Metagenome / Metatranscriptome Family F081499

Basic Information
Family ID	F081499
Family Type	Metagenome / Metatranscriptome
Number of Sequences	114
Average Sequence Length	40 residues
Representative Sequence	VKVFSLENAYVVEQAQVIKNTEGSNEAIVTGEMADTPPGS
Number of Associated Samples	90
Number of Associated Scaffolds	114

Quality Assessment
Transcriptomic Evidence	Yes
Most common taxonomic group	Bacteria
% of genes with valid RBS motifs	64.04 %
% of genes near scaffold ends (potentially truncated)	27.19 %
% of genes from short scaffolds (< 2000 bps)	80.70 %
Associated GOLD sequencing projects	86
AlphaFold2 3D model prediction	Yes
3D model pTM-score	0.26

Most Common Taxonomy
Group	Bacteria (62.281 % of family members)
NCBI Taxonomy ID	2
Taxonomy	All Organisms → cellular organisms → Bacteria

Most Common Ecosystem
GOLD Ecosystem	Environmental → Aquatic → Freshwater → Lake → Sediment → Sediment (19.298 % of family members)
Environment Ontology (ENVO)	Unclassified (28.070 % of family members)
Earth Microbiome Project Ontology (EMPO)	Unclassified (32.456 % of family members)

Full Alignment
Alignment of all the sequences in the family.

Powered by MSAViewer

Seed Alignment
Alignment of a non-redundant set of sequences, used to build the family's HMM profile.

Powered by MSAViewer

AlphaFold2 Input Alignment
Refined alignment used as input for AlphaFold2.

Powered by MSAViewer

Predicted Topology & Secondary Structure
Classification:	Globular	Signal Peptide:	No	Secondary Structure distribution:	α-helix: 26.47% β-sheet: 0.00% Coil/Unstructured: 73.53%
Feature Viewer

Powered by Feature Viewer

Pfam ID	Name	% Frequency in 114 Family Scaffolds
PF08388	GIIM	13.16
PF00078	RVT_1	9.65
PF00106	adh_short	1.75
PF03401	TctC	0.88
PF00501	AMP-binding	0.88
PF02744	GalP_UDP_tr_C	0.88
PF01661	Macro	0.88
PF00440	TetR_N	0.88
PF07646	Kelch_2	0.88
PF01609	DDE_Tnp_1	0.88
PF00557	Peptidase_M24	0.88
PF11453	DUF2950	0.88
PF13414	TPR_11	0.88
PF00210	Ferritin	0.88
PF13098	Thioredoxin_2	0.88
PF02353	CMAS	0.88
PF01266	DAO	0.88
PF13669	Glyoxalase_4	0.88
PF14236	DUF4338	0.88
PF02515	CoA_transf_3	0.88

COG ID	Name	Functional Category	% Frequency in 114 Family Scaffolds
COG1804	Crotonobetainyl-CoA:carnitine CoA-transferase CaiB and related acyl-CoA transferases	Lipid transport and metabolism [I]	0.88
COG2110	O-acetyl-ADP-ribose deacetylase (regulator of RNase III), contains Macro domain	Translation, ribosomal structure and biogenesis [J]	0.88
COG2226	Ubiquinone/menaquinone biosynthesis C-methylase UbiE/MenG	Coenzyme transport and metabolism [H]	0.88
COG2227	2-polyprenyl-3-methyl-5-hydroxy-6-metoxy-1,4-benzoquinol methylase	Coenzyme transport and metabolism [H]	0.88
COG2230	Cyclopropane fatty-acyl-phospholipid synthase and related methyltransferases	Lipid transport and metabolism [I]	0.88
COG3039	Transposase and inactivated derivatives, IS5 family	Mobilome: prophages, transposons [X]	0.88
COG3055	N-acetylneuraminic acid mutarotase	Cell wall/membrane/envelope biogenesis [M]	0.88
COG3181	Tripartite-type tricarboxylate transporter, extracytoplasmic receptor component TctC	Energy production and conversion [C]	0.88
COG3293	Transposase	Mobilome: prophages, transposons [X]	0.88
COG3385	IS4 transposase InsG	Mobilome: prophages, transposons [X]	0.88
COG5421	Transposase	Mobilome: prophages, transposons [X]	0.88
COG5433	Predicted transposase YbfD/YdcC associated with H repeats	Mobilome: prophages, transposons [X]	0.88
COG5659	SRSO17 transposase	Mobilome: prophages, transposons [X]	0.88

NCBI Taxonomy

Select NCBI taxonomy Level:

Name	Rank	Taxonomy	Distribution
All Organisms	root	All Organisms	66.67 %
Unclassified	root	N/A	33.33 %

Name	Rank	Taxonomy	Distribution
cellular organisms	root	All Organisms → cellular organisms	66.67 %
Unclassified	root	N/A	33.33 %

