Metagenome / Metatranscriptome Family F081315

Basic Information
Family ID	F081315
Family Type	Metagenome / Metatranscriptome
Number of Sequences	114
Average Sequence Length	41 residues
Representative Sequence	MDPLGTLIVSLGTLILLDLAALQLGGVRRPRTRTRATRSR
Number of Associated Samples	107
Number of Associated Scaffolds	114

Quality Assessment
Transcriptomic Evidence	Yes
Most common taxonomic group	Bacteria
% of genes with valid RBS motifs	71.93 %
% of genes near scaffold ends (potentially truncated)	22.81 %
% of genes from short scaffolds (< 2000 bps)	84.21 %
Associated GOLD sequencing projects	101
AlphaFold2 3D model prediction	Yes
3D model pTM-score	0.45

Most Common Taxonomy
Group	Bacteria (83.333 % of family members)
NCBI Taxonomy ID	2
Taxonomy	All Organisms → cellular organisms → Bacteria

Most Common Ecosystem
GOLD Ecosystem	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil (21.053 % of family members)
Environment Ontology (ENVO)	Unclassified (33.333 % of family members)
Earth Microbiome Project Ontology (EMPO)	Host-associated → Plant → Plant rhizosphere (42.105 % of family members)

Full Alignment
Alignment of all the sequences in the family.

Powered by MSAViewer

Seed Alignment
Alignment of a non-redundant set of sequences, used to build the family's HMM profile.

Powered by MSAViewer

AlphaFold2 Input Alignment
Refined alignment used as input for AlphaFold2.

Powered by MSAViewer

Predicted Topology & Secondary Structure
Classification:	Transmembrane (alpha-helical)	Signal Peptide:	No	Secondary Structure distribution:	α-helix: 35.29% β-sheet: 0.00% Coil/Unstructured: 64.71%
Feature Viewer

Powered by Feature Viewer

Pfam ID	Name	% Frequency in 114 Family Scaffolds
PF04075	F420H2_quin_red	32.46
PF06267	DUF1028	5.26
PF01152	Bac_globin	4.39
PF00478	IMPDH	3.51
PF03699	UPF0182	1.75
PF02540	NAD_synthase	0.88
PF01479	S4	0.88
PF00117	GATase	0.88
PF14748	P5CR_dimer	0.88
PF00293	NUDIX	0.88
PF06153	CdAMP_rec	0.88
PF07676	PD40	0.88
PF04879	Molybdop_Fe4S4	0.88
PF13011	LZ_Tnp_IS481	0.88

COG ID	Name	Functional Category	% Frequency in 114 Family Scaffolds
COG3342	Uncharacterized conserved protein, Ntn-hydrolase superfamily	General function prediction only [R]	5.26
COG2346	Truncated hemoglobin YjbI	Inorganic ion transport and metabolism [P]	4.39
COG1615	Uncharacterized membrane protein, UPF0182 family	Function unknown [S]	1.75
COG0171	NH3-dependent NAD+ synthetase	Coenzyme transport and metabolism [H]	0.88

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:

Name	Rank	Taxonomy	Distribution
All Organisms	root	All Organisms	83.33 %
Unclassified	root	N/A	16.67 %

Name	Rank	Taxonomy	Distribution
cellular organisms	root	All Organisms → cellular organisms	83.33 %
Unclassified	root	N/A	16.67 %

Name	Rank	Taxonomy	Distribution
Bacteria	superkingdom	All Organisms → cellular organisms → Bacteria	83.33 %
Unclassified	root	N/A	16.67 %

Name	Rank	Taxonomy	Distribution
Terrabacteria group	clade	All Organisms → cellular organisms → Bacteria → Terrabacteria group	63.16 %
Unclassified	root	N/A	16.67 %
Proteobacteria	phylum	All Organisms → cellular organisms → Bacteria → Proteobacteria	0.88 %

Name	Rank	Taxonomy	Distribution
Chloroflexi	phylum	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi	57.89 %
Unclassified	root	N/A	16.67 %
Actinobacteria	phylum	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria	2.63 %
delta/epsilon subdivisions	subphylum	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions	0.88 %

Name	Rank	Taxonomy	Distribution
unclassified Chloroflexi	no rank	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi	57.02 %
Unclassified	root	N/A	16.67 %
Deltaproteobacteria	class	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria	0.88 %
Actinomycetia	class	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia	0.88 %

Name	Rank	Taxonomy	Distribution
Chloroflexi bacterium	species	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium	57.02 %
Unclassified	root	N/A	16.67 %
Deltaproteobacteria	class	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria	0.88 %
Actinomycetia	class	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia	0.88 %

