Basic Information | |
---|---|
Family ID | F081690 |
Family Type | Metagenome / Metatranscriptome |
Number of Sequences | 114 |
Average Sequence Length | 43 residues |
Representative Sequence | MGLAHWDEVESHRRAKGEMDAVWQRLGDAAGTKGVGVNRVRVEP |
Number of Associated Samples | 98 |
Number of Associated Scaffolds | 114 |
Quality Assessment | |
---|---|
Transcriptomic Evidence | Yes |
Most common taxonomic group | Bacteria |
% of genes with valid RBS motifs | 37.72 % |
% of genes near scaffold ends (potentially truncated) | 98.25 % |
% of genes from short scaffolds (< 2000 bps) | 92.11 % |
Associated GOLD sequencing projects | 93 |
AlphaFold2 3D model prediction | Yes |
3D model pTM-score | 0.64 |
Hidden Markov Model |
---|
Powered by Skylign |
Most Common Taxonomy | |
---|---|
Group | Bacteria (73.684 % of family members) |
NCBI Taxonomy ID | 2 |
Taxonomy | All Organisms → cellular organisms → Bacteria |
Most Common Ecosystem | |
---|---|
GOLD Ecosystem | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere (8.772 % of family members) |
Environment Ontology (ENVO) | Unclassified (23.684 % of family members) |
Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (45.614 % of family members) |
⦗Top⦘ |
⦗Top⦘ |
Predicted Topology & Secondary Structure | |||||
---|---|---|---|---|---|
Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 11.11% β-sheet: 26.39% Coil/Unstructured: 62.50% | Feature Viewer |
|
|||||
Powered by Feature Viewer |
Structure Viewer | |
---|---|
| |
Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.64 |
Powered by PDBe Molstar |
⦗Top⦘ |
Pfam ID | Name | % Frequency in 114 Family Scaffolds |
---|---|---|
PF00294 | PfkB | 17.54 |
PF00484 | Pro_CA | 8.77 |
PF03618 | Kinase-PPPase | 7.02 |
PF00107 | ADH_zinc_N | 3.51 |
PF07650 | KH_2 | 3.51 |
PF00353 | HemolysinCabind | 1.75 |
PF11578 | DUF3237 | 1.75 |
PF00150 | Cellulase | 1.75 |
PF00072 | Response_reg | 0.88 |
PF09992 | NAGPA | 0.88 |
PF14016 | DUF4232 | 0.88 |
PF03449 | GreA_GreB_N | 0.88 |
PF00583 | Acetyltransf_1 | 0.88 |
PF08220 | HTH_DeoR | 0.88 |
PF00892 | EamA | 0.88 |
PF01326 | PPDK_N | 0.88 |
PF01156 | IU_nuc_hydro | 0.88 |
PF01472 | PUA | 0.88 |
PF13860 | FlgD_ig | 0.88 |
PF08327 | AHSA1 | 0.88 |
PF02272 | DHHA1 | 0.88 |
PF00455 | DeoRC | 0.88 |
PF02896 | PEP-utilizers_C | 0.88 |
PF03704 | BTAD | 0.88 |
PF02230 | Abhydrolase_2 | 0.88 |
PF12840 | HTH_20 | 0.88 |
PF13417 | GST_N_3 | 0.88 |
PF07883 | Cupin_2 | 0.88 |
PF02913 | FAD-oxidase_C | 0.88 |
PF05437 | AzlD | 0.88 |
COG ID | Name | Functional Category | % Frequency in 114 Family Scaffolds |
---|---|---|---|
COG0288 | Carbonic anhydrase | Inorganic ion transport and metabolism [P] | 8.77 |
COG1806 | Regulator of PEP synthase PpsR, kinase-PPPase family (combines ADP:protein kinase and phosphorylase activities) | Signal transduction mechanisms [T] | 7.02 |
COG1349 | DNA-binding transcriptional regulator of sugar metabolism, DeoR/GlpR family | Transcription [K] | 1.75 |
COG2730 | Aryl-phospho-beta-D-glucosidase BglC, GH1 family | Carbohydrate transport and metabolism [G] | 1.75 |
COG3934 | Endo-1,4-beta-mannosidase | Carbohydrate transport and metabolism [G] | 1.75 |
COG0120 | Ribose 5-phosphate isomerase | Carbohydrate transport and metabolism [G] | 0.88 |
COG0277 | FAD/FMN-containing lactate dehydrogenase/glycolate oxidase | Energy production and conversion [C] | 0.88 |
COG0574 | Phosphoenolpyruvate synthase/pyruvate phosphate dikinase | Carbohydrate transport and metabolism [G] | 0.88 |
COG0782 | Transcription elongation factor, GreA/GreB family | Transcription [K] | 0.88 |
COG1957 | Inosine-uridine nucleoside N-ribohydrolase | Nucleotide transport and metabolism [F] | 0.88 |
COG3629 | DNA-binding transcriptional regulator DnrI/AfsR/EmbR, SARP family, contains BTAD domain | Transcription [K] | 0.88 |
COG3947 | Two-component response regulator, SAPR family, consists of REC, wHTH and BTAD domains | Transcription [K] | 0.88 |
⦗Top⦘ |
Name | Rank | Taxonomy | Distribution |
All Organisms | root | All Organisms | 73.68 % |
Unclassified | root | N/A | 26.32 % |
Visualization |
---|
Powered by ApexCharts |
Scaffold | Taxonomy | Length | IMG/M Link |
---|---|---|---|
2166559005|cont_contig63600 | All Organisms → cellular organisms → Bacteria | 777 | Open in IMG/M |
2170459002|F0B48LX02GYH9Y | All Organisms → cellular organisms → Bacteria | 500 | Open in IMG/M |
3300000956|JGI10216J12902_126735998 | All Organisms → cellular organisms → Bacteria | 562 | Open in IMG/M |
3300001535|A3PFW1_10298480 | All Organisms → cellular organisms → Bacteria | 1628 | Open in IMG/M |
3300002568|C688J35102_117860494 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 511 | Open in IMG/M |
3300002568|C688J35102_120794917 | Not Available | 1601 | Open in IMG/M |
3300004081|Ga0063454_100319939 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 984 | Open in IMG/M |
3300004156|Ga0062589_102887647 | Not Available | 502 | Open in IMG/M |
3300004479|Ga0062595_100352987 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1025 | Open in IMG/M |