Name	Rank	Taxonomy	Distribution
Bacteria	superkingdom	All Organisms → cellular organisms → Bacteria	62.28 %
Unclassified	root	N/A	33.33 %
Archaea	superkingdom	All Organisms → cellular organisms → Archaea	4.39 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	33.33 %
Proteobacteria	phylum	All Organisms → cellular organisms → Bacteria → Proteobacteria	14.91 %
Nitrospirae	phylum	All Organisms → cellular organisms → Bacteria → Nitrospirae	14.04 %
environmental samples	no rank	All Organisms → cellular organisms → Archaea → environmental samples	4.39 %
Terrabacteria group	clade	All Organisms → cellular organisms → Bacteria → Terrabacteria group	0.88 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	33.33 %
delta/epsilon subdivisions	subphylum	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions	14.04 %
Thermodesulfovibrionia	class	All Organisms → cellular organisms → Bacteria → Nitrospirae → Thermodesulfovibrionia	13.16 %
uncultured archaeon GZfos18F2	species	All Organisms → cellular organisms → Archaea → environmental samples → uncultured archaeon GZfos18F2	4.39 %
Firmicutes	phylum	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes	0.88 %
Nitrospira	class	All Organisms → cellular organisms → Bacteria → Nitrospirae → Nitrospira	0.88 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	33.33 %
Deltaproteobacteria	class	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria	14.04 %
Thermodesulfovibrionales	order	All Organisms → cellular organisms → Bacteria → Nitrospirae → Thermodesulfovibrionia → Thermodesulfovibrionales	13.16 %
uncultured archaeon GZfos18F2	species	All Organisms → cellular organisms → Archaea → environmental samples → uncultured archaeon GZfos18F2	4.39 %
Nitrospirales	order	All Organisms → cellular organisms → Bacteria → Nitrospirae → Nitrospira → Nitrospirales	0.88 %
Firmicutes	phylum	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes	0.88 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	33.33 %
Thermodesulfovibrionaceae	family	All Organisms → cellular organisms → Bacteria → Nitrospirae → Thermodesulfovibrionia → Thermodesulfovibrionales → Thermodesulfovibrionaceae	13.16 %
uncultured archaeon GZfos18F2	species	All Organisms → cellular organisms → Archaea → environmental samples → uncultured archaeon GZfos18F2	4.39 %
Syntrophobacterales	order	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Syntrophobacterales	3.51 %
unclassified Deltaproteobacteria	no rank	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria	3.51 %
Desulfobacterales	order	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfobacterales	2.63 %
Deltaproteobacteria incertae sedis	no rank	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Deltaproteobacteria incertae sedis	0.88 %
Nitrospiraceae	family	All Organisms → cellular organisms → Bacteria → Nitrospirae → Nitrospira → Nitrospirales → Nitrospiraceae	0.88 %
Firmicutes	phylum	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes	0.88 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	33.33 %
Thermodesulfovibrio	genus	All Organisms → cellular organisms → Bacteria → Nitrospirae → Thermodesulfovibrionia → Thermodesulfovibrionales → Thermodesulfovibrionaceae → Thermodesulfovibrio	13.16 %
uncultured archaeon GZfos18F2	species	All Organisms → cellular organisms → Archaea → environmental samples → uncultured archaeon GZfos18F2	4.39 %
Syntrophaceae	family	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Syntrophobacterales → Syntrophaceae	3.51 %
Deltaproteobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium	1.75 %
Desulfobacteraceae	family	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfobacterales → Desulfobacteraceae	0.88 %
Candidatus Desulfacyla	genus	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Deltaproteobacteria incertae sedis → Candidatus Desulfacyla	0.88 %
Deltaproteobacteria bacterium HGW-Deltaproteobacteria-13	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium HGW-Deltaproteobacteria-13	0.88 %
unclassified Nitrospiraceae	no rank	All Organisms → cellular organisms → Bacteria → Nitrospirae → Nitrospira → Nitrospirales → Nitrospiraceae → unclassified Nitrospiraceae	0.88 %
unclassified Desulfobacterales	no rank	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfobacterales → unclassified Desulfobacterales	0.88 %
Deltaproteobacteria bacterium RBG_13_51_10	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium RBG_13_51_10	0.88 %
Firmicutes	phylum	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes	0.88 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	33.33 %
unclassified Thermodesulfovibrio	no rank	All Organisms → cellular organisms → Bacteria → Nitrospirae → Thermodesulfovibrionia → Thermodesulfovibrionales → Thermodesulfovibrionaceae → Thermodesulfovibrio → unclassified Thermodesulfovibrio	13.16 %
uncultured archaeon GZfos18F2	species	All Organisms → cellular organisms → Archaea → environmental samples → uncultured archaeon GZfos18F2	4.39 %
Smithella	genus	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Syntrophobacterales → Syntrophaceae → Smithella	2.63 %
Deltaproteobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium	1.75 %
unclassified Desulfobacteraceae	no rank	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfobacterales → Desulfobacteraceae → unclassified Desulfobacteraceae	0.88 %
Nitrospiraceae bacterium	species	All Organisms → cellular organisms → Bacteria → Nitrospirae → Nitrospira → Nitrospirales → Nitrospiraceae → unclassified Nitrospiraceae → Nitrospiraceae bacterium	0.88 %
unclassified Syntrophaceae	no rank	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Syntrophobacterales → Syntrophaceae → unclassified Syntrophaceae	0.88 %
Desulfobacterales bacterium S5133MH4	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfobacterales → unclassified Desulfobacterales → Desulfobacterales bacterium S5133MH4	0.88 %
Candidatus Desulfacyla euxinica	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Deltaproteobacteria incertae sedis → Candidatus Desulfacyla → Candidatus Desulfacyla euxinica	0.88 %
Deltaproteobacteria bacterium HGW-Deltaproteobacteria-13	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium HGW-Deltaproteobacteria-13	0.88 %
Deltaproteobacteria bacterium RBG_13_51_10	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium RBG_13_51_10	0.88 %
Firmicutes	phylum	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes	0.88 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	33.33 %
Thermodesulfovibrio sp. RBG_19FT_COMBO_42_12	species	All Organisms → cellular organisms → Bacteria → Nitrospirae → Thermodesulfovibrionia → Thermodesulfovibrionales → Thermodesulfovibrionaceae → Thermodesulfovibrio → unclassified Thermodesulfovibrio → Thermodesulfovibrio sp. RBG_19FT_COMBO_42_12	13.16 %
uncultured archaeon GZfos18F2	species	All Organisms → cellular organisms → Archaea → environmental samples → uncultured archaeon GZfos18F2	4.39 %
Deltaproteobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium	1.75 %
Desulfobacteraceae bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfobacterales → Desulfobacteraceae → unclassified Desulfobacteraceae → Desulfobacteraceae bacterium	0.88 %
Syntrophaceae bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Syntrophobacterales → Syntrophaceae → unclassified Syntrophaceae → Syntrophaceae bacterium	0.88 %
unclassified Smithella	no rank	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Syntrophobacterales → Syntrophaceae → Smithella → unclassified Smithella	0.88 %
Nitrospiraceae bacterium	species	All Organisms → cellular organisms → Bacteria → Nitrospirae → Nitrospira → Nitrospirales → Nitrospiraceae → unclassified Nitrospiraceae → Nitrospiraceae bacterium	0.88 %
Desulfobacterales bacterium S5133MH4	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfobacterales → unclassified Desulfobacterales → Desulfobacterales bacterium S5133MH4	0.88 %
Candidatus Desulfacyla euxinica	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Deltaproteobacteria incertae sedis → Candidatus Desulfacyla → Candidatus Desulfacyla euxinica	0.88 %
Deltaproteobacteria bacterium HGW-Deltaproteobacteria-13	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium HGW-Deltaproteobacteria-13	0.88 %
Deltaproteobacteria bacterium RBG_13_51_10	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium RBG_13_51_10	0.88 %
Firmicutes	phylum	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes	0.88 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	33.33 %
Thermodesulfovibrio sp. RBG_19FT_COMBO_42_12	species	All Organisms → cellular organisms → Bacteria → Nitrospirae → Thermodesulfovibrionia → Thermodesulfovibrionales → Thermodesulfovibrionaceae → Thermodesulfovibrio → unclassified Thermodesulfovibrio → Thermodesulfovibrio sp. RBG_19FT_COMBO_42_12	13.16 %
uncultured archaeon GZfos18F2	species	All Organisms → cellular organisms → Archaea → environmental samples → uncultured archaeon GZfos18F2	4.39 %
Deltaproteobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium	1.75 %
Smithella sp. PtaU1.Bin162	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Syntrophobacterales → Syntrophaceae → Smithella → unclassified Smithella → Smithella sp. PtaU1.Bin162	0.88 %
Desulfobacteraceae bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfobacterales → Desulfobacteraceae → unclassified Desulfobacteraceae → Desulfobacteraceae bacterium	0.88 %
Syntrophaceae bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Syntrophobacterales → Syntrophaceae → unclassified Syntrophaceae → Syntrophaceae bacterium	0.88 %
Nitrospiraceae bacterium	species	All Organisms → cellular organisms → Bacteria → Nitrospirae → Nitrospira → Nitrospirales → Nitrospiraceae → unclassified Nitrospiraceae → Nitrospiraceae bacterium	0.88 %
Desulfobacterales bacterium S5133MH4	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfobacterales → unclassified Desulfobacterales → Desulfobacterales bacterium S5133MH4	0.88 %
Candidatus Desulfacyla euxinica	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Deltaproteobacteria incertae sedis → Candidatus Desulfacyla → Candidatus Desulfacyla euxinica	0.88 %
Deltaproteobacteria bacterium HGW-Deltaproteobacteria-13	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium HGW-Deltaproteobacteria-13	0.88 %
Deltaproteobacteria bacterium RBG_13_51_10	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium RBG_13_51_10	0.88 %
Firmicutes	phylum	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes	0.88 %