Visualization

Powered by ApexCharts

Associated Scaffolds

Scaffold	Taxonomy	Length	IMG/M Link
2170459005\|F1BAP7Q02HBIW7	Not Available	501	Open in IMG/M
3300003324\|soilH2_10025004	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium	1399	Open in IMG/M
3300004114\|Ga0062593_101832995	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium	668	Open in IMG/M
3300004156\|Ga0062589_100543864	All Organisms → cellular organisms → Bacteria	992	Open in IMG/M
3300004463\|Ga0063356_101193739	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium	1104	Open in IMG/M
3300004463\|Ga0063356_103921836	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium	640	Open in IMG/M
3300004479\|Ga0062595_101051991	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium	706	Open in IMG/M
3300004480\|Ga0062592_101692651	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium	615	Open in IMG/M
3300005329\|Ga0070683_101771342	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium	594	Open in IMG/M
3300005331\|Ga0070670_101168184	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium	703	Open in IMG/M
3300005332\|Ga0066388_104217837	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium	733	Open in IMG/M
3300005332\|Ga0066388_108734551	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium	503	Open in IMG/M
3300005337\|Ga0070682_101654868	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium	555	Open in IMG/M
3300005337\|Ga0070682_101963641	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium	514	Open in IMG/M
3300005338\|Ga0068868_100329657	All Organisms → cellular organisms → Bacteria	1302	Open in IMG/M
3300005344\|Ga0070661_100531030	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium	945	Open in IMG/M
3300005406\|Ga0070703_10012742	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium	2382	Open in IMG/M
3300005438\|Ga0070701_11135117	Not Available	552	Open in IMG/M
3300005439\|Ga0070711_101357329	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi	618	Open in IMG/M
3300005468\|Ga0070707_100090075	All Organisms → cellular organisms → Bacteria	2969	Open in IMG/M
3300005471\|Ga0070698_100077349	All Organisms → cellular organisms → Bacteria	3327	Open in IMG/M
3300005471\|Ga0070698_101027228	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium	772	Open in IMG/M
3300005518\|Ga0070699_100017858	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia	6091	Open in IMG/M
3300005536\|Ga0070697_100442264	All Organisms → cellular organisms → Bacteria	1132	Open in IMG/M
3300005545\|Ga0070695_100618207	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium	852	Open in IMG/M
3300005577\|Ga0068857_101274170	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium	713	Open in IMG/M
3300005614\|Ga0068856_101126050	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium	802	Open in IMG/M
3300005616\|Ga0068852_102065473	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium	592	Open in IMG/M
3300005764\|Ga0066903_100471073	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium	2111	Open in IMG/M
3300005764\|Ga0066903_105796713	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium	649	Open in IMG/M
3300005842\|Ga0068858_101110031	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium	776	Open in IMG/M
3300005889\|Ga0075290_1025777	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium	740	Open in IMG/M
3300005937\|Ga0081455_10150669	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria	1794	Open in IMG/M
3300006573\|Ga0074055_11501368	Not Available	571	Open in IMG/M
3300006603\|Ga0074064_11649724	Not Available	600	Open in IMG/M
3300006755\|Ga0079222_12676800	Not Available	502	Open in IMG/M
3300007004\|Ga0079218_10906543	All Organisms → cellular organisms → Bacteria	867	Open in IMG/M
3300009090\|Ga0099827_10929708	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium	754	Open in IMG/M
3300009094\|Ga0111539_10835905	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium	1071	Open in IMG/M
3300009098\|Ga0105245_10588451	All Organisms → cellular organisms → Bacteria	1138	Open in IMG/M
3300009137\|Ga0066709_100537649	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium	1653	Open in IMG/M
3300009143\|Ga0099792_10004921	All Organisms → cellular organisms → Bacteria	5317	Open in IMG/M
3300009162\|Ga0075423_10621130	All Organisms → cellular organisms → Bacteria	1139	Open in IMG/M
3300009174\|Ga0105241_11340708	Not Available	683	Open in IMG/M
3300009176\|Ga0105242_10203739	Not Available	1759	Open in IMG/M
3300009177\|Ga0105248_11266172	Not Available	834	Open in IMG/M
3300009789\|Ga0126307_10143132	Not Available	1912	Open in IMG/M
3300010044\|Ga0126310_10630369	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium	803	Open in IMG/M
3300010362\|Ga0126377_10320250	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium	1536	Open in IMG/M
3300010397\|Ga0134124_11426085	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium	719	Open in IMG/M
3300010400\|Ga0134122_13346796	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium	504	Open in IMG/M
3300011119\|Ga0105246_10916304	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium	787	Open in IMG/M
3300011444\|Ga0137463_1106477	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium	1055	Open in IMG/M
3300012200\|Ga0137382_11227587	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium	532	Open in IMG/M
3300012668\|Ga0157216_10036713	All Organisms → cellular organisms → Bacteria	2487	Open in IMG/M
3300012896\|Ga0157303_10149246	All Organisms → cellular organisms → Bacteria	625	Open in IMG/M
3300012912\|Ga0157306_10038586	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium	1138	Open in IMG/M
3300012914\|Ga0157297_10079725	All Organisms → cellular organisms → Bacteria	936	Open in IMG/M
3300012955\|Ga0164298_10168503	All Organisms → cellular organisms → Bacteria	1249	Open in IMG/M
3300012957\|Ga0164303_10731851	All Organisms → cellular organisms → Bacteