in IMG/M
3300009279Eukaryotic communities of water from the North Atlantic ocean - ACM42EnvironmentalOpen in IMG/M
3300009447Pelagic marine microbial communities from North Sea - COGITO_mtgs_110509EnvironmentalOpen in IMG/M
3300009544Marine eukaryotic phytoplankton communities from Arctic Ocean - Arctic Ocean- Svalbard ARC20M MetagenomeEnvironmentalOpen in IMG/M
3300009606Marine eukaryotic communities from Pacific Ocean to study complex ecological interactions - MBTS_5May14_M2_3um Metatranscriptome (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300009677Marine eukaryotic communities from Pacific Ocean to study complex ecological interactions - CN13ID_70_C50_10m_0.8um Metatranscriptome (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300010981Metatranscriptome of Marine eukaryotic phytoplankton communities from the Antarctic Ocean - ANT-7 (Eukaryote Community Metatranscriptome) (version 4)EnvironmentalOpen in IMG/M
3300012780Freshwater microbial communities from Lake Croche, Canada - C_130625_M_mt (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300012952Marine eukaryotic phytoplankton communities from the Atlantic Ocean - Atlantic ANT 4 MetagenomeEnvironmentalOpen in IMG/M
3300012953Marine eukaryotic phytoplankton communities from the Atlantic Ocean - Atlantic ANT 2 MetagenomeEnvironmentalOpen in IMG/M
3300013286Freshwater microbial communities from Elizabeth Lake, Yosemite National Park, California, USA - 13020-23YEnvironmentalOpen in IMG/M
3300013295northern Canada Lakes metatranscriptome co-assemblyEnvironmentalOpen in IMG/M
3300017166Metatranscriptome of marine eukaryotic communities from Atlantic Ocean in filtered seawater, 15 C, 29.4 psu salinity and 162 ?mol photons light - Favella taraikaensis Fe Narragansett Bay (MMETSP0436)Host-AssociatedOpen in IMG/M
3300017782Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 3 SPOT_SRF_2009-08-19EnvironmentalOpen in IMG/M
3300017788Freshwater microbial communities from Lake Kivu, Western Province, Rwanda to study Microbial Dark Matter (Phase II) - Kivu_15m_20LEnvironmentalOpen in IMG/M
3300018533Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_147 - TARA_N000002107 (ERX1789415-ERR1719338)EnvironmentalOpen in IMG/M
3300018622Metatranscriptome of marine microbial communities from Baltic Sea - GS684_3p0_dTEnvironmentalOpen in IMG/M
3300018657Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_068 - TARA_N000000705 (ERX1789382-ERR1719418)EnvironmentalOpen in IMG/M
3300018684Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_085 - TARA_N000001034 (ERX1782225-ERR1712160)EnvironmentalOpen in IMG/M
3300018706Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_153 - TARA_N000002813 (ERX1789488-ERR1719151)EnvironmentalOpen in IMG/M
3300018713Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_068 - TARA_N000000703 (ERX1782432-ERR1712119)EnvironmentalOpen in IMG/M
3300018720Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_066 - TARA_N000000793 (ERX1789656-ERR1719302)EnvironmentalOpen in IMG/M
3300018764Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_076 - TARA_N000000868 (ERX1782470-ERR1712186)EnvironmentalOpen in IMG/M
3300018765Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_152 - TARA_N000002803 (ERX1782330-ERR1712010)EnvironmentalOpen in IMG/M
3300018771Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_102 - TARA_N000001658 (ERX1789535-ERR1719438)EnvironmentalOpen in IMG/M
3300018796Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_004 - TARA_X000000410 (ERX1789505-ERR1719432)EnvironmentalOpen in IMG/M
3300018804Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_109 - TARA_N000001738 (ERX1789642-ERR1719208)EnvironmentalOpen in IMG/M
3300018813Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_066 - TARA_N000000809 (ERX1782297-ERR1712172)EnvironmentalOpen in IMG/M
3300018819Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_137 - TARA_N000002940 (ERX1789719-ERR1719288)EnvironmentalOpen in IMG/M
3300018838Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_102 - TARA_N000001646 (ERX1789439-ERR1719515)EnvironmentalOpen in IMG/M
3300018888Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_102 - TARA_N000001648 (ERX1789571-ERR1719332)EnvironmentalOpen in IMG/M
3300018903Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_080 - TARA_N000001499 (ERX1789636-ERR1719512)EnvironmentalOpen in IMG/M
3300018927Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_064 - TARA_N000000531 (ERX1782133-ERR1712125)EnvironmentalOpen in IMG/M
3300018929Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_072 - TARA_N000000843 (ERX1782134-ERR1712223)EnvironmentalOpen in IMG/M
3300018947Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_142 - TARA_N000003102 (ERX1782406-ERR1712029)EnvironmentalOpen in IMG/M
3300018961Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_152 - TARA_N000002783 (ERX1789414-ERR1719458)EnvironmentalOpen in IMG/M
3300018964Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_065 - TARA_N000000939 (ERX1782328-ERR1712130)EnvironmentalOpen in IMG/M
3300018974Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_066 - TARA_N000000809 (ERX1782160-ERR1711971)EnvironmentalOpen in IMG/M
3300018989Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_152 - TARA_N000002803 (ERX1782326-ERR1711934)EnvironmentalOpen in IMG/M
3300018995Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_128 - TARA_N000002299 (ERX1782426-ERR1711902)EnvironmentalOpen in IMG/M