Visualization

Powered by ApexCharts

Associated Scaffolds

Scaffold	Taxonomy	Length	IMG/M Link
2124908035\|B3_GZOS_CLC_ConsensusfromContig82742	Not Available	763	Open in IMG/M
2140918008\|ConsensusfromContig3145	Not Available	901	Open in IMG/M
3300000229\|TB_LI09_3DRAFT_1057320	All Organisms → cellular organisms → Bacteria → Nitrospirae → Thermodesulfovibrionia → Thermodesulfovibrionales → Thermodesulfovibrionaceae → Thermodesulfovibrio → unclassified Thermodesulfovibrio → Thermodesulfovibrio sp. RBG_19FT_COMBO_42_12	876	Open in IMG/M
3300000491\|ML8_100867	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfobacterales → Desulfobacteraceae → unclassified Desulfobacteraceae → Desulfobacteraceae bacterium	2940	Open in IMG/M
3300000493\|MLSed_106020	Not Available	620	Open in IMG/M
3300000558\|Draft_10083530	All Organisms → cellular organisms → Bacteria	2513	Open in IMG/M
3300001580\|Draft_10354121	Not Available	615	Open in IMG/M
3300001580\|Draft_10354654	Not Available	615	Open in IMG/M
3300002538\|JGI24132J36420_10000815	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria	14526	Open in IMG/M
3300002549\|JGI24130J36418_10090680	All Organisms → cellular organisms → Bacteria → Nitrospirae → Thermodesulfovibrionia → Thermodesulfovibrionales → Thermodesulfovibrionaceae → Thermodesulfovibrio → unclassified Thermodesulfovibrio → Thermodesulfovibrio sp. RBG_19FT_COMBO_42_12	711	Open in IMG/M
3300002569\|JGI24136J36422_10148757	All Organisms → cellular organisms → Bacteria → Nitrospirae → Thermodesulfovibrionia → Thermodesulfovibrionales → Thermodesulfovibrionaceae → Thermodesulfovibrio → unclassified Thermodesulfovibrio → Thermodesulfovibrio sp. RBG_19FT_COMBO_42_12	608	Open in IMG/M
3300002703\|draft_10957164	Not Available	818	Open in IMG/M
3300002703\|draft_10957219	Not Available	819	Open in IMG/M
3300002703\|draft_11059126	Not Available	2405	Open in IMG/M
3300003852\|Ga0031655_10336342	All Organisms → cellular organisms → Bacteria	562	Open in IMG/M
3300005601\|Ga0070722_10504943	Not Available	543	Open in IMG/M
3300005821\|Ga0078746_1097491	Not Available	676	Open in IMG/M
3300005832\|Ga0074469_11172422	All Organisms → cellular organisms → Bacteria	1295	Open in IMG/M
3300005833\|Ga0074472_11404381	All Organisms → cellular organisms → Bacteria	965	Open in IMG/M
3300005938\|Ga0066795_10156367	All Organisms → cellular organisms → Bacteria → Nitrospirae → Thermodesulfovibrionia → Thermodesulfovibrionales → Thermodesulfovibrionaceae → Thermodesulfovibrio → unclassified Thermodesulfovibrio → Thermodesulfovibrio sp. RBG_19FT_COMBO_42_12	680	Open in IMG/M
3300005938\|Ga0066795_10224273	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Syntrophobacterales → Syntrophaceae → Smithella	557	Open in IMG/M
3300006094\|Ga0082037_1010880	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria	1742	Open in IMG/M
3300006224\|Ga0079037_101501693	Not Available	672	Open in IMG/M
3300006972\|Ga0075518_1047755	All Organisms → cellular organisms → Bacteria → Nitrospirae → Thermodesulfovibrionia → Thermodesulfovibrionales → Thermodesulfovibrionaceae → Thermodesulfovibrio → unclassified Thermodesulfovibrio → Thermodesulfovibrio sp. RBG_19FT_COMBO_42_12	857	Open in IMG/M
3300008517\|Ga0111034_1238490	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfobacterales → unclassified Desulfobacterales → Desulfobacterales bacterium S5133MH4	1028	Open in IMG/M
3300009034\|Ga0115863_1244492	All Organisms → cellular organisms → Bacteria	2137	Open in IMG/M
3300009034\|Ga0115863_1381429	All Organisms → cellular organisms → Bacteria	1639	Open in IMG/M
3300009034\|Ga0115863_1393157	Not Available	1609	Open in IMG/M
3300009034\|Ga0115863_1684093	All Organisms → cellular organisms → Bacteria	1152	Open in IMG/M
3300009039\|Ga0105152_10038106	All Organisms → cellular organisms → Bacteria	1910	Open in IMG/M
3300009039\|Ga0105152_10126821	Not Available	1042	Open in IMG/M
3300009091\|Ga0102851_10352701	Not Available	1462	Open in IMG/M
3300009135\|Ga0118736_10006862	All Organisms → cellular organisms → Bacteria	2509	Open in IMG/M
3300009150\|Ga0114921_10066601	All Organisms → cellular organisms → Bacteria	2305	Open in IMG/M
3300009150\|Ga0114921_10093831	All Organisms → cellular organisms → Bacteria	1981	Open in IMG/M
3300009150\|Ga0114921_10686048	Not Available	756	Open in IMG/M
3300009171\|Ga0105101_10341940	All Organisms → cellular organisms → Bacteria	725	Open in IMG/M
3300009388\|Ga0103809_1050388	Not Available	500	Open in IMG/M
3300009499\|Ga0114930_10529561	Not Available	528	Open in IMG/M
3300010392\|Ga0118731_109880520	Not Available	899	Open in IMG/M
3300010429\|Ga0116241_10086919	Not Available	2747	Open in IMG/M
3300010430\|Ga0118733_102715734	Not Available	977	Open in IMG/M
3300010932\|Ga0137843_1044014	All Organisms → cellular organisms → Archaea → environmental samples → uncultured archaeon GZfos18F2	999	Open in IMG/M
3300011118\|Ga0114922_10767141	Not Available	789	Open in IMG/M
3300011407\|Ga0137450_1058477	Not Available	717	Open in IMG/M
3300012931\|Ga0153915_12314113	All Organisms → cellular organisms → Bacteria → Nitrospirae → Thermodesulfovibrionia → Thermodesulfovibrionales → Thermodesulfovibrionaceae → Thermodesulfovibrio → unclassified Thermodesulfovibrio → Thermodesulfovibrio sp. RBG_19FT_COMBO_42_12	629	Open in IMG/M
3300012964\|Ga0153916_10906770	All Organisms → cellular organisms → Bacteria	962	Open in IMG/M
3300014656\|Ga0180007_10656107	All Organisms → cellular organisms → Bacteria → Nitrospirae → Thermodesulfovibrionia → Thermodesulfovibrionales → Thermodesulfovibrionaceae → Thermodesulfovibrio → unclassified Thermodesulfovibrio → Thermodesulfovibrio sp. RBG_19FT_COMBO_42_12	624	Open in IMG/M
3300014913\|Ga0164310_10508504	Not Available	700	Open in IMG/M
3300014914\|Ga0164311_10428286	Not Available	766	Open in IMG/M
3300015370\|Ga0180009_10018267	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfobacterales	5825	Open in IMG/M
3300017931\|Ga0187877_1360183	All Organisms → cellular organisms → Bacteria → Nitrospirae → Thermodesulfovibrionia → Thermodesulfovibrionales → Thermodesulfovibrionaceae → Thermodesulfovibrio → unclassified Thermodesulfovibrio → Thermodesulfovibrio sp. RBG_19FT_COMBO_42_12	551	Open in IMG/M
3300017989\|Ga0180432_10624917	Not Available	765	Open in IMG/M
3300018005\|Ga0187878_1063789	All Organisms → cellular organisms → Bacteria	1606	Open in IMG/M
3300018015\|Ga0187866_1284754	All Organisms → cellular organisms → Bacteria → Nitrospirae → Thermodesulfovibrionia → Thermodesulfovibrionales → Thermodesulfovibrionaceae → Thermodesulfovibrio → unclassified Thermodesulfovibrio → Thermodesulfovibrio sp. RBG_19FT_COMBO_42_12	584	Open in IMG/M
3300018055\|Ga0184616_10088330	All Organisms → cellular organisms → Bacteria	1093	Open in IMG/M
3300018064\|Ga0187773_10608251	All Organisms → cellular organisms → Bacteria → Nitrospirae → Thermodesulfovibrionia → Thermodesulfovibrionales → Thermodesulfovibrionaceae → Thermodesulfovibrio → unclassified Thermodesulfovibrio → Thermodesulfovibrio sp. RBG_19FT_COMBO_42_12	669	Open in IMG/M
3300018068\|Ga0184636_1028973	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria	1742	Open in IMG/M
3300018068\|Ga0184636_1082507	Not Available	1086	Open in IMG/M
3300018088\|Ga0187771_11049370	Not Available	691	Open in IMG/M
3300022553\|Ga0212124_10174557	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Syntrophobacterales → Syntrophaceae → unclassified Syntrophaceae → Syntrophaceae bacterium	1174	Open in IMG/M
3300022650\|Ga0236339_1245043	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Syntrophobacterales → Syntrophaceae → Smithella	574	Open in IMG/M
3300024263\|Ga0209978_10344454	Not Available	735	Open in IMG/M
(restricted) 3300024300\|Ga0233420_10017916	All Organisms → cellular organisms → Bacteria	2210	Open in IMG/M
(restricted) 3300024528\|Ga0255045_10207899	Not Available	765	Open in IMG/M
3300025159\|Ga0209619_10073334	All Organisms → cellular organisms → Bacteria	2094	Open in IMG/M
3300025308\|Ga0209211_10094740	All Organisms → cellular organisms → Bacteria	2346	Open in IMG/M
3300025322\|Ga0209641_10452240	Not Available	918	Open in IMG/M
3300025326\|Ga0209342_10191113	All Organisms → cellular organisms → Bacteria	1831	Open in IMG/M
3300025600\|Ga0209125_1020360	All Organisms → cellular organisms → Bacteria	2731	Open in IMG/M
3300025843\|Ga0209182_10021487	All Organisms → cellular organisms → Bacteria	1926	Open in IMG/M
3300027888\|Ga0209635_10289647	Not Available	1304	Open in IMG/M
3300027897\|Ga0209254_10558833	All Organisms → cellular organisms → Bacteria → Nitrospirae → Nitrospira → Nitrospirales → Nitrospiraceae → unclassified Nitrospiraceae → Nitrospiraceae bacterium	815	Open in IMG/M
3300027899\|Ga0209668_10312909	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium HGW-Deltaproteobacteria-13	1011	Open in IMG/M
3300027900\|Ga0209253_10110393	All Organisms → cellular organisms → Bacteria	2248	Open in IMG/M
3300027900\|Ga0209253_10156388	All Organisms → cellular organisms → Bacteria	1843	Open in IMG/M
3300027917\|Ga0209536_101629444	Not Available	782	Open in IMG/M
3300029288\|Ga0265297_10081949	All Organisms → cellular organisms → Bacteria	2646	Open in IMG/M
3300029288\|Ga0265297_10247012	All Organisms → cellular organisms → Bacteria	1271	Open in IMG/M
3300030613\|Ga0299915_10678024	All Organisms → cellular organisms → Bacteria	654	Open in IMG/M
3300031255\|Ga0315554_1039026	All Organisms → cellular organisms → Archaea → environmental samples → uncultured archaeon GZfos18F2	1981	Open in IMG/M
3300031275\|Ga0307437_1123597	All Organisms → cellular organisms → Archaea → environmental samples → uncultured archaeon GZfos18F2	748	Open in IMG/M
3300031539\|Ga0307380_10400091	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Deltaproteobacteria incertae sedis → Candidatus Desulfacyla → Candidatus Desulfacyla euxinica	1239	Open in IMG/M
3300031565\|Ga0307379_10040067	All Organisms → cellular organisms → Bacteria	5514	Open in IMG/M
3300031653\|Ga0315550_1209028	All Organisms → cellular organisms → Archaea → environmental samples → uncultured archaeon GZfos18F2	736	Open in IMG/M
3300031654\|Ga0315549_1293889	Not Available	577	Open in IMG/M
3300031862\|Ga0315280_10004589	All Organisms → cellular organisms → Bacteria → Proteobacteria	20274	Open in IMG/M
3300031862\|Ga0315280_10064683	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Syntrophobacterales → Syntrophaceae → Smithella → unclassified Smithella → Smithella sp. PtaU1.Bin162	2924	Open in IMG/M
3300031862\|Ga0315280_10077584	All Organisms → cellular organisms → Bacteria	2529	Open in IMG/M
3300031862\|Ga0315280_10236648	All Organisms → cellular organisms → Bacteria	986	Open in IMG/M
3300031949\|Ga0214473_10103111	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes	3331	Open in IMG/M
3300031949\|Ga0214473_10196619	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria	2335	Open in IMG/M
3300031949\|Ga0214473_10383638	All Organisms → cellular organisms → Bacteria	1589	Open in IMG/M
3300031999\|Ga0315274_10811166	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium	990	Open in IMG/M
3300032020\|Ga0315296_10535288	All Organisms → cellular organisms → Bacteria → Nitrospirae → Thermodesulfovibrionia → Thermodesulfovibrionales → Thermodesulfovibrionaceae → Thermodesulfovibrio → unclassified Thermodesulfovibrio → Thermodesulfovibrio sp. RBG_19FT_COMBO_42_12	613	Open in IMG/M
3300032020\|Ga0315296_10535456	Not Available	612	Open in IMG/M
3300032053\|Ga0315284_10617409	Not Available	1290	Open in IMG/M
3300032069\|Ga0315282_10245514	All Organisms → cellular organisms → Bacteria	1234	Open in IMG/M
3300032118\|Ga0315277_11044689	All Organisms → cellular organisms → Bacteria → Nitrospirae → Thermodesulfovibrionia → Thermodesulfovibrionales → Thermodesulfovibrionaceae → Thermodesulfovibrio → unclassified Thermodesulfovibrio → Thermodesulfovibrio sp. RBG_19FT_COMBO_42_12	741	Open in IMG/M
3300032156\|Ga0315295_10214213	All Organisms → cellular organisms → Bacteria	1937	Open in IMG/M
3300032156\|Ga0315295_10589751	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium	1126	Open in IMG/M
3300032163\|Ga0315281_10522487	All Organisms → cellular organisms → Bacteria	1260	Open in IMG/M
3300032163\|Ga0315281_10831109	All Organisms → cellular organisms → Archaea → environmental samples → uncultured archaeon GZfos18F2	950	Open in IMG/M
3300032163\|Ga0315281_11153554	Not Available	776	Open in IMG/M
3300032163\|Ga0315281_12241832	All Organisms → cellular organisms → Bacteria → Nitrospirae → Thermodesulfovibrionia → Thermodesulfovibrionales → Thermodesulfovibrionaceae → Thermodesulfovibrio → unclassified Thermodesulfovibrio → Thermodesulfovibrio sp. RBG_19FT_COMBO_42_12	516	Open in IMG/M
3300032164\|Ga0315283_10288744	All Organisms → cellular organisms → Bacteria	1777	Open in IMG/M
3300032177\|Ga0315276_12349116	Not Available	537	Open in IMG/M
3300032397\|Ga0315287_10264897	All Organisms → cellular organisms → Bacteria	2019	Open in IMG/M
3300032401\|Ga0315275_10264141	All Organisms → cellular organisms → Bacteria	1923	Open in IMG/M
3300032516\|Ga0315273_11860285	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium RBG_13_51_10	721	Open in IMG/M
3300032516\|Ga0315273_12532835	All Organisms → cellular organisms → Bacteria → Nitrospirae → Thermodesulfovibrionia → Thermodesulfovibrionales → Thermodesulfovibrionaceae → Thermodesulfovibrio → unclassified Thermodesulfovibrio → Thermodesulfovibrio sp. RBG_19FT_COMBO_42_12	590	Open in IMG/M
3300033416\|Ga0316622_100874399	All Organisms → cellular organisms → Bacteria	1046	Open in IMG/M
3300033433\|Ga0326726_10452154	All Organisms → cellular organisms → Bacteria → Nitrospirae → Thermodesulfovibrionia → Thermodesulfovibrionales → Thermodesulfovibrionaceae → Thermodesulfovibrio → unclassified Thermodesulfovibrio → Thermodesulfovibrio sp. RBG_19FT_COMBO_42_12	1224	Open in IMG/M
3300033483\|Ga0316629_11328597	Not Available	580	Open in IMG/M

Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:

Habitat	Taxonomy	Distribution
Environmental	Environmental	91.23%
Engineered	Engineered	8.77%

Habitat	Taxonomy	Distribution
Aquatic	Environmental → Aquatic	70.18%
Terrestrial	Environmental → Terrestrial	21.05%
Wastewater	Engineered → Wastewater	6.14%
Solid Waste	Engineered → Solid Waste	1.75%
Lab Enrichment	Engineered → Lab Enrichment	0.88%

Habitat	Taxonomy	Distribution
Freshwater	Environmental → Aquatic → Freshwater	41.23%
Marine	Environmental → Aquatic → Marine	21.05%
Soil	Environmental → Terrestrial → Soil	19.30%
Sediment	Environmental → Aquatic → Sediment	6.14%
Industrial Wastewater	Engineered → Wastewater → Industrial Wastewater	5.26%
Landfill	Engineered → Solid Waste → Landfill	1.75%
Non-Marine Saline And Alkaline	Environmental → Aquatic → Non-Marine Saline And Alkaline	0.88%
Unclassified	Environmental → Aquatic → Unclassified	0.88%
Peat	Environmental → Terrestrial → Peat	0.88%
Unclassified	Environmental → Terrestrial → Unclassified	0.88%
Anaerobic Digestor	Engineered → Wastewater → Anaerobic Digestor	0.88%
Defined Media	Engineered → Lab Enrichment → Defined Media	0.88%

Habitat	Taxonomy	Distribution
Lake	Environmental → Aquatic → Freshwater → Lake	24.56%
Unclassified	Environmental → Terrestrial → Soil → Unclassified	10.53%
Oceanic	Environmental → Aquatic → Marine → Oceanic	7.02%
Intertidal Zone	Environmental → Aquatic → Marine → Intertidal Zone	7.02%
Lentic	Environmental → Aquatic → Freshwater → Lentic	6.14%
Wetlands	Environmental → Aquatic → Freshwater → Wetlands	6.14%
Unclassified	Environmental → Aquatic → Sediment → Unclassified	6.14%
Wetlands	Environmental → Terrestrial → Soil → Wetlands	5.26%
Petrochemical	Engineered → Wastewater → Industrial Wastewater → Petrochemical	5.26%
Coastal	Environmental → Aquatic → Marine → Coastal	4.39%
Groundwater	Environmental → Aquatic → Freshwater → Groundwater	3.51%
Hydrothermal Vents	Environmental → Aquatic → Marine → Hydrothermal Vents	1.75%
Loam	Environmental → Terrestrial → Soil → Loam	1.75%
Clay	Environmental → Terrestrial → Soil → Clay	1.75%
Unclassified	Engineered → Solid Waste → Landfill → Unclassified	1.75%
Sediment	Environmental → Aquatic → Freshwater → Sediment	0.88%
Strait	Environmental → Aquatic → Marine → Strait	0.88%
Hypersaline	Environmental → Aquatic → Non-Marine Saline And Alkaline → Hypersaline	0.88%
Unclassified	Environmental → Aquatic → Unclassified → Unclassified	0.88%
Unclassified	Environmental → Terrestrial → Peat → Unclassified	0.88%
Unclassified	Environmental → Terrestrial → Unclassified → Unclassified	0.88%
Unclassified	Engineered → Wastewater → Anaerobic Digestor → Unclassified	0.88%
Anaerobic Media	Engineered → Lab Enrichment → Defined Media → Anaerobic Media	0.88%

Habitat	Taxonomy	Distribution
Sediment	Environmental → Aquatic → Freshwater → Lake → Sediment	21.93%
Sediment	Environmental → Aquatic → Marine → Oceanic → Sediment	7.02%
Unclassified	Environmental → Aquatic → Sediment → Unclassified → Unclassified	6.14%
Permafrost	Environmental → Terrestrial → Soil → Unclassified → Permafrost	6.14%
Unclassified	Engineered → Wastewater → Industrial Wastewater → Petrochemical → Unclassified	5.26%
Sediment	Environmental → Aquatic → Freshwater → Lentic → Sediment	4.39%
Sediment	Environmental → Aquatic → Marine → Coastal → Sediment	4.39%
Unclassified	Environmental → Aquatic → Freshwater → Wetlands → Unclassified	3.51%
Salt Marsh	Environmental → Aquatic → Marine → Intertidal Zone → Salt Marsh	3.51%
Sediment	Environmental → Aquatic → Marine → Intertidal Zone → Sediment	3.51%
Unclassified	Environmental → Terrestrial → Soil → Wetlands → Unclassified	3.51%
Unclassified	Environmental → Aquatic → Freshwater → Lake → Unclassified	2.63%
Bog	Environmental → Aquatic → Freshwater → Wetlands → Bog	2.63%
Unclassified	Environmental → Aquatic → Freshwater → Groundwater → Unclassified	2.63%
Uranium Contaminated	Environmental → Terrestrial → Soil → Unclassified → Uranium Contaminated	2.63%
Unclassified	Environmental → Aquatic → Freshwater → Lentic → Unclassified	1.75%
Sediment	Environmental → Aquatic → Marine → Hydrothermal Vents → Sediment	1.75%
Unclassified	Environmental → Terrestrial → Soil → Unclassified → Unclassified	1.75%
Permafrost	Environmental → Terrestrial → Soil → Wetlands → Permafrost	1.75%
Unclassified	Environmental → Terrestrial → Soil → Loam → Unclassified	1.75%
Unclassified	Environmental → Terrestrial → Soil → Clay → Unclassified	1.75%
Unclassified	Engineered → Solid Waste → Landfill → Unclassified → Unclassified	1.75%
Unclassified	Environmental → Aquatic → Freshwater → Sediment → Unclassified	0.88%
Cave Water	Environmental → Aquatic → Freshwater → Groundwater → Cave Water	0.88%
Unclassified	Environmental → Aquatic → Marine → Strait → Unclassified	0.88%
Sediment	Environmental → Aquatic → Non-Marine Saline And Alkaline → Hypersaline → Sediment	0.88%
Unclassified	Environmental → Aquatic → Unclassified → Unclassified → Unclassified	0.88%
Unclassified	Environmental → Terrestrial → Peat → Unclassified → Unclassified	0.88%
Unclassified	Environmental → Terrestrial → Unclassified → Unclassified → Unclassified	0.88%
Unclassified	Engineered → Wastewater → Anaerobic Digestor → Unclassified → Unclassified	0.88%
Unclassified	Engineered → Lab Enrichment → Defined Media → Anaerobic Media → Unclassified	0.88%