3300004479|Ga0062595_102259991 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 535 | Open in IMG/M |
3300005331|Ga0070670_100166345 | All Organisms → cellular organisms → Bacteria | 1912 | Open in IMG/M |
3300005332|Ga0066388_101510190 | All Organisms → cellular organisms → Bacteria | 1176 | Open in IMG/M |
3300005332|Ga0066388_101719286 | All Organisms → cellular organisms → Bacteria | 1111 | Open in IMG/M |
3300005338|Ga0068868_101676390 | All Organisms → cellular organisms → Bacteria | 599 | Open in IMG/M |
3300005434|Ga0070709_10143682 | Not Available | 1642 | Open in IMG/M |
3300005435|Ga0070714_100314632 | All Organisms → cellular organisms → Bacteria | 1463 | Open in IMG/M |
3300005435|Ga0070714_102103821 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 550 | Open in IMG/M |
3300005436|Ga0070713_100696225 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 970 | Open in IMG/M |
3300005437|Ga0070710_10630721 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 749 | Open in IMG/M |
3300005439|Ga0070711_100655337 | All Organisms → cellular organisms → Bacteria | 881 | Open in IMG/M |
3300005454|Ga0066687_10570768 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 672 | Open in IMG/M |
3300005529|Ga0070741_11589806 | All Organisms → cellular organisms → Bacteria | 536 | Open in IMG/M |
3300005541|Ga0070733_10316521 | Not Available | 1032 | Open in IMG/M |
3300005544|Ga0070686_100764576 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 776 | Open in IMG/M |
3300005548|Ga0070665_100844071 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 929 | Open in IMG/M |
3300005549|Ga0070704_100667488 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 919 | Open in IMG/M |
3300005557|Ga0066704_10942135 | Not Available | 533 | Open in IMG/M |
3300005575|Ga0066702_10273062 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1031 | Open in IMG/M |
3300005577|Ga0068857_102003623 | Not Available | 568 | Open in IMG/M |
3300005578|Ga0068854_102270999 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 502 | Open in IMG/M |
3300005614|Ga0068856_101517699 | All Organisms → cellular organisms → Bacteria | 684 | Open in IMG/M |
3300005764|Ga0066903_105858464 | All Organisms → cellular organisms → Bacteria | 645 | Open in IMG/M |
3300006028|Ga0070717_10035751 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 4025 | Open in IMG/M |
3300006032|Ga0066696_10308438 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1029 | Open in IMG/M |
3300006058|Ga0075432_10461693 | Not Available | 559 | Open in IMG/M |
3300006173|Ga0070716_100283940 | Not Available | 1143 | Open in IMG/M |
3300006173|Ga0070716_101658038 | Not Available | 526 | Open in IMG/M |
3300006797|Ga0066659_11891917 | All Organisms → cellular organisms → Bacteria | 506 | Open in IMG/M |
3300006852|Ga0075433_11445360 | All Organisms → cellular organisms → Bacteria | 594 | Open in IMG/M |
3300006852|Ga0075433_11531068 | All Organisms → cellular organisms → Bacteria | 576 | Open in IMG/M |
3300009093|Ga0105240_10075519 | All Organisms → cellular organisms → Bacteria | 4157 | Open in IMG/M |
3300009156|Ga0111538_10993153 | Not Available | 1062 | Open in IMG/M |
3300009156|Ga0111538_13129727 | All Organisms → cellular organisms → Bacteria | 577 | Open in IMG/M |
3300009789|Ga0126307_10059606 | All Organisms → cellular organisms → Bacteria | 2992 | Open in IMG/M |
3300009840|Ga0126313_10283782 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1291 | Open in IMG/M |
3300009840|Ga0126313_11019208 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 678 | Open in IMG/M |
3300010040|Ga0126308_10761110 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 669 | Open in IMG/M |
3300010040|Ga0126308_11059854 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 570 | Open in IMG/M |
3300010042|Ga0126314_10912464 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 650 | Open in IMG/M |
3300010361|Ga0126378_12707299 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 566 | Open in IMG/M |
3300010375|Ga0105239_12208256 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 640 | Open in IMG/M |
3300010375|Ga0105239_12337744 | Not Available | 622 | Open in IMG/M |
3300010376|Ga0126381_101291120 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1055 | Open in IMG/M |
3300010376|Ga0126381_103558542 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 611 | Open in IMG/M |
3300010399|Ga0134127_13418114 | All Organisms → cellular organisms → Bacteria | 520 | Open in IMG/M |
3300010403|Ga0134123_11014201 | Not Available | 847 | Open in IMG/M |
3300011119|Ga0105246_11675528 | Not Available | 603 | Open in IMG/M |
3300012045|Ga0136623_10058478 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1683 | Open in IMG/M |
3300012357|Ga0137384_11202201 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 603 | Open in IMG/M |
3300012527|Ga0136633_1256470 | Not Available | 640 | Open in IMG/M |
3300012915|Ga0157302_10485977 | Not Available | 530 | Open in IMG/M |