3300018996Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_072 - TARA_N000000839 (ERX1782178-ERR1712156)EnvironmentalOpen in IMG/M
3300018999Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_142 - TARA_N000003100 (ERX1782275-ERR1712038)EnvironmentalOpen in IMG/M
3300019001Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_009 - TARA_X000001043 (ERX1782383-ERR1712007)EnvironmentalOpen in IMG/M
3300019007Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_039 - TARA_N000000011 (ERX1782393-ERR1712012)EnvironmentalOpen in IMG/M
3300019009Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_067 - TARA_N000000756 (ERX1782233-ERR1711966)EnvironmentalOpen in IMG/M
3300019011Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_076 - TARA_N000000871 (ERX1782184-ERR1712079)EnvironmentalOpen in IMG/M
3300019020Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_153 - TARA_N000002813 (ERX1789673-ERR1719264)EnvironmentalOpen in IMG/M
3300019022Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_082 - TARA_N000001390 (ERX1782474-ERR1712194)EnvironmentalOpen in IMG/M
3300019035Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_067 - TARA_N000000742 (ERX1789492-ERR1719296)EnvironmentalOpen in IMG/M
3300019048Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_085 - TARA_N000001030 (ERX1782209-ERR1712166)EnvironmentalOpen in IMG/M
3300019049Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_064 - TARA_N000000531 (ERX1782179-ERR1712232)EnvironmentalOpen in IMG/M
3300019050Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_084 - TARA_N000001438 (ERX1782371-ERR1711865)EnvironmentalOpen in IMG/M
3300019085Metatranscriptome of marine microbial communities from Baltic Sea - GS670_3p0_dTEnvironmentalOpen in IMG/M
3300019133Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_083 - TARA_N000001377 (ERX1782440-ERR1712071)EnvironmentalOpen in IMG/M
3300019150Eukaryotic communities of water from different depths collected during the Tara Oceans expedition - TARA_N000000616 (ERX1782105-ERR1711908)EnvironmentalOpen in IMG/M
3300020183Freshwater microbial communities from Lake Tanganyika, Tanzania - TA2015002 Mahale S4 surfaceEnvironmentalOpen in IMG/M
3300021898Metatranscriptome of marine eukaryotic phytoplankton communities from the Arctic Ocean - ARK-55S (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300021908Metatranscriptome of Marine eukaryotic phytoplankton communities from the Atlantic Ocean - Stratiphyt 2011 S11 C1 B13 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300021921Metatranscriptome of marine eukaryotic phytoplankton communities from Norwegian Sea - 10m ARK-5M ARK-5-3 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300021925Metatranscriptome of marine eukaryotic phytoplankton communities from the Arctic Ocean - ARK-51M (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300024346Whole water sample coassemblyEnvironmentalOpen in IMG/M