Habitat	Taxonomy	Distribution
Sediment	Environmental → Aquatic → Freshwater → Lake → Sediment → Sediment	19.30%
Deep Subsurface	Environmental → Aquatic → Marine → Oceanic → Sediment → Deep Subsurface	5.26%
Hydrocarbon Resource Environments	Engineered → Wastewater → Industrial Wastewater → Petrochemical → Unclassified → Hydrocarbon Resource Environments	5.26%
Freshwater Lake Sediment	Environmental → Aquatic → Freshwater → Lentic → Sediment → Freshwater Lake Sediment	4.39%
Arctic Peat Soil	Environmental → Terrestrial → Soil → Unclassified → Permafrost → Arctic Peat Soil	4.39%
Marine Sediment	Environmental → Aquatic → Marine → Coastal → Sediment → Marine Sediment	3.51%
Sediment, Intertidal	Environmental → Aquatic → Marine → Intertidal Zone → Sediment → Sediment, Intertidal	3.51%
Lake Sediment	Environmental → Aquatic → Freshwater → Lake → Sediment → Lake Sediment	2.63%
Peatland	Environmental → Aquatic → Freshwater → Wetlands → Bog → Peatland	2.63%
Salt Marsh Sediment	Environmental → Aquatic → Marine → Intertidal Zone → Salt Marsh → Salt Marsh Sediment	2.63%
Groundwater Sediment	Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment	2.63%
Soil	Environmental → Terrestrial → Soil → Unclassified → Uranium Contaminated → Soil	2.63%
Lentic	Environmental → Aquatic → Freshwater → Lentic → Unclassified → Lentic	1.75%
Freshwater	Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater	1.75%
Freshwater Wetlands	Environmental → Aquatic → Freshwater → Wetlands → Unclassified → Freshwater Wetlands	1.75%
Freshwater Wetlands	Environmental → Aquatic → Freshwater → Wetlands → Unclassified → Freshwater Wetlands	1.75%
Groundwater	Environmental → Aquatic → Freshwater → Groundwater → Unclassified → Groundwater	1.75%
Marine Sediment	Environmental → Aquatic → Marine → Oceanic → Sediment → Marine Sediment	1.75%
Marine Sediment	Environmental → Aquatic → Marine → Hydrothermal Vents → Sediment → Marine Sediment	1.75%
Sediment (Intertidal)	Environmental → Aquatic → Sediment → Unclassified → Unclassified → Sediment (Intertidal)	1.75%
Soil	Environmental → Terrestrial → Soil → Unclassified → Permafrost → Soil	1.75%
Soil	Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil	1.75%
Tropical Peatland	Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland	1.75%
Soil	Environmental → Terrestrial → Soil → Wetlands → Permafrost → Soil	1.75%
Soil	Environmental → Terrestrial → Soil → Loam → Unclassified → Soil	1.75%
Soil	Environmental → Terrestrial → Soil → Clay → Unclassified → Soil	1.75%
Landfill Leachate	Engineered → Solid Waste → Landfill → Unclassified → Unclassified → Landfill Leachate	1.75%
Freshwater Sediment	Environmental → Aquatic → Freshwater → Sediment → Unclassified → Freshwater Sediment	0.88%
Freshwater	Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater	0.88%
Soil	Environmental → Aquatic → Freshwater → Groundwater → Unclassified → Soil	0.88%
Groundwater	Environmental → Aquatic → Freshwater → Groundwater → Cave Water → Groundwater	0.88%
Marine	Environmental → Aquatic → Marine → Coastal → Sediment → Marine	0.88%
Salt Marsh	Environmental → Aquatic → Marine → Intertidal Zone → Salt Marsh → Salt Marsh	0.88%
Seawater	Environmental → Aquatic → Marine → Strait → Unclassified → Seawater	0.88%
Hypersaline Lake Sediment	Environmental → Aquatic → Non-Marine Saline And Alkaline → Hypersaline → Sediment → Hypersaline Lake Sediment	0.88%
Soil	Environmental → Aquatic → Sediment → Unclassified → Unclassified → Soil	0.88%
Marine Sediment	Environmental → Aquatic → Sediment → Unclassified → Unclassified → Marine Sediment	0.88%
Subsea Pool	Environmental → Aquatic → Unclassified → Unclassified → Unclassified → Subsea Pool	0.88%
Soil	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil	0.88%
Soil	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil	0.88%
Peat Soil	Environmental → Terrestrial → Peat → Unclassified → Unclassified → Peat Soil	0.88%
Petroleum Reservoir	Environmental → Terrestrial → Unclassified → Unclassified → Unclassified → Petroleum Reservoir	0.88%
Anaerobic Digestor Sludge	Engineered → Wastewater → Anaerobic Digestor → Unclassified → Unclassified → Anaerobic Digestor Sludge	0.88%
Enrichment Culture	Engineered → Lab Enrichment → Defined Media → Anaerobic Media → Unclassified → Enrichment Culture	0.88%