3300012922|Ga0137394_10599010 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 932 | Open in IMG/M |
3300012960|Ga0164301_10193462 | Not Available | 1290 | Open in IMG/M |
3300012977|Ga0134087_10467933 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 628 | Open in IMG/M |
3300012977|Ga0134087_10475626 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 624 | Open in IMG/M |
3300012984|Ga0164309_10051930 | All Organisms → cellular organisms → Bacteria | 2380 | Open in IMG/M |
3300012985|Ga0164308_11210968 | All Organisms → cellular organisms → Bacteria | 682 | Open in IMG/M |
3300012989|Ga0164305_10140312 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1624 | Open in IMG/M |
3300013104|Ga0157370_10128768 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 2362 | Open in IMG/M |
3300013104|Ga0157370_10345819 | Not Available | 1371 | Open in IMG/M |
3300013105|Ga0157369_10989014 | All Organisms → cellular organisms → Bacteria | 861 | Open in IMG/M |
3300013294|Ga0120150_1093605 | Not Available | 569 | Open in IMG/M |
3300013772|Ga0120158_10277626 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 823 | Open in IMG/M |
3300013772|Ga0120158_10285240 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 807 | Open in IMG/M |
3300014827|Ga0120171_1010307 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 4312 | Open in IMG/M |
3300014968|Ga0157379_11955777 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes | 579 | Open in IMG/M |
3300015261|Ga0182006_1163049 | Not Available | 750 | Open in IMG/M |
3300015265|Ga0182005_1132906 | All Organisms → cellular organisms → Bacteria | 715 | Open in IMG/M |
3300015357|Ga0134072_10492656 | All Organisms → cellular organisms → Bacteria | 503 | Open in IMG/M |
3300017789|Ga0136617_10465713 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1010 | Open in IMG/M |
3300017974|Ga0187777_10191199 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1377 | Open in IMG/M |
3300018482|Ga0066669_10757832 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 857 | Open in IMG/M |
3300020075|Ga0206349_1962161 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 784 | Open in IMG/M |
3300020076|Ga0206355_1050741 | All Organisms → cellular organisms → Bacteria | 640 | Open in IMG/M |
3300025929|Ga0207664_10419236 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1192 | Open in IMG/M |
3300025932|Ga0207690_10094805 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 2118 | Open in IMG/M |
3300025949|Ga0207667_11652226 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → unclassified Thermoleophilia → Thermoleophilia bacterium | 608 | Open in IMG/M |
3300025981|Ga0207640_11817210 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 551 | Open in IMG/M |
3300026075|Ga0207708_10292167 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1323 | Open in IMG/M |
3300026075|Ga0207708_11057225 | Not Available | 707 | Open in IMG/M |
3300026078|Ga0207702_10523711 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1157 | Open in IMG/M |
3300026095|Ga0207676_11875062 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 598 | Open in IMG/M |
3300026116|Ga0207674_10652709 | All Organisms → cellular organisms → Bacteria | 1016 | Open in IMG/M |
3300026528|Ga0209378_1218954 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 612 | Open in IMG/M |
3300027703|Ga0207862_1252991 | Not Available | 516 | Open in IMG/M |
3300027869|Ga0209579_10588326 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 604 | Open in IMG/M |
3300028573|Ga0265334_10119288 | Not Available | 943 | Open in IMG/M |
3300028666|Ga0265336_10116991 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 794 | Open in IMG/M |
3300028666|Ga0265336_10165648 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 657 | Open in IMG/M |
3300028872|Ga0307314_10062530 | All Organisms → cellular organisms → Bacteria | 957 | Open in IMG/M |
3300028881|Ga0307277_10027784 | All Organisms → cellular organisms → Bacteria | 2242 | Open in IMG/M |
3300030513|Ga0268242_1138527 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 531 | Open in IMG/M |
3300031170|Ga0307498_10282974 | Not Available | 614 | Open in IMG/M |
3300031341|Ga0307418_1082884 | Not Available | 842 | Open in IMG/M |
3300031572|Ga0318515_10552133 | Not Available | 614 | Open in IMG/M |
3300031640|Ga0318555_10474627 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 678 | Open in IMG/M |
3300031793|Ga0318548_10608129 | Not Available | 532 | Open in IMG/M |
3300031821|Ga0318567_10206910 | Not Available | 1096 | Open in IMG/M |
3300031939|Ga0308174_10476200 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1018 | Open in IMG/M |
3300032064|Ga0318510_10391808 | Not Available | 590 | Open in IMG/M |
3300032074|Ga0308173_10631468 | Not Available | 973 | Open in IMG/M |
3300032770|Ga0335085_10189153 | Not Available | 2533 | Open in IMG/M |
3300033551|Ga0247830_10704258 | All Organisms → cellular organisms → Bacteria | 802 | Open in IMG/M |