3300025848Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_0.19_N_<0.8_DNA (SPAdes)EnvironmentalOpen in IMG/M
3300025872Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_0.19_D_>0.8_DNA (SPAdes)EnvironmentalOpen in IMG/M
3300025887Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Spr_20_>0.8_DNA (SPAdes)EnvironmentalOpen in IMG/M
3300025896Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Spr_0.19_<0.8_DNA (SPAdes)EnvironmentalOpen in IMG/M
3300027754Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_130807_MF_MetaG (SPAdes)EnvironmentalOpen in IMG/M
3300027771Marine microbial communities from the West Antarctic Peninsula - Coastal water metaG006-DNA (SPAdes)EnvironmentalOpen in IMG/M
3300027810Marine eukaryotic phytoplankton communities from Arctic Ocean - Arctic Ocean ARC135M Metagenome (SPAdes)EnvironmentalOpen in IMG/M
3300027885Freshwater lake sediment microbial communities from the University of Notre Dame, USA, for methane emissions studies - LWP11 LW (SPAdes)EnvironmentalOpen in IMG/M
3300028282Metatranscriptome of seawater microbial communities from Monterey Bay, California, United States - WCR_77 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300030653Metatranscriptome of marine eukaryotic phytoplankton communities from Antarctic Ocean - PS103-29 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300031113Marine microbial communities from the Southern Atlantic ocean transect - DeepDOM_S7_Trap_metaT (Eukaryote Community Metatranscriptome) (version 2)EnvironmentalOpen in IMG/M
3300031638Marine microbial communities from Western Arctic Ocean, Canada - CB4_surfaceEnvironmentalOpen in IMG/M
3300031717Metatranscriptome of marine eukaryotic phytoplankton communities from Antarctic Ocean - PS103-6 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300031729Metatranscriptome of marine eukaryotic phytoplankton communities from South Atlantic Ocean ? PS103-4.R2 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300031739Metatranscriptome of marine eukaryotic phytoplankton communities from South Atlantic Ocean ? PS103-1.R3 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300031750Metatranscriptome of marine eukaryotic phytoplankton communities from South Atlantic Ocean ? PS103-3.R3 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300031784Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 4 MA112EnvironmentalOpen in IMG/M
3300033572Metatranscriptome of marine eukaryotic phytoplankton communities from South Atlantic Ocean ? PS103-4.R1 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap


 ⦗Top⦘

Family Sequences

Protein ID Sample Taxon ID Habitat Sequence
Ga0065166_1043209813300004112Freshwater LakeVAGSVGDFEKLFEDMDVKTEEMNGALDNVYATSIDNNEVMNLLNEMRDQQQME
Ga0075443_1023548823300006165MarineMLQKCMKQMDSLGVAGSIGSFEEVFEDMDVKTGDMNAALDNIYSTSIDNGEVMELLTQMRD*
Ga0075493_152859313300006396AqueousMDSIGVAGSIGDFEELFETMDVKTQEMNGALDNVYSTSIDNGEVMSLLNEMKDMQQME
Ga0075488_110450413300006397AqueousMLQRCMKQMDSLGVAGSIGSFEQVFEDMDVKTGDMNAALDNIYSTSIDNGEVMDLLT*
Ga0099654_1032422713300006415LakeMKKMDSIGVAGSVGDFEKLFEDMDVKTEEMNGALDNVYSTSIDNGEVMNLLNEMRD*
Ga0099654_1032422813300006415LakeVGDFEKLFEDMDVKTEEMNGALDNVYSTSIDNGEVMNLLNEMRD*
Ga0075471_1060116833300006641AqueousMQMGENIGEFEKIFEDLDVKVEEMNGALDGVYSTSIDNGEVTDLLAE
Ga0075467_1026777923300006803AqueousMKQMDSLGAAGSIGSFEQVFEDLDVKTGDMNAALDNIYSTSIDNGEVM*
Ga0075467_1047087223300006803AqueousMLQKCMKQMDSLGVAGSIGNFEQVFEDLDVKTGDMNAALDNIYSTSIDNGEVM*
Ga0075464_1045522113300006805AqueousLQIAGSIGDFEKVFEDMDVKTEEMNGALENIYGSSIDNNEVMQLLNEMRD*
Ga0075472_1028545133300006917AqueousMDSLGVAGSIGSFEQVFEDLDVKTGDMNAALDNIYSTSIDNNEVMELLSQMRDQQVMEAGG*
Ga0102828_108635713300007559EstuarineVAGSVGDFEKLFEDMDVKTEEMNGALDNIYGSSIDNSEVMNLLNEMRD*
Ga0102951_108261633300007725WaterMDSLGVAGSIGSFEQVFEDMDVKTGDMNAALDNIYSTSIDNGEVMELLNQMRDQQTMEAGG*
Ga0105736_111230913300007861Estuary WaterMLKKCMKDMDSIGVSGSIGEFEKVFEDLDVKVEEMNGALDGVYSSSIDNGEVSDLLAELG
Ga0103951_1032064223300008832MarineMKQMDSIGVAGSIGDFEKVFEDLDVKTGDINQAMDNIYSTSIDNGEVMQLLNQMRD*
Ga0103741_112893523300008938Ice Edge, Mcmurdo Sound, AntarcticaMDSLGVAGSIGSFEQVFEDLDVKTGDMNAGLDNIYSTSIDNGEVMELLTAMKD*
Ga0104259_101745423300008958Ocean WaterMGSMEAFESVFEDLDVKTGEMNDAMDNIYGGSIDNGEVAELLT*
Ga0102963_132533533300009001Pond WaterLALFFQVAGSIGDFEKIFEDLDVKTEEMNGALDNVYSTSIDNG
Ga0114980_1043615313300009152Freshwater LakeVAGSVGDFEKLFEDMDVKTEEMNGALDNIYGSSIDNNEVMNLLNEMRD*
Ga0103842_101295413300009216River WaterMDAIGAAGSIGDFEKVFEDLDVKTGEMNSALDNVYSTSIDNGEVM*
Ga0103876_105885623300009269Surface Ocean WaterMDALGAAGSIGQFEKVFEDLDVKTGEMNDALDGVYSTSIDNGEVAQLLQ*
Ga0103878_104747123300009274Surface Ocean WaterMLQKAMKQMDSLGVAGSIGSFEQVFEDMDVKTGDMNAALDNIYSTSIDNGEVMDLLTQMRD*
Ga0103880_1006006713300009279Surface Ocean WaterMDAIGAAGSMGAFEKVFEDLDVKTGEMNDALDTIGASSVDNGEVM*
Ga0115560_124145523300009447Pelagic MarineMGSMEAFENVFEDLDVKTGEMNDAMDNIYGGSIDNGEVAELLS*
Ga0115006_1096920633300009544MarineMKQMDSLGVAGSIGNFEQVFEDMDVKTGDMNAALDNIYSTSIDNGEVMDLLNQMRD*
Ga0115102_1079789223300009606MarineMKQMDSIGAAGSIGSFEQVFEDLDVKTGDMNAALDNIYSTSIDNGEVMTLLTQMR
Ga0115104_1105353113300009677MarineMKQMDSIGVAGSIGDFEKVFEDLDVKTGDINQAMDNIYSTSIDNGEVMQLLNQMKDQQTMEAGGEIGVGTGGI*
Ga0138316_1037491123300010981MarineMDAIGAAGSIGDFEKVFEDLDVKTGELNDAMDNVYSTSIDNGEVMNLLNQMRD*
Ga0138271_113412533300012780Freshwater LakeMKKMDSIGVAGSVGDFDKLFEDMDVKTEEMNGALDNVYSTSIDNSEVMNLLNEMRD*
Ga0163180_1076806313300012952SeawaterMLQRCMKQMDSLGVAGSIGSFEQVFEDMDVKTGDMNAALDNIYSTSIDNGEVMELLNQMRDQQTMEAGGEIAAGAG*
Ga0163179_1165490333300012953SeawaterMDALGVAGSIGDFEKVFEDLDVKTGDMNQALDSIYSTSIDNGEVMNL
Ga0136641_109729433300013286FreshwaterVAGAVGDFEKIFEDMDVKTEEMNGALDNVYASSVDNGEVMNLLNEMRDMQ*
Ga0170791_1130493023300013295FreshwaterMKKMDSIGVAGSIGDFERIFEDMDVKTEEMNGALDNVYSTSIDNNEVMTLLNEMRDQQQMAVGGEIAGANKNAINPQKSAA*
Ga0170791_1298043223300013295FreshwaterMEKMNAIGVAGAVGDFEKIFEDMDVKTEEMNGALDNVYASSVDNGEVMNLLNEMRDMQ*
Ga0170791_1575013723300013295FreshwaterMQKMDSIGVAGSVGDFEKLFEDMDVKTEEMNGALDNIYGSSIDNNEVMNLLNEMRD*
Ga0186523_11126323300017166Host-AssociatedMLQKCMKQMDSLGVAGSIGNFEQVFEDLDVKTGDMNAALDNIYSTSIDNGEVMDLLTQMR
Ga0181380_112510223300017782SeawaterMLQKAMKQMDSLGVAGSIGNFEKIFEDLDVKTGDMNAALDNIYSTSIDNGEVMTLLEQMRDEQVMNHGGAMKTGEGVAENG
Ga0169931_1058088313300017788FreshwaterLSNFLKVAGSVGDFERLFEDMDVKTEEMNGALDNVYATSIDNNEVMNLLNEMRD
Ga0193523_11100713300018533MarineMDAIGAAGSIGDFEKVFEDLDVKTGELNDAMDNVYSTSIDNGEVMNLLNQMRD
Ga0188862_101840123300018622Freshwater LakeMDKMGVAGSIGEFEKVFEDLDVKTEEMNGALDNVYSTSIDNGEVMNLLNEMRDQQ
Ga0192889_105678713300018657MarineMDAIGAAGSIGDFEKVFEDLDVKTGELNDAMDNVYSTSIDNGEVMDLLNQMRD
Ga0192983_105139223300018684MarineMDSLGVAGSIGSFEQVFEDLDVKTGDMNAGLDNIYSTSIDNGEVMELLTAMKD
Ga0193539_104853533300018706MarineMDSIGVAGSIGNFEQVFEDLDVKTGDMNAALDNIYSTSIDNGEVMDLLT
Ga0192887_102450023300018713MarineMDSIGAAGSIGDFEKVFEDLDVKTGDMNAAMDNIYSTSIDNGEVMNLLNQMKDQQTMEAGGEINAG
Ga0192866_106240123300018720MarineMKQMDSIGVAGSIGDFEKVFEDLDVKTGDINQAMDNIYSTSIDNGEVMTLLNQMKDQQTMEAGGEINAGTGAIKD
Ga0192924_103623313300018764MarineMLQRCMKQMDSLGVAGSIGSFEQVFEDMDVKTGDMNAALDNIYSTSIDNGEVMELLNQMRDQQTMEAGG
Ga0193031_107246833300018765MarineMLQRCMKQMDSIGVAGSIGNFEQVFEDLDVKTGDMNAALDNIYSTSIDNGEVMDLLT
Ga0193314_104759013300018771MarineMKQMDSLGVAGSIGSFEQVFEDMDVKTGDMNAALDNIYSTSIDNSEVMELLTQMRD
Ga0193314_106220223300018771MarineMSKQISQSVPLLKKAMKQMDAIGAAGSIGDFEKVFEDLDVKTGELNDAMDNVYSTSIDNGEVMDLLNQMRDQ
Ga0193117_106217913300018796MarineMKQMDALGVAGSIGDFEKVFEDLDVKTGDMNQALDNIYSTSIDNGEVMNLLNQMRDEQSMEAGG
Ga0193329_108337213300018804MarineMKQMDAIGAAGSIGDFEKVFEDLDVKTGELNDAMDNVYSTSIDNGEVMDLLNQMRDQ
Ga0192872_107432023300018813MarineMDSIGAAGSIGDFEKVFEDLDVKTGDMNAAMDNIYSTSIDNGEVMNLLNQMKDQQSMEAGNEINAG
Ga0192872_108411213300018813MarineMDSIGVAGSIGDFEKVFEDLDVKTGDINQAMDNIYSTSIDNGEVMTLLNQMKDQQTMEAGGEINAGTGAIKD
Ga0192872_108907823300018813MarineMLQRCMKQMDSLGVAGSIGSFEQVFEDMDVKTGDMNAALDNIYSTSIDNGEVMDLLNQMR
Ga0193497_106195413300018819MarineMDSLGVAGSIGDFEKVFEDLDVKTGDMNAALDNIYSTSIDNGEVMDLLNQMKDQQTMEAGGEINAG
Ga0193302_106783913300018838MarineMLQRCMKQMDSLGVAGSIGSFEQVFEDMDVKTGDMNAALDNIYSTSIDNSEVMELLTQMR