Visualization

Powered by ApexCharts

Associated Samples

Taxon OID	Sample Name	Habitat Type	IMG/M Link
2124908035	Permafrost microbial communities from permafrost in Bonanza Creek, Alaska - Bog Site B3	Environmental	Open in IMG/M
2140918008	Permafrost microbial communities from permafrost in Bonanza Creek, Alaska - Bog_all	Environmental	Open in IMG/M
3300000229	Groundwater microbial communities from subsurface biofilms in sulfidic aquifier in Frasassi Gorge, Italy, sample from two redox zones- LI09_3	Environmental	Open in IMG/M
3300000491	Lentic microbial communities from White Lake grasslands, BC, Canada	Environmental	Open in IMG/M
3300000493	Lentic microbial communities from White Lake grasslands, BC, Canada	Environmental	Open in IMG/M
3300000558	Wastewater microbial communities from Syncrude, Ft. McMurray, Alberta - West In Pit SyncrudeMLSB2011	Engineered	Open in IMG/M
3300001580	Wastewater microbial communities from Syncrude, Ft. McMurray, Alberta - Microbes from Suncor taillings pond 6 2012TP6_6	Engineered	Open in IMG/M
3300002538	Arctic peat soil from Barrow, Alaska - Barrow Graham LP Ref core NGADG0004-212	Environmental	Open in IMG/M
3300002549	Arctic peat soil from Barrow, Alaska - Barrow Graham LP Ref core NGADG0002-212	Environmental	Open in IMG/M
3300002569	Arctic peat soil from Barrow, Alaska, USA - Barrow Graham LP Ref core NGADG0011-212	Environmental	Open in IMG/M
3300002703	Wastewater microbial communities from Syncrude, Ft. McMurray, Alberta - Microbes from Oil sands tailings Tailings Pond 5 - 2012TP5	Engineered	Open in IMG/M
3300003852	Freshwater lake sediment microbial communities from the University of Notre Dame, USA, for methane emissions studies -HBP12 HB	Environmental	Open in IMG/M
3300005601	Marine sediment microbial communities from the Atlantic coast under amendment with organic carbon and nitrate - tdAd00.1	Environmental	Open in IMG/M
3300005821	Marine sediment microbial communities from Aarhus Bay station M5, Denmark - 25 cmbsf, PM1	Environmental	Open in IMG/M
3300005832	Microbial communities from Baker Bay sediment, Columbia River estuary, Washington - S.41_BBB	Environmental	Open in IMG/M
3300005833	Microbial communities from Cathlamet Bay sediment, Columbia River estuary, Oregon - S.174_CBK	Environmental	Open in IMG/M
3300005938	Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Permafrost soil replicate 2 DNA2013-191	Environmental	Open in IMG/M
3300006094	Petroleum reservoir microbial communities from Reconcavo Basin, Brazil, analyzing oil degradation - Bahia-well BA- 1	Environmental	Open in IMG/M
3300006224	Freshwater wetland microbial communities from Ohio, USA, analyzing the effect of biotic and abiotic controls - Mud 3 Core 4 Depth 4 metaG	Environmental	Open in IMG/M
3300006972	Arctic peat soil microbial communities from the Barrow Environmental Observatory site, Barrow, Alaska, USA - NGEE PermafrostAB136-A	Environmental	Open in IMG/M
3300008517	Marine sediment microbial communities from Aarhus Bay station M5, Denmark - 175 cmbsf. Combined Assembly of Gp0128389 and Gp0131431 MM4PM4	Environmental	Open in IMG/M
3300009034	Intertidal mud flat sediment archaeal communities from Garolim Bay, Chungcheongnam-do, Korea	Environmental	Open in IMG/M
3300009039	Lake sediment microbial communities from Lake Baikal, Russia to study Microbial Dark Matter (Phase II) - Lake Baikal sediment 0-5 cm	Environmental	Open in IMG/M
3300009091	Freshwater wetland microbial communities from Ohio, USA, analyzing the effect of biotic and abiotic controls - Mud 3 Core 4 Depth 3 metaG (Illumina Assembly)	Environmental	Open in IMG/M
3300009135	Marine sediment microbial communities from methane seeps within Hudson Canyon, US Atlantic Margin - Hudson Canyon PC-16 382 cmbsf	Environmental	Open in IMG/M
3300009150	Deep subsurface microbial communities from South Atlantic Ocean to uncover new lineages of life (NeLLi) - Benguela_00093 metaG	Environmental	Open in IMG/M
3300009171	Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P8 Core (1) Depth 19-21cm May2015	Environmental	Open in IMG/M
3300009388	Metatranscriptome sequencing of an Anaerobic Hexadecane-Degrading Microbial Consortia from University of California, San Diego, USA - Hexadecane	Engineered	Open in IMG/M
3300009499	Deep subsurface microbial communities from Anholt, Denmark to uncover new lineages of life (NeLLi) - Anholt_01485 metaG	Environmental	Open in IMG/M
3300010392	Coastal sediment microbial communities from Rhode Island, USA. Combined Assembly of Gp0121717, Gp0123912, Gp0123935, Gp0139423, Gp0139424, Gp0139388, Gp0139387, Gp0139386, Gp0139385	Environmental	Open in IMG/M
3300010429	AD_USRAca	Engineered	Open in IMG/M
3300010430	Marine sediment microbial communities from Gulf of Thailand under amendment with organic carbon and nitrate - JGI co-assembly of 8 samples	Environmental	Open in IMG/M
3300010932	Freshwater microbial communities from the Kallisti Limnes subsea pool, Santorini, Greece - 2-BIOTECH-ROV7-P1	Environmental	Open in IMG/M
3300011118	Deep subsurface microbial communities from Aarhus Bay to uncover new lineages of life (NeLLi) - Aarhus_00045 metaG	Environmental	Open in IMG/M
3300011407	Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMGT454_2	Environmental	Open in IMG/M
3300012931	Freshwater wetland microbial communities from Ohio, USA - Open water 3 Core 3 Depth 3 metaG	Environmental	Open in IMG/M
3300012964	Freshwater wetland microbial communities from Ohio, USA - Open water 3 Core 3 Depth 4 metaG	Environmental	Open in IMG/M
3300014656	Groundwater microbial communities from the Aspo Hard Rock Laboratory (HRL) deep subsurface site, Sweden - MM_PC_MetaG	Environmental	Open in IMG/M
3300014913	Subseafloor sediment microbial communities from Guaymas Basin, Gulf of California, Mexico - Guay1, Core 4569-9, 0-3 cm	Environmental	Open in IMG/M
3300014914	Subseafloor sediment microbial communities from Guaymas Basin, Gulf of California, Mexico - Guay2, Core 4569-9, 9-12 cm	Environmental	Open in IMG/M
3300015370	Groundwater microbial communities from the Aspo Hard Rock Laboratory (HRL) deep subsurface site, Sweden - OS_PC_MetaG	Environmental	Open in IMG/M
3300017931	Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_17_100	Environmental	Open in IMG/M
3300017989	Hypersaline lake sediment archaeal communities from the Salton Sea, California, USA - SS_1_MS_2 metaG	Environmental	Open in IMG/M
3300018005	Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_17_150	Environmental	Open in IMG/M
3300018015	Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_11_150	Environmental	Open in IMG/M
3300018055	Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM4_90_coex	Environmental	Open in IMG/M
3300018064	Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_BV02_MP05_10_MG	Environmental	Open in IMG/M
3300018068	Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM4_90_b2	Environmental	Open in IMG/M
3300018088	Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP15_10_MG	Environmental	Open in IMG/M
3300022553	Powell_combined assembly	Environmental	Open in IMG/M
3300022650	Freshwater microbial communities from thermokarst lake SAS2a, Kuujjuarapick, Canada - Sample Winter W3	Environmental	Open in IMG/M
3300024263	Deep subsurface microbial communities from South Atlantic Ocean to uncover new lineages of life (NeLLi) - Benguela_00093 metaG (SPAdes)	Environmental	Open in IMG/M
3300024300 (restricted)	Freshwater microbial communities from Lake Matano, South Sulawesi, Indonesia - Watercolumn_Matano_2014_102_MG	Environmental	Open in IMG/M
3300024528 (restricted)	Seawater microbial communities from Strait of Georgia, British Columbia, Canada - BC1_12_23	Environmental	Open in IMG/M
3300025159	Soil microbial communities from Rifle, Colorado, USA - sediment 16ft 3	Environmental	Open in IMG/M
3300025308	Soil microbial communities from Rifle, Colorado, USA - Groundwater A2	Environmental	Open in IMG/M
3300025322	Soil microbial communities from Rifle, Colorado - Rifle CSP2_sed 16_1 (SPAdes)	Environmental	Open in IMG/M
3300025326	Soil microbial communities from Rifle, Colorado - Rifle CSP2_sed 16_2 (SPAdes)	Environmental	Open in IMG/M
3300025600	Arctic peat soil from Barrow, Alaska - Barrow Graham LP Incubations 11-31A (SPAdes)	Environmental	Open in IMG/M
3300025843	Lake sediment microbial communities from Lake Baikal, Russia to study Microbial Dark Matter (Phase II) - Lake Baikal sediment 0-5 cm (SPAdes)	Environmental	Open in IMG/M
3300027888	Marine sediment microbial communities from White Oak River estuary, North Carolina - WOR-2-30_32 (SPAdes)	Environmental	Open in IMG/M
3300027897	Freshwater lake sediment microbial communities from the University of Notre Dame, USA, for methane emissions studies - DIP11 DI (SPAdes)	Environmental	Open in IMG/M
3300027899	Freshwater lake sediment microbial communities from the University of Notre Dame, USA, for methane emissions studies - PLP11 PL (SPAdes)	Environmental	Open in IMG/M
3300027900	Freshwater lake sediment microbial communities from the University of Notre Dame, USA, for methane emissions studies - BRP12 BR (SPAdes)	Environmental	Open in IMG/M
3300027917	Marine sediment microbial communities from White Oak River estuary, North Carolina - WOR-2-8_12 (SPAdes)	Environmental	Open in IMG/M
3300029288	Leachate microbial communities from a municipal landfill in Southern Ontario, Canada - Leachate well 137-91	Engineered	Open in IMG/M
3300030613	Soil microbial communities from uranium-contaminated site in the Upper Colorado River Basin, Wyoming, United States - RVT92D227	Environmental	Open in IMG/M
3300031255	Salt marsh sediment microbial communities from the Plum Island Ecosystem LTER, Massachusetts, United States - Salt Marsh Sediment SW1603-70	Environmental	Open in IMG/M
3300031275	Salt marsh sediment microbial communities from the Plum Island Ecosystem LTER, Massachusetts, United States - WE1603-90	Environmental	Open in IMG/M
3300031539	Soil microbial communities from Risofladan, Vaasa, Finland - UN-3	Environmental	Open in IMG/M
3300031565	Soil microbial communities from Risofladan, Vaasa, Finland - UN-2	Environmental	Open in IMG/M
3300031653	Salt marsh sediment microbial communities from the Plum Island Ecosystem LTER, Massachusetts, United States - Salt Marsh Sediment SW1601-90	Environmental	Open in IMG/M
3300031654	Salt marsh sediment microbial communities from the Plum Island Ecosystem LTER, Massachusetts, United States - Salt Marsh Sediment SW1601-200	Environmental	Open in IMG/M
3300031862	Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G06_40	Environmental	Open in IMG/M
3300031949	Soil microbial communities from uranium-contaminated site in the Upper Colorado River Basin, Wyoming, United States - RVT98D197	Environmental	Open in IMG/M
3300031999	Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G02_20	Environmental	Open in IMG/M
3300032020	Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G14_18	Environmental	Open in IMG/M
3300032053	Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G09_16	Environmental	Open in IMG/M
3300032069	Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G07_20	Environmental	Open in IMG/M
3300032118	Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G05_15	Environmental	Open in IMG/M
3300032156	Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G14_0	Environmental	Open in IMG/M
3300032163	Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G07_0	Environmental	Open in IMG/M
3300032164	Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G09_0	Environmental	Open in IMG/M
3300032177	Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G05_0	Environmental	Open in IMG/M
3300032397	Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G11_0	Environmental	Open in IMG/M
3300032401	Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G03_0	Environmental	Open in IMG/M
3300032516	Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G02_0	Environmental	Open in IMG/M
3300033416	Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_Aug_OW2_C1_D5_C	Environmental	Open in IMG/M
3300033433	Lab enriched peat soil microbial communities from Michigan Hollow, Ithaca, NY, United States - MHF15MN	Environmental	Open in IMG/M
3300033483	Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_May_M1_C1_D1_A	Environmental	Open in IMG/M