3300033803|Ga0314862_0086369 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 715 | Open in IMG/M |
⦗Top⦘ |
Habitat | Taxonomy | Distribution |
Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 8.77% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 7.02% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 6.14% |
Corn Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere | 6.14% |
Serpentine Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Serpentine Soil | 5.26% |
Permafrost | Environmental → Terrestrial → Soil → Unclassified → Permafrost → Permafrost | 4.39% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 4.39% |
Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 4.39% |
Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 3.51% |
Polar Desert Sand | Environmental → Aquatic → Freshwater → Ice → Unclassified → Polar Desert Sand | 2.63% |
Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 2.63% |
Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 2.63% |
Surface Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil | 2.63% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil | 2.63% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural → Soil | 2.63% |
Soil | Environmental → Terrestrial → Soil → Loam → Grasslands → Soil | 2.63% |
Agricultural Soil | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Agricultural Soil | 2.63% |
Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 2.63% |
Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 2.63% |
Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Rhizosphere | 2.63% |
Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 1.75% |
Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 1.75% |
Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Corn, Switchgrass And Miscanthus Rhizosphere | 1.75% |
Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere | 1.75% |
Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere | 1.75% |
Salt Marsh | Environmental → Aquatic → Marine → Intertidal Zone → Salt Marsh → Salt Marsh | 0.88% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 0.88% |
Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 0.88% |
Grass Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grass Soil | 0.88% |
Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 0.88% |
Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Peatland | 0.88% |
Tropical Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland | 0.88% |
Switchgrass Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Switchgrass Rhizosphere | 0.88% |
Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 0.88% |
Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere | 0.88% |
Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 0.88% |
Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 0.88% |
Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere | 0.88% |
Simulated | Engineered → Modeled → Simulated Communities (Sequence Read Mixture) → Unclassified → Unclassified → Simulated | 0.88% |
Visualization |
---|
Powered by ApexCharts |
Taxon OID | Sample Name | Habitat Type | IMG/M Link |
---|---|---|---|
2166559005 | Simulated microbial communities from Lyon, France | Engineered | Open in IMG/M |
2170459002 | Grass soil microbial communities from Rothamsted Park, UK - March 2009 direct MP BIO 1O1 lysis 0-21 cm | Environmental | Open in IMG/M |
3300000956 | Soil microbial communities from Great Prairies - Kansas, Native Prairie soil | Environmental | Open in IMG/M |
3300001535 | Permafrost active layer microbial communities from McGill Arctic Research Station, Canada - (A3-PF-15A)- 1 week illumina | Environmental | Open in IMG/M |
3300002568 | Grasslands soil microbial communities from Hopland, California, USA - 2 | Environmental | Open in IMG/M |
3300004081 | Grasslands soil microbial communities from Hopland, California, USA - 2 (version 2) | Environmental | Open in IMG/M |
3300004156 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Combined assembly of AARS Block 1 | Environmental | Open in IMG/M |
3300004479 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of All WPAs | Environmental | Open in IMG/M |
3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Host-Associated | Open in IMG/M |
3300005332 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly) | Environmental | Open in IMG/M |
3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Host-Associated | Open in IMG/M |
3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Environmental | Open in IMG/M |
3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Environmental | Open in IMG/M |
3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Environmental | Open in IMG/M |
3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Environmental | Open in IMG/M |
3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Environmental | Open in IMG/M |
3300005454 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_136 | Environmental | Open in IMG/M |
3300005529 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen16_06102014_R1 | Environmental | Open in IMG/M |