Ga0193304_108252613300018888MarineVFEDMDVKTGDMNAALDNIYSTSIDNSEVMELLTQMRD
Ga0193244_106790013300018903MarineMKQMDAIGAAGSIGDFEKVFEDLDVKTGELNDAMDNVYSTSIDNGEVMNLLNQMRDQ
Ga0193083_1004438923300018927MarineMDSIGAAGSIGDFEKVFEDLDVKTGDMNAAMDNIYSTSIDNGEVMNLLNQMKD
Ga0192921_1016834413300018929MarineMKQMDSLGVAGSIGSFEQVFEDMDVKTGDMNAALDNIYSTSIDNGEVMELLNQMRDQQTMEAGG
Ga0193066_1022885323300018947MarineMDAIGAAGSIGDFEKVFEDLDVKTGELNDAMDNVYSTSIDNGEVMELLNQMRD
Ga0193531_1024565913300018961MarineMKQMDSLGVAGSIGSFEQVFEDMDVKTGDMNAALDNIYSTSIDNGEVMDLLTQMRD
Ga0193087_1029551923300018964MarineMDAVGVAGSMGDFEKVFEDLDVKTGDMNAALDNIYSTSIDNGEVM
Ga0192873_1026641823300018974MarineMKQMDSIGVAGSIGDFEKVFEDLDVKTGDINQAMDNIYSTSIDNGEVMQLLN
Ga0193030_1017248223300018989MarineMLQKAMKQMDSLGVAGSIGSFETVFEDMDVKTGDMNAALDNIYSTSIDNGEVMTLLNQMRDE
Ga0193430_1009008813300018995MarineMLQRCMKQMDSLGVAGSIGSFEQVFEDMDVKTGDMNAALDNIYSTSIDNGEVMELLNQMRDQQTMEAGGEIAAGSG
Ga0192916_1013743623300018996MarineMLQRCMKQMDSLGVAGSIGSFEQVFEDMDVKTGDMNAALDNIYSTSIDNGEVMDLLN
Ga0192916_1017090823300018996MarineMDAVGAAGSIGDFEKVFEDLDVKTGEMNAALDNVYSTSIDNGEVMTLL
Ga0192916_1017291523300018996MarineMLQRCMKQMDSLGVAGSIGSFEQVFEDMDVKTGDMNAALDNIYSTSIDNGEVMELLNQMR
Ga0192916_1020927423300018996MarineMDAVGAAGSIGDFEKVFEDLDVKTGEMNAALDNVYSTSIDNGEVMQLLQQMKD
Ga0192916_1021093833300018996MarineMLQKCMKQMDSLGVAGSIGSFEQVFEDLDVKTGDMNAALDNIYSTSIDNSEVMELLTAMQYQQVMEAGGEINA
Ga0193514_1017761613300018999MarineMLQKCMKQMDSLGVSGSIGSFEQVFEDMDVKTGDMNAALDNIYSTSIDNGEVMELLNQMRDQQTMEAGGQIAAGSGEIA
Ga0193514_1026659623300018999MarineMDAIGAAGSIGDFEKVFEDLDVKTGELNDAMDNVYSTSIDNGEVMDLLN
Ga0193514_1026848623300018999MarineMLQRCMKQMDSLGVAGSIGSFEQVFEDMDVKTGDMNAALDNIYSTSIDNGEVMELLNQMRDQQTMEAGGEIAAG
Ga0193514_1031919123300018999MarineMDALGVAGSIGDFEKVFEDLDVKTGDMNQALDNIYSTSIDNGEVMNLLN
Ga0193034_1010963123300019001MarineMKQMDALGVAGSIGDFEKVFEDLDVKTGDMNAALDNIYSTSIDNGEVMNLLNQMKDE
Ga0193196_1046776613300019007MarineMDAIGAAGSIGDFEKVFEDLDVKTGELNDAMDNVYSTSIDNGEVMDLLNQ
Ga0192880_1006393223300019009MarineMKQMDSIGVAGSIGDFEKVFEDLDVKTGDINQAMDNIYSTSIDNGEVMQLLNQMKDQQTMEAGGEIGVGSGGIAQPN
Ga0192926_1029223913300019011MarineMLQRAMKQMDSLGVAGSIGSFEAVFEDMDVKTGDMNAALDNIYSTSIDNGEVM
Ga0192926_1035075023300019011MarineMLQKAMKQMDSLGVAGSIGSFEQVFEDMDVKTGDMNAALDNIYSTSIDNSEVMELLTQMR
Ga0193538_1026192523300019020MarineMLQKCMKQMDSLGVAGSIGNFEQVFEDLDVKTGDMNAALDNIYSTSIDNGEVMELLTAMKDQ
Ga0192951_1018197413300019022MarineMDSIGVAGSIGDFEKVFEDLDVKTGDIDQAMDSIYSTSIDNGEVMQLLNQMKDQQTMEAGGEIGTGSGPIAQPN
Ga0192875_1009625223300019035MarineMDSIGVAGSIGDFEKVFEDLDVKTGDIDQAMDSIYSTSIDNGEVMQLLNQMKDQQTMEAGGEIGVGSGGIAQPN
Ga0192981_1024861823300019048MarineMKKMDSIGMAGSVGDFEKIFEDMDVKTAEMNGALDSVYATSLDNGEVSNLLNELRDQQ
Ga0193082_1048059313300019049MarineMDSVGAQGSIGDFEKVFEDLDVKTGDMNEALNSVYSTSIDNGEVMNLLT