Geographical Distribution

Zoom:	Powered by OpenStreetMap

Structure Viewer


Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100	pTM-score: 0.26
Secondary Structure: α-helix β-sheet Coil Turn	pTM-score: 0.26
Powered by PDBe Molstar

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

Metagenome / Metatranscriptome Family F081499

Overview

Multiple Sequence Alignments

Structure & Topology

Predicted Secondary Structure and Topology

Predicted 3D Structure

Low Quality Model:

Gene Neighborhood

Neighboring Pfam domains

Neighboring Clusters of Orthologous Genes (COGs)

Phylogeny

NCBI Taxonomy

Associated Scaffolds

Environmental Properties

Associated Habitat Types

Associated Samples

Family Sequences

Protein ID	Sample Taxon ID	Habitat	Sequence
B3_GZOS_CLC_01734600	2124908035	Soil	VKVFSLENAYVVERAQVIKNTEGSNDAIVKGEMADTPPGS
Bog_all_C_00352060	2140918008	Soil	VKVFSPENPYFVEQAQVIKNTEGSNAAIVKGEMADTPPGS
TB_LI09_3DRAFT_10573201	3300000229	Groundwater	VKVFSPENAYVVEQAQGIKNPEGSNEAIVRGEMGDTPPGS*
ML8_1008675	3300000491	Lentic	VKAFSLENAYVVEKAQVVRNTEGSNESVVIGEMVDTPPGP*
MLSed_1060201	3300000493	Lentic	VKAFSLENAYAVEKAQVVRNTEGSNESVVIGEMVDT
Draft_100835302	3300000558	Hydrocarbon Resource Environments	VKVFSLENPYDVEQAQVIKNTEGSNEAIVKGXMADXPPGS*
Draft_103541211	3300001580	Hydrocarbon Resource Environments	VFSLENPYDVEQAQVIKNTEGSNEAIVKGKMADSPPGS*
Draft_103546541	3300001580	Hydrocarbon Resource Environments	VFSLENPYDVEQAQVIKNTEGSNEAIVKGEMADTPPGS*
JGI24132J36420_100008158	3300002538	Arctic Peat Soil	VKVFSPENPYVVERAQVIKNTEGSNEAIVTGEMADTPPGS*
JGI24130J36418_100906801	3300002549	Arctic Peat Soil	VKVFSLENAYVVERAQVLKTTEGSNDAIVTGEMADTPPGS*
JGI24136J36422_101487571	3300002569	Arctic Peat Soil	VKVFSLENAYVVERAQVFKVTEGSNDAIVTGEMADTPPGS*
draft_109571641	3300002703	Hydrocarbon Resource Environments	VKVFSLENPYDVEQAQVIKNTEGSNEAIVKGEMADTPPGS*
draft_109572191	3300002703	Hydrocarbon Resource Environments	VKVFSLENPYDVEQAQVIKNTEGSNEAIVKGKMADSPPGS*
draft_110591263	3300002703	Hydrocarbon Resource Environments	VKVFSLENAYDVELAQAIKNTEGSNDAIVKGEMVDTPPGS*
Ga0031655_103363421	3300003852	Freshwater Lake Sediment	KEFSLENAYVVERAQVIKNTEGSNEAIATGEMADTPPGS*
Ga0070722_105049431	3300005601	Marine Sediment	VKVFSPENAIIVEQAQVIKNMEGSNEAIVIGEMVETPPGS*
Ga0078746_10974911	3300005821	Marine Sediment	VKVFSPENAIIVEQAQVIKNMEGSNETIVIGEMVETPPGS*
Ga0074469_111724221	3300005832	Sediment (Intertidal)	VKVFSLENAYVVEQAQVVKNTEGSNEAIVIGEMVDTPPGS*
Ga0074472_114043811	3300005833	Sediment (Intertidal)	VKVFSPENAYGVEQAQVIKNTEGSNVVIVKGEMADTPPGS*
Ga0066795_101563672	3300005938	Soil	VKEFSLENPYVVERAQVIKNTEGSNEAIVKGEMADTPPGS*
Ga0066795_102242732	3300005938	Soil	VKVFSLENPYVVERAQVIKNTEGSNEAIVTGEMVDTPPGS*
Ga0082037_10108803	3300006094	Petroleum Reservoir	VKVFSPENTYVVEQAQVIKNTEGSNEAIVTGEKADTPPGS*
Ga0079037_1015016932	3300006224	Freshwater Wetlands	VKVFSPENAYVVEQVQVIKNTEGSNAVIVKGEMADTPPGS*
Ga0075518_10477552	3300006972	Arctic Peat Soil	VEVFSLENAYVVERAQVLKVTEGSNEAIDTGEMADTPPGS*
Ga0111034_12384901	3300008517	Marine Sediment	VKVFSLENAYVVEQAQVIKNTEGSNETIVIGEMVD
Ga0115863_12444921	3300009034	Sediment, Intertidal	RVKVFSLENAYVVEQAQVIKNMEGSNEAIVIGEMAETPPGS*
Ga0115863_13814291	3300009034	Sediment, Intertidal	VKVFSLENAYDVEQAQVIKNTEGSNEAIVRGEMAETPPGS*
Ga0115863_13931571	3300009034	Sediment, Intertidal	VFSPENAYGVERVDVVKNAEGSNEAIVIGEMAETPPGS*
Ga0115863_16840931	3300009034	Sediment, Intertidal	VKVFSLENAYVVEQAQVIKNTEGSNEAIVIGEMVDTPPGS*
Ga0105152_100381062	3300009039	Lake Sediment	VYSLENAYVVERAQVFKVTEGSNEAIVTGEMADTPPGS*
Ga0105152_101268213	3300009039	Lake Sediment	VKEFSPENANVVEQAQGIKNPEGSNEAIVKGEMADTPPGS*
Ga0102851_103527012	3300009091	Freshwater Wetlands	VKVFSPENAYGVEQAQVIKNTEGSNAVIVKGEMADTPPGS*
Ga0118736_100068622	3300009135	Marine Sediment	VKVFSLENAYVVEQAQVIKNTEGSNETIVIGEMAETPPGS*
Ga0114921_100666011	3300009150	Deep Subsurface	VFSFENAYVVEQAQVVKNTEGSNEAIVIGEMVETPPGS*
Ga0114921_100938312	3300009150	Deep Subsurface	VKVFSLENAYVVEQAQVVKNTEGSNETIVIGEMVDTPPGS*
Ga0114921_106860481	3300009150	Deep Subsurface	VKVYSSENANIVEQAQVIKNMEGSNETIDIGEMVEIPPGS*
Ga0105101_103419401	3300009171	Freshwater Sediment	FSPENAYVVEQAQGIKNPEGSNEAIVKGEMADTPPGS*
Ga0103809_10503881	3300009388	Enrichment Culture	VKVFSLENPYVVEQAQVIKNTEGSNEAIVKGEMADTLPGS*
Ga0114930_105295611	3300009499	Deep Subsurface	VKVFSLENAYVVEQAQVIKNMEGSNEVIVIGEMVEAPPGS*
Ga0118731_1098805202	3300010392	Marine	VKVFSPENAIIVEQAQVIKNMEGSNEAIVIGEMVETPLGS*
Ga0116241_100869193	3300010429	Anaerobic Digestor Sludge	VKVFSLENAYVVEQAQVIKNTEGSNDAIVKGEMADTPPGS*
Ga0118733_1027157341	3300010430	Marine Sediment	MVKVFSFENACVVEQAQVVKNTEGSNETIVIGEMVETPPGS*
Ga0137843_10440142	3300010932	Subsea Pool	VKVFSLENAYVVEQAQVVKNTEGSNEAIVIGEMADNPPGS*
Ga0114922_107671412	3300011118	Deep Subsurface	VKVFSLENAYVVEQAQVVKNTEDNNEVIIIGEMAETPSGS*
Ga0137450_10584772	3300011407	Soil	VKVFSLENAYDVERAQVIKNTEGSNDAIVKGEMVDTPPGS*
Ga0153915_123141131	3300012931	Freshwater Wetlands	ENANVVEQAQGIKNPEGSNEAIVKGEMADTPPGS*
Ga0153916_109067702	3300012964	Freshwater Wetlands	VKEFSLENANVVEQAQGIKNPEGSNEAIVKGEMADTPPGS*
Ga0180007_106561071	3300014656	Groundwater	VKVFSLENAYVVERAQVIKVTEGSNEAIVTGEMVDTPPGS*
Ga0164310_105085041	3300014913	Marine Sediment	SARVKVFSPENAIIVEQAQVIKNMEGSNEAIVIGEMVETPPGS*
Ga0164311_104282861	3300014914	Marine Sediment	MKVYNPKNALIVEQDQMIKNMEVSNKAIAIGEMVETPPGS*
Ga0180009_100182672	3300015370	Groundwater	VKVFSLENPYVVEQAQVIKNTEGSNEAIVTGEMADTPPGS*