3300005541 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen05_05102014_R1 | Environmental | Open in IMG/M |
3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Environmental | Open in IMG/M |
3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Host-Associated | Open in IMG/M |
3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Environmental | Open in IMG/M |
3300005557 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_153 | Environmental | Open in IMG/M |
3300005575 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_151 | Environmental | Open in IMG/M |
3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Host-Associated | Open in IMG/M |
3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Host-Associated | Open in IMG/M |
3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Host-Associated | Open in IMG/M |
3300005764 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2) | Environmental | Open in IMG/M |
3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Environmental | Open in IMG/M |
3300006032 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_145 | Environmental | Open in IMG/M |
3300006058 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 | Host-Associated | Open in IMG/M |
3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Environmental | Open in IMG/M |
3300006797 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_108 | Environmental | Open in IMG/M |
3300006852 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Host-Associated | Open in IMG/M |
3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Host-Associated | Open in IMG/M |
3300009156 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD1 (version 2) | Host-Associated | Open in IMG/M |
3300009789 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot28 | Environmental | Open in IMG/M |
3300009840 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot105A | Environmental | Open in IMG/M |
3300010040 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot55 | Environmental | Open in IMG/M |
3300010042 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot105B | Environmental | Open in IMG/M |
3300010361 | Tropical forest soil microbial communities from Panama - MetaG Plot_23 | Environmental | Open in IMG/M |
3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Host-Associated | Open in IMG/M |
3300010376 | Tropical forest soil microbial communities from Panama - MetaG Plot_28 | Environmental | Open in IMG/M |
3300010399 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-3 | Environmental | Open in IMG/M |
3300010403 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-3 | Environmental | Open in IMG/M |
3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Host-Associated | Open in IMG/M |
3300012045 | Polar desert sand microbial communities from Dry Valleys, Antarctica - metaG UQ449 (21.06) | Environmental | Open in IMG/M |
3300012357 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_60_16 metaG | Environmental | Open in IMG/M |
3300012527 | Polar desert sand microbial communities from Dry Valleys, Antarctica - metaG UQ83 (22.06) | Environmental | Open in IMG/M |
3300012915 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S103-311B-2 | Environmental | Open in IMG/M |
3300012922 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czobulk1.16 metaG | Environmental | Open in IMG/M |
3300012960 | Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_231_MG | Environmental | Open in IMG/M |
3300012977 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Glu_20cm_5_24_1 metaG | Environmental | Open in IMG/M |
3300012984 | Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_247_MG | Environmental | Open in IMG/M |
3300012985 | Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_246_MG | Environmental | Open in IMG/M |
3300012989 | Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_237_MG | Environmental | Open in IMG/M |
3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Host-Associated | Open in IMG/M |
3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Host-Associated | Open in IMG/M |
3300013294 | Permafrost microbial communities from Nunavut, Canada - A3_65cm_0M | Environmental | Open in IMG/M |
3300013772 | Permafrost microbial communities from Nunavut, Canada - A10_80_0.25M | Environmental | Open in IMG/M |
3300014827 | Permafrost microbial communities from Nunavut, Canada - A3_80cm_18M | Environmental | Open in IMG/M |
3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Host-Associated | Open in IMG/M |
3300015261 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG | Host-Associated | Open in IMG/M |
3300015265 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG | Host-Associated | Open in IMG/M |
3300015357 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_20cm_5_0_1 metaG | Environmental | Open in IMG/M |
3300017789 | Polar desert sand microbial communities from Dry Valleys, Antarctica - metaG UQ322 (21.06) | Environmental | Open in IMG/M |