Ga0192966_1020601523300019050MarineMKQMDSIGVAGSIGDFEKVFEDLDVKTGDIDQAMDSIYSTSIDNGEVMQLLNQMKDQQTMEAGGEIAAG
Ga0188830_101466523300019085Freshwater LakeMKKMDAMGVAGSIGSFEKLFEDMDVKTEEMNGALDNVYATSIDNGEVMNLLNEMRD
Ga0193089_105778223300019133MarineMKQMDAIGVAGSIGDFEKVFEDLDVKTGDIDQAMDSIYSTSIDNGEVMQLLN
Ga0194244_1007196223300019150MarineMDAVGAAGSIGDFEKVFEDLDVKTGEMNAALDNVYSTSIDNGEVMQLLQQMKDE
Ga0194115_1026048913300020183Freshwater LakeMKKMDAIGVAGSIGDFERVFEDMDVKAEEMTGALDNIYATSIDNDEVMSLLNEMRD
Ga0063097_107667123300021898MarineMLKSAMKKMDAMGVAGSIGDFDKVFEDMDVKTEEMTGAMDNIYSTSVDNN
Ga0063135_108095223300021908MarineMDAIGAAGSVGSFEKVFEDLDVKTGEMNDALDSIGASSIDNGEVM
Ga0063870_105716323300021921MarineMLQKCMKQMDAMNAGASAASFEQVFEDMDVKTADMNGALDSMTGSSVDNGEVMELLNQMRDQ
Ga0063096_107096223300021925MarineMGVAGSIGDFEQVFEDMDVKTGDMNAALDNIYGTSIDNGEVMELLNQMGAQ
Ga0244775_1072398113300024346EstuarineVAGSVGDFEKLFEDMDVKTEEMNGALDNIYGSSIDNSEVMNLLNEMRD
Ga0208005_115563213300025848AqueousMLQRCMKQMDSLGVAGSIGSFEQVFEDLDVKTGDMNAALDNIYSTSIDNNEVMELLTQMRDQQVMEAGG
Ga0208783_1034479823300025872AqueousMKKMDSIGVAGSIGDFERVFEDMDVKTEEMNGALDNMYQASIDNSEVTNLLNEIKAQQGMAVGAGMVAG
Ga0208544_1021541223300025887AqueousMKQMDSLGAAGSIGSFEQVFEDLDVKTGDMNAALDNIYSTSIDNGEVM
Ga0208916_1024339533300025896AqueousLQIAGSIGDFEKVFEDMDVKTEEMNGALENIYGSSIDNNEVMQLLNEMRD
Ga0209596_121921913300027754Freshwater LakeVAGSVGDFEKLFEDMDVKTEEMNGALDNIYGSSIDNNEVMNLLNEMRD
Ga0209279_1019817113300027771MarineMLQKCMKQMDSLGVAGSIGSFEEVFEDMDVKTGDMNAALDNIYSTSIDNGEVM
Ga0209302_1024139023300027810MarineMGSMEAFENVFEDLDVKTGEMNDAMDNIYGGSIDNGEVAELLS
Ga0209450_1048522723300027885Freshwater Lake SedimentMKQMDSLGVAGSIGSFEQVFEDMDVKTGDMNAALDNIYSTSIDNNEVMELLNQMRD
Ga0256413_136648223300028282SeawaterMAKMDSLGVAGNMMNLEKVFEDMDVKTEEMTGALDNVNAPSIPNNEVMSLLNEMRDQV
Ga0307402_1094143323300030653MarineMDSIGVAGSIGDFEKVFEDLDVKTGDIDQAMDSIYSTSIDNGEVMQLLNQMKDQ
Ga0138347_1013827223300031113MarineMKQMDAVGVAGSMGDFEKVFEDLDVKTGDMNAALDNIYSTSIDNGEVM
Ga0138347_1086004723300031113MarineMLQKAMKQMDSLGVAGSIGSFEQVFEDMDVKTGDMNAALDNIYSTSIDNGEVMDLLTQMR
Ga0302125_1018139613300031638MarineMDSMGVAGSIGDFEQVFEDMDVKTGDMNAALDNIYGTSIDNGEVMELLNQMGAQ
Ga0307396_1031981713300031717MarineMDSIGVAGSIGDFEKVFEDLDVKTGDIDQAMDSIYSTSIDNGEVMQLLNQMKDQQTMEAGGEIAAG
Ga0307391_1062641123300031729MarineMLQKCMKQMDSLGVAGSIGSFEEVFEDMDVKTGDMNAALDNIYSTSIDNGEVMELLTQMR
Ga0307383_1030903713300031739MarineMDSIGVAGSIGDFEKVFEDLDVKTGDIDQAMDSIYSTSIDNGEVMQLLN
Ga0307389_1040570523300031750MarineMDSIGVAGSIGDFEKVFEDLDVKTGDIDQAMDSIYSTSIDNGEVMQLLNQMKDQQTMEAGGEIGVG
Ga0315899_1086106033300031784FreshwaterVGDFEKLFEDMDVKTEEMNGALDNVYSTSIDNGEVMNLLNEMRD
Ga0307390_1108177913300033572MarineMLQKCMKQMDSLGVAGSIGSFEEVFEDMDVKTGDMNAALDNIYSTSIDNGEVMDLLTQMR

 ⦗Top⦘


Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.