Ga0187877_13601831	3300017931	Peatland	VKVFSPENVYVVEEVQGIKNPEGGNEAIVRGEMVDTPPGS
Ga0180432_106249171	3300017989	Hypersaline Lake Sediment	VYSLENGYVVGKTQVVKNTEESNEAIVMGKIVDTPPAQ
Ga0187878_10637893	3300018005	Peatland	VTAGRNPKWVKEFSLENAYVVERAQVIKNTEGSNEAIATGEMADTPPGS
Ga0187866_12847542	3300018015	Peatland	VKVFSLENAYVVEQAQGIKNPEGSNEAIVKGEMADTPPGS
Ga0184616_100883301	3300018055	Groundwater Sediment	VKEFSLENANVVEQAQVIKNTEGSNEAIVKGEMADTPPGS
Ga0187773_106082512	3300018064	Tropical Peatland	VKVFSPENAYGVEQAQVIKNTEGSNEVIVKGEMADTPPGS
Ga0184636_10289732	3300018068	Groundwater Sediment	VKEFSPENAKVVEQAQGIKNAEGSTEAIVKGEMADTPPGS
Ga0184636_10825072	3300018068	Groundwater Sediment	VKVFSLENAYVVERAQVIKNTEGSNEAIVKGEMADTPPGS
Ga0187771_110493701	3300018088	Tropical Peatland	VKVFSPENAYVVEQAQGIKNPEGSNEAIVKGEMADTPPGS
Ga0212124_101745571	3300022553	Freshwater	VFSPENPYVVEQAQVFKATEGSNDAIVKGETADTPPGS
Ga0236339_12450431	3300022650	Freshwater	VKVFSLENAYVVERAQVIKTTEGSNDAIVAGEMADTPPGS
Ga0209978_103444541	3300024263	Deep Subsurface	VKVFSLENAYVVEQVQVIKNMEGSNEAIVIGEMAETPPGS
(restricted) Ga0233420_100179163	3300024300	Freshwater	VKVFSPENAYGVEQAQVIKNTEGSNEAIVRGEMADTPPGS
(restricted) Ga0255045_102078991	3300024528	Seawater	VKVFSPENAIIVEQAQVIKNMEGSNEAIVIGEMVETPPGS
Ga0209619_100733344	3300025159	Soil	VKVSSPENAYVVEQGDVVRNTEYSNEAIVIGEKEVLS
Ga0209211_100947404	3300025308	Soil	VKVSSPENAYVVEQGDVVRNTEYSNEVIVIGEKEVLS
Ga0209641_104522401	3300025322	Soil	VKVSSPKNAYVVEQGDVVRNTEYSNEAIVIGEKEVLS
Ga0209342_101911131	3300025326	Soil	SLENPYVVERAQVIKNTEGSNDAIVKGEMVDTPPGS
Ga0209125_10203601	3300025600	Arctic Peat Soil	SVKVFSLENPYVVERAQVIKNTEGSNEAIVTGEMVDTPPGS
Ga0209182_100214872	3300025843	Lake Sediment	VKEFSPENANVVEQAQGIKNPEGSNEAIVKGEMADTPPGS
Ga0209635_102896472	3300027888	Marine Sediment	VKVFSLENAYVVEQAQVIKNTEGSNETIVIGKMVETPPGS
Ga0209254_105588332	3300027897	Freshwater Lake Sediment	VTAGRNPKWVKEFSLENAYVVERTQVIKNTEGSNAAIVKGEMADTPPG
Ga0209668_103129093	3300027899	Freshwater Lake Sediment	VKVFSLENAYVVEQAQVIKNTEGSNEAIVTGEMADTPPGS
Ga0209253_101103931	3300027900	Freshwater Lake Sediment	PENANGVEQAQVIKNTEGSNEVIVRGEMADTLPGS
Ga0209253_101563881	3300027900	Freshwater Lake Sediment	RVKVFSPENAYGVEQAQVIKNTEGSNAVIVKGEMADTPPGS
Ga0209536_1016294441	3300027917	Marine Sediment	VKVFSLENAYVVEQAQVIKNTEGSNEVIVIGEMAETPPGS
Ga0265297_100819491	3300029288	Landfill Leachate	VKVFSPENTYVVEQAQVIKNTEGSNEAIVTGEKADTPPGS
Ga0265297_102470122	3300029288	Landfill Leachate	SVKVFSPENTYVVEQAQVIKNTEGSNEAIVTGEKADTPPGS
Ga0299915_106780241	3300030613	Soil	VKEFSLENAYVVERAQVIKNTEGSNEAIATGEMADTPP
Ga0315554_10390263	3300031255	Salt Marsh Sediment	VKVFSLENAYVVEQAQVIKNMEGSNEAIVIGEMAETPPGS
Ga0307437_11235971	3300031275	Salt Marsh	VKVFSLENAYIVEQAHVIKNTEGSNETIVIGEMAETPPGS
Ga0307380_104000912	3300031539	Soil	VKVFSLENAYVVEQAQVIKNMEGSNEVIVIGEMAEAPPGS
Ga0307379_100400673	3300031565	Soil	VKVFSLENAYVVEQAQVIKNMEGSNEVIGIGEMAETPPGS
Ga0315550_12090281	3300031653	Salt Marsh Sediment	VKVFSLENAYIVEQAHVIKNTGGSNETIVIGEMAETPPGS
Ga0315549_12938891	3300031654	Salt Marsh Sediment	VKVYSLENAYVVEKAQVVKNTEGSNEAIVIGEMVDTPPGP
Ga0315280_100045898	3300031862	Sediment	VTAGRNPERVKEFSPENAYVVERAQGIKNPEGSNEAIVKGEMVDTPPGS
Ga0315280_100646834	3300031862	Sediment	PENAYVVEQAQGIKNPEGSNEAIVKGEMADTPPGS
Ga0315280_100775843	3300031862	Sediment	VKEFSPENAYVVEQAQGIKNPEGSNEAIVKGEMVDTPPGS
Ga0315280_102366481	3300031862	Sediment	VKEFSPENAYVVEQAQGIKNPEGSNEAIVKGEMADTPPGS
Ga0214473_101031113	3300031949	Soil	VTAGRNPKWVKEFSLENANVVERAQGIKNPEGSNEAIVKGEMADTPPGS
Ga0214473_101966194	3300031949	Soil	VKEFSPENANVVEQAQGIKNPEGSNEAIVKGEMVDTPPGS
Ga0214473_103836382	3300031949	Soil	MFSPENAYGVEQAQVIKNTGGSNAVIVKGEMADTPPGA
Ga0315274_108111662	3300031999	Sediment	VKVFSSENAYVVEPAQVIKNTEGANEAIVRGEMADT
Ga0315296_105352881	3300032020	Sediment	MVIPPEAGLTVKVFSLENANVVEQAQGIKNPEGSNAVIVKGEMADTPPGS
Ga0315296_105354562	3300032020	Sediment	VTAGRNPKWVKEFSLENANVVERAKGIKNPEGSNEAIVKGEMADTPPGS
Ga0315284_106174092	3300032053	Sediment	VKEFSLENANVVEQAQGIKNPEGSNEAIVKGEMADTPPGS
Ga0315282_102455142	3300032069	Sediment	VKEFSPENATVVEQAQGIKNPEGSNEAIVKGEMADTPPGS
Ga0315277_110446892	3300032118	Sediment	VKVFSPENAYGVEQVQVMKNTEGSNAVIVKGEMADTPPGS
Ga0315295_102142131	3300032156	Sediment	VKVFSPENAYGVEQAQVIKNTEGSNGVIVKGEMADTPPGS
Ga0315295_105897511	3300032156	Sediment	PENAKVVEQTQGIKNPEGSNEAIVKGEMADTPPGS
Ga0315281_105224872	3300032163	Sediment	VKVFSPENAYGVEQAQVIKNTEGSNAVIVKGEMADTPPGS
Ga0315281_108311091	3300032163	Sediment	VKELSPENAYVVEPAQGIKNPEGSNEAIGKGEMVDTPPES
Ga0315281_111535541	3300032163	Sediment	VKVFSLENAYGVERAQVMKNTEGSNEAIATGEMVDTPPGS
Ga0315281_122418322	3300032163	Sediment	FSPENAYGVEQAQVIKNTEGSNAVIVKGEMADTPPGS
Ga0315283_102887443	3300032164	Sediment	TAGRNPGRVKEFSPENANVVEQAQGIKNPEGSNEGIVRGEMADTSPGS
Ga0315276_123491162	3300032177	Sediment	KVFSLENAYVVERAQVFKATEGRNEAIVIGEMADTPPGS
Ga0315287_102648972	3300032397	Sediment	VKVFSLENAYVVEQAQVIKNTEGSNEAIVTGEMAETPPGS
Ga0315275_102641412	3300032401	Sediment	VKVFSPENAYGVEQAQVIKNTEGSNEAIVKGEMADTPPGS
Ga0315273_118602851	3300032516	Sediment	VKEFSLENANVVEQAQGIKNTEGSNEAIVKGEMEK
Ga0315273_125328351	3300032516	Sediment	KVFSPENAYVVEQAQGIKNPEGSNEAIVRGEMADTPPGS
Ga0316622_1008743991	3300033416	Soil	ARVKVFSPENAYVVEQAQGIKNPEGSNEAIVIGEMVDTPPGS
Ga0326726_104521542	3300033433	Peat Soil	VKVFSPENAYVVEQAQGIKNREGSNEAIVKGEMADTPPGS
Ga0316629_113285971	3300033483	Soil	VKVFSPENAYGVEQAQVIKNTEGSNEAVVKGEMADTLPGL

Hidden Markov Model


Click on a Sequence Logo column to get its information.
Powered by Skylign