3300017974 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_Q2_SP5_10_MG | Environmental | Open in IMG/M |
3300018482 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_118 | Environmental | Open in IMG/M |
3300020075 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-5 (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
3300020076 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v3) | Environmental | Open in IMG/M |
3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) | Environmental | Open in IMG/M |
3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) | Host-Associated | Open in IMG/M |
3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) | Host-Associated | Open in IMG/M |
3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) | Environmental | Open in IMG/M |
3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) | Host-Associated | Open in IMG/M |
3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) | Host-Associated | Open in IMG/M |
3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) | Host-Associated | Open in IMG/M |
3300026528 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_156 (SPAdes) | Environmental | Open in IMG/M |
3300027703 | Tropical forest soil microbial communities from Luquillo Experimental Forest, Puerto Rico - Sample 81 (SPAdes) | Environmental | Open in IMG/M |
3300027869 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen03_05102014_R1 (SPAdes) | Environmental | Open in IMG/M |
3300028573 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG | Host-Associated | Open in IMG/M |
3300028666 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG | Host-Associated | Open in IMG/M |
3300028872 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_204 | Environmental | Open in IMG/M |
3300028881 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_116 | Environmental | Open in IMG/M |
3300030513 | Bulk soil microbial communities from Mexico - San Felipe (SF) metaG (v2) | Environmental | Open in IMG/M |
3300031170 | Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 12_S | Environmental | Open in IMG/M |
3300031341 | Salt marsh sediment microbial communities from the Plum Island Ecosystem LTER, Massachusetts, United States - WE1602-20 | Environmental | Open in IMG/M |
3300031572 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f19 | Environmental | Open in IMG/M |
3300031640 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f23 | Environmental | Open in IMG/M |
3300031793 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f21 | Environmental | Open in IMG/M |
3300031821 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.088b5f20 | Environmental | Open in IMG/M |
3300031939 | Soil microbial communities from UC Gill Tract Community Farm, Albany, California, United States - DLSLS.P.R2 | Environmental | Open in IMG/M |
3300032064 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.171b2f17 | Environmental | Open in IMG/M |
3300032074 | Soil microbial communities from UC Gill Tract Community Farm, Albany, California, United States - DLSLS.P.R1 | Environmental | Open in IMG/M |
3300032770 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.5 | Environmental | Open in IMG/M |
3300033551 | Soil microbial communities from agricultural site in Penn Yan, New York, United States - 12C_Control_Day5 | Environmental | Open in IMG/M |
3300033803 | Tropical peat soil microbial communities from peatlands in Loreto, Peru - MAQ_0_10 | Environmental | Open in IMG/M |
Geographical Distribution | |
---|---|
Zoom: | Powered by OpenStreetMap |
⦗Top⦘ |
Protein ID | Sample Taxon ID | Habitat | Sequence |
cont_0600.00004280 | 2166559005 | Simulated | MTVAHWDEVDWRHNAKGEMDATWQRLGDSAGARGVGVNRVRVEPGKLPTPPTR |
E1_00396140 | 2170459002 | Grass Soil | MTVAHWDEVDWRHNAKGEMDATWQRLGDSAGARGVGVNRVRVEPGKAADASHSHGASEDALLRPGGSGL |
JGI10216J12902_1267359981 | 3300000956 | Soil | VIAHWDEVEARRRAKGEMDAEWQRLGDAAGTVGVGV |
A3PFW1_102984801 | 3300001535 | Permafrost | MGIAHWDDVERHHRAKGEMDATWQRLGHPAGTKGVGVNRVC |
C688J35102_1178604942 | 3300002568 | Soil | MTVAHWDDVPARRFAKGEMDASWQLLGDAAGTQGVGVNRVR |
C688J35102_1207949171 | 3300002568 | Soil | VVWQHGAMGVAHWDDVEWRRRAKGAMDASWQRLGDAAGARDVGINRVR |
Ga0063454_1003199391 | 3300004081 | Soil | MLAHWDDVDLRRREVGEMAASWQRLGDVAGTVRLGVNRVRVDP* |
Ga0062589_1028876471 | 3300004156 | Soil | MGVAHWDEVVWQRRAKGAMDASWQRLGDAAGTSAVGVNRV |
Ga0062595_1003529874 | 3300004479 | Soil | VAVSHWDEVESFRSAKGEMDATWQRLGDAAGTRVVGVNRVRVEPGKLPT |
Ga0062595_1022599912 | 3300004479 | Soil | VGLAHWDDVEGHHRAKGEMDATWQRLGREAGTKTVGLNRV |
Ga0070670_1001663454 | 3300005331 | Switchgrass Rhizosphere | VPPVGIVHWDDIERHRAAKGEMDATWQQLGKAAGAVGIGVNR |
Ga0066388_1015101903 | 3300005332 | Tropical Forest Soil | VTVAHWDEVEFHRSAKGEMDASWQVLGDAAGTRGVGVRRCRVEPG |
Ga0066388_1017192863 | 3300005332 | Tropical Forest Soil | VTVAHWDEVGSHRRAKGEMDATWQWLGNAAGTRSVGVNRVRVAPGKLPTPPHSHGAS |
Ga0068868_1016763902 | 3300005338 | Miscanthus Rhizosphere | MTVAHWDEVDWRHNAKGEMDATWQGLGDAAGTRGVGVNRVRVEPGK |
Ga0070709_101436824 | 3300005434 | Corn, Switchgrass And Miscanthus Rhizosphere | MGVAHWDEVESHHRAKGEMGATWQAVGNAAGTVTVGVNRI |
Ga0070714_1003146321 | 3300005435 | Agricultural Soil | MGVAHWDEVEGQARAKGEMDATWQALGDAAGTRSVGVNLVRVAPGKLPTPPHSH |
Ga0070714_1021038211 | 3300005435 | Agricultural Soil | VTVAHWDEVESRHRAKGEMDGTWQALGDAAGTRGVGVNRVR |
Ga0070713_1006962252 | 3300005436 | Corn, Switchgrass And Miscanthus Rhizosphere | VGVAHWDEIERQHRAKGEMDATWQRLGSPAGARTVGLNRVRVAAGKLPTPPHSH |
Ga0070710_106307211 | 3300005437 | Corn, Switchgrass And Miscanthus Rhizosphere | MGVAHWDEVESFRGAKGEMDATWQRLGAAAGAQGVGVNRVRVAP |
Ga0070711_1006553371 | 3300005439 | Corn, Switchgrass And Miscanthus Rhizosphere | VPLVGIVHWDDIEQHRAAKGEMDATWQQLGKAAGAVGIGVN |
Ga0066687_105707681 | 3300005454 | Soil | MGVAHWDEVGSHHAAKGEMDAEWQWLGHAAGTRGVGVNRVRVAPGRLP |
Ga0070741_115898061 | 3300005529 | Surface Soil | MGVAHWDEVESFRNAKGEMDATWQRLGDAAGTKGVGVNRVRVAPG |
Ga0070733_103165211 | 3300005541 | Surface Soil | VAHWDDVEGHRAAKGEMDAMWQRLGDAAGTRSVGVNRVRVE |
Ga0070686_1007645761 | 3300005544 | Switchgrass Rhizosphere | MTVAHWDEVDWRHNAKGEMDATWQRLGDAAGARGVGVNRV |
Ga0070665_1008440713 | 3300005548 | Switchgrass Rhizosphere | MTVAHWDEVDWRRNAKGEMDATWQRLGDAAGARGVGVNRVRI |
Ga0070704_1006674883 | 3300005549 | Corn, Switchgrass And Miscanthus Rhizosphere | MTVAHWDEVDWRHNAKGEMDATWQRLGDAAGARGVGVNRVRVEPGKL |
Ga0066704_109421352 | 3300005557 | Soil | MGVAHWDEVGSHHAAKGEMDAEWQWLGHAAGTRGVGVNRVRV |
Ga0066702_102730623 | 3300005575 | Soil | VEGLAHWDDVEWHHRAKGEMDATWQFLGRAAGVVGV |
Ga0068857_1020036231 | 3300005577 | Corn Rhizosphere | MGVAHWDEVDSRRSAKGEMDAEWQWLGRAAGTRGVGVNRVRVAPGRL |
Ga0068854_1022709991 | 3300005578 | Corn Rhizosphere | VGLAHWDDVAAHRAAKGEMDAEWQRLGDAAGSVTVGLS |
Ga0068856_1015176993 | 3300005614 | Corn Rhizosphere | MGVAHWDEVEFHRRSKGEMDASWQWLGHASGTRGVGVNRVRVEP |
Ga0066903_1058584642 | 3300005764 | Tropical Forest Soil | MGLAHWDDVEFHRSAKGEMDASWQRLGNAAGTRKVGVSR |
Ga0070717_100357515 | 3300006028 | Corn, Switchgrass And Miscanthus Rhizosphere | VGLAHWDEIERQHRAKGEMDATWQRLGSPAGARTVGLNRVRVAAGKLPTPPHS |
Ga0066696_103084383 | 3300006032 | Soil | VTVAHWDEVETFRSAKGEMDATWQRLGAAAGTRAVGVNRVR |
Ga0075432_104616932 | 3300006058 | Populus Rhizosphere | VLAHWDEIEANRREKGEMAASWQRLGSAAGTRAVGVNRVRID |
Ga0070716_1002839401 | 3300006173 | Corn, Switchgrass And Miscanthus Rhizosphere | MTVAHWDEVDWRHNAKGEMDATWQRLGDAAGARGVG |
Ga0070716_1016580381 | 3300006173 | Corn, Switchgrass And Miscanthus Rhizosphere | VGIVHWDDIERHRAAKGEMDATWQQLGKAAGAVGIGVNRM |
Ga0066659_118919171 | 3300006797 | Soil | MGIVHWDDVERQRRAKGEMDAEWQILGDAAGTTGVGV |
Ga0075433_114453602 | 3300006852 | Populus Rhizosphere | MTVAHWDEVEARRNAKGEMDATWQALGKAAGTRGVGVNRVRV |
Ga0075433_115310681 | 3300006852 | Populus Rhizosphere | VLAHWDEIEADRREKGEMAASWQRLGSAAGTRAVGVNRVRIDPGRLS |
Ga0105240_100755195 | 3300009093 | Corn Rhizosphere | VGIAHWDEVEGHRNAKGEMDATWQFLGRASGSQGVGVN |
Ga0111538_109931533 | 3300009156 | Populus Rhizosphere | VTVAHWDDVETHHRAKGEMDATWQRLGDAAGTRGV |
Ga0111538_131297271 | 3300009156 | Populus Rhizosphere | VTLAHWDEVEERRRAKGEMDATWQRLGDAAGTKGVGVSRVRVAPGKLPT |
Ga0126307_100596061 | 3300009789 | Serpentine Soil | VSVAHWDDVESRHRAKGEMDAVWQRVGDAAGTRGVGVSRVRV |
Ga0126313_102837821 | 3300009840 | Serpentine Soil | MTVSHWDEVESYRRAKGEMNGTWQRLGDAAGTRGVGVNRVRLEPGA |
Ga0126313_110192082 | 3300009840 | Serpentine Soil | VGHIRNDPAVSVAHWDEVQSQHRAKGEMDAVWQRLGDAAGTRGVGV |
Ga0126308_107611103 | 3300010040 | Serpentine Soil | VSVAHWDEVQSQHRAKGEMDAVWQRLGDAAGTRGVGVNRV |
Ga0126308_110598541 | 3300010040 | Serpentine Soil | VGHIRNDPAVSVAHWDEVQSQHRAKGEMDAVWQRLGDAAGTRGVGVNRV |
Ga0126314_109124641 | 3300010042 | Serpentine Soil | VIAHWDEVGWHRREKGEMGGDWQRLGDAAGTDGVGVNRVRID |
Ga0126378_127072991 | 3300010361 | Tropical Forest Soil | MTVAHWDEVDSRHAAKGEMDATWQRLGNAAGTRGVGVARVQVAPGKLPTP |
Ga0105239_122082561 | 3300010375 | Corn Rhizosphere | MGLAHWDEVEGHRAAKGEMDAEWQMLGRAAGTAGVGVN |
Ga0105239_123377442 | 3300010375 | Corn Rhizosphere | VGLAHWDDVEGRRAAKGEMDAEWQMLGRAAGTAGVG |
Ga0126381_1012911204 | 3300010376 | Tropical Forest Soil | MTVANWDEVEEIVRAKGEMDGIWQAVGAAAGTRGVGVNRVRVAPGKLPTPPH |
Ga0126381_1035585422 | 3300010376 | Tropical Forest Soil | MGVAHWDEVEFFRSAKGEMDASWQRLGDEAGTREVGVRR |
Ga0134127_134181142 | 3300010399 | Terrestrial Soil | MGLAHWDDVEPRHRAKGEMDATWKRLGEAAGTKGV |
Ga0134123_110142011 | 3300010403 | Terrestrial Soil | VGIVHWDDIERHRAAKGEMDATWQQLGKAAGAVGIG |
Ga0105246_116755282 | 3300011119 | Miscanthus Rhizosphere | VGIVHWDDIERHRAAKGEMDATWQQLGKAAGAVGIGVN |
Ga0136623_100584784 | 3300012045 | Polar Desert Sand | MGIAHWDDVEHTRRAKGEMDATWQRLGQAAGTKGVGLN |
Ga0137384_112022011 | 3300012357 | Vadose Zone Soil | VTVAHWDEVETFRSAKGEMDATWQRLGAAAGTRAVGMNRVRV |
Ga0136633_12564701 | 3300012527 | Polar Desert Sand | MGLAHWDDVEQHRRAKGEMDATWQRLGDATGTKGV |
Ga0157302_104859772 | 3300012915 | Soil | MGVAHWDEVDFRRSAKGEMDAEWQWLGRAAGTRGVGVNRVRV |
Ga0137394_105990102 | 3300012922 | Vadose Zone Soil | VGIAHWDDVDAHHRSNGELDAMWQLLGRAAGTQEVGVNRVRVAPGRLP |
Ga0164301_101934623 | 3300012960 | Soil | VGIVHWDDIERHRAAKGEMDATWQQLGKAAGAVGIGVNR |
Ga0134087_104679332 | 3300012977 | Grasslands Soil | VNRTGVVHWDDVERRHRALGELDATWRILGEAAGTVT |
Ga0134087_104756261 | 3300012977 | Grasslands Soil | VGVAHWEDVEWHRLAKGEMDAELQRLGRAAGAVGVGVNRVRVAPGRLPTPPHSHGAA* |
Ga0164309_100519304 | 3300012984 | Soil | VGIVHWDDIERHRAAKGEMDATWQQLGKAAGAVGIGVNRMRVAPG |
Ga0164308_112109683 | 3300012985 | Soil | LAAVTVAHWDEVEFHRSAKGQMDAEWQWLGRAAGTKRVGVNRVRVAPGKL |
Ga0164305_101403123 | 3300012989 | Soil | VGTAHWDEVEQHRRAKGEMDATWQFLGRAAGAQGVGLN |
Ga0157370_101287685 | 3300013104 | Corn Rhizosphere | VGVAHWDEVEGHHRAKGEMDATWHFLGRAAGTKTVGVNRVHVAPG |
Ga0157370_103458193 | 3300013104 | Corn Rhizosphere | VGIVHWDDIERHRAAKGEMDATWQQLGKAAGAVGIGVNRMRVAPGRLPTPPHS |
Ga0157369_109890141 | 3300013105 | Corn Rhizosphere | MGVAHWDEVDSNHRAKGEMDATWQSLGNAAGTRGVGVNRV |
Ga0120150_10936051 | 3300013294 | Permafrost | VSPIVHWDDVEQRRNAKGEMDATWQRLGRTAGAVGVGVN |
Ga0120158_102776261 | 3300013772 | Permafrost | MGLAHWDDVERMHRAKGEMDAEWQRLGDAARVGGGGLH |
Ga0120158_102852402 | 3300013772 | Permafrost | VGLAHWDDIEGHHRAKGEMDATWQRLGAPAGAKTVGLNRVN |
Ga0120171_10103075 | 3300014827 | Permafrost | VGIAHWDDVEPERRAKGEMDATWQRLGAPARTKGVGLNRGG |
Ga0157379_119557771 | 3300014968 | Switchgrass Rhizosphere | VGLAHWDDVATYRGAKGEMDAEWQRLGDAAGSVGVGLSRVRV |
Ga0182006_11630492 | 3300015261 | Rhizosphere | VGLAHWDEVDEHRSAKGEMDAVWQMLGRAAGTTGVGVNRVRVAPGK |
Ga0182005_11329063 | 3300015265 | Rhizosphere | MGVAHWDEVDSRRSAKGEMDAEWQWLGRAAGTRGVGVNRVRVAPGRLPTPPHSHSASEE |
Ga0134072_104926561 | 3300015357 | Grasslands Soil | MGVAHWDEVEFHRSAKGEMDAEWQWLGHAAGTCGVGVNRVRVAPGR |
Ga0136617_104657132 | 3300017789 | Polar Desert Sand | MGIVHWDEVERHRRAKGEMDATWQRLGQAAGTKGVGVN |
Ga0187777_101911991 | 3300017974 | Tropical Peatland | MGLAHWDDVLEHRSAKGELDAVWQRLGDAAGTVGVGVNRVRVAP |
Ga0066669_107578321 | 3300018482 | Grasslands Soil | VTVAHWDEVETFRSAKGEMDATWQRLGAAAGTRAVGVNRVRV |
Ga0206349_19621611 | 3300020075 | Corn, Switchgrass And Miscanthus Rhizosphere | VTVAHWDEVETFRSAKGEMDATWQRLGAAAGARAVG |
Ga0206355_10507413 | 3300020076 | Corn, Switchgrass And Miscanthus Rhizosphere | MGVAHWDEVDSRRSAKGEMDAEWQWLGRAAGTRGVGVNRVRVAPGRLPTPPHSHSASE |
Ga0207664_104192361 | 3300025929 | Agricultural Soil | MGVAHWDEVEPHTRAKGEMDASWQWLGNAAGTRGV |
Ga0207690_100948053 | 3300025932 | Corn Rhizosphere | VGLAHWDDVDERRAAKGEMDAVWQMLGRAAGTAGVGLNRIR |
Ga0207667_116522261 | 3300025949 | Corn Rhizosphere | MGIAHRDEVEEHRAAKGEMDAVWKRIGAAAGAKTVGVNLVTVA |
Ga0207640_118172101 | 3300025981 | Corn Rhizosphere | VGLAHWDDVAAHRAAKGEMDAEWQRLGDAAGSVTVGLSRVRVA |
Ga0207708_102921671 | 3300026075 | Corn, Switchgrass And Miscanthus Rhizosphere | MGLAHWDDVEGFRRAKGEMDATWQRLGDAAGTKDVGLN |
Ga0207708_110572251 | 3300026075 | Corn, Switchgrass And Miscanthus Rhizosphere | VGIVHWDDIERHRAAKGEMDATWQQLGKAAGAVGIGVNRMRVAPGRLPTPP |
Ga0207702_105237113 | 3300026078 | Corn Rhizosphere | MGVAHWDEVDSNHRAKGEMDATWQSLGNAAGTRGVGVNRVRVEPGRLPTPPHSHGA |
Ga0207676_118750621 | 3300026095 | Switchgrass Rhizosphere | MGLAHWDDVEGFRRAKGEMDATWQRLGDAAGTKDVGLNRVRVAP |
Ga0207674_106527093 | 3300026116 | Corn Rhizosphere | MGVAHWDEVDSRRSAKGEMDAEWQWLGRAAGTRGVGVNRVRVAPGRLPT |
Ga0209378_12189541 | 3300026528 | Soil | MTVAHWDEVESRRNAKGEMDATWQRLGDAAGTSGVGVNRVRIERG |
Ga0207862_12529912 | 3300027703 | Tropical Forest Soil | VGLAHWDDVPEHHAAKGEMDAVWQRLGAAAGTAGVGV |
Ga0209579_105883261 | 3300027869 | Surface Soil | MSVVHWDEVDFHRSAKGEMDASSQFLGDAAGTRGVGVNRVRVEPGKLPT |
Ga0265334_101192882 | 3300028573 | Rhizosphere | MGVAHWDEVEGHRPAKGEMDATWQRLGDAAVTKSVGV |
Ga0265336_101169911 | 3300028666 | Rhizosphere | VGVAHWDDVESFHRAKGEMDATWQALGRAAGTRGV |
Ga0265336_101656481 | 3300028666 | Rhizosphere | MGVAHWDEVAEFRAAKGEMDAVWQRLGDAAGTQGVGVNRVRVEPGKL |
Ga0307314_100625303 | 3300028872 | Soil | MSVAHWDDVEWHRRAKGAMDASWQRLGGAAGASGVGVNRVRVA |
Ga0307277_100277845 | 3300028881 | Soil | VGIAHWDEVEAHRRAKGEMDAEWQLLGNAAGTVGVGVNRVRI |
Ga0268242_11385272 | 3300030513 | Soil | MGIAHWDEVEWRRNAKGEMALSVQRLGRAAGTKGVGVNRVRV |
Ga0307498_102829741 | 3300031170 | Soil | VGIVHWDDIERHRAAKGEMDATWQQLAKPAGAVGIGVNRMRVAPGKLPTPPHSHGA |
Ga0307418_10828842 | 3300031341 | Salt Marsh | VTVAHWDEVEGSRRSRGEMDATWQRLGDAAGTRGVGVNRVRVEPGRL |
Ga0318515_105521332 | 3300031572 | Soil | VTVAHWDEVEERVRAKGEMDGIWQAVGEAAGTRGVGVNRVRVPPGK |
Ga0318555_104746272 | 3300031640 | Soil | MGVAHWDEVETHRAAKGEMDAVWQRLGSHAGTVGVGVS |
Ga0318548_106081292 | 3300031793 | Soil | MNPPKGVVHWDEVEGHHAERGEMAATWRRLGHAAGTKTVGV |
Ga0318567_102069101 | 3300031821 | Soil | MNPPKGVVHWDEVEGHHAERGEMAATWRRLGHAAGTKTVG |
Ga0308174_104762002 | 3300031939 | Soil | VGLAHWDDVEPRCTAKGEMDAEWQRLGDAAGTVGVG |
Ga0318510_103918082 | 3300032064 | Soil | MNPPKGVVHWDEVEGHHAERGEMAATWRRLGHAAGTKTVGVS |
Ga0308173_106314683 | 3300032074 | Soil | MAVAHWDDVEWHRRAKGAMDASWQRLGDAAGTSGVGVNRV |
Ga0335085_101891533 | 3300032770 | Soil | MGIAHWDEVEFHRAANGEIDASWQRLGATAGAVGVGVNRVRVAPGM |
Ga0247830_107042582 | 3300033551 | Soil | MGLAHWDEVESHRRAKGEMDAVWQRLGDAAGTKGVGVNRVRVEP |
Ga0314862_0086369_576_713 | 3300033803 | Peatland | MGVAHWDNVESHRLSKGEMDATWQALGNAAGTVTVGVNRVRVEPGK |
⦗Top⦘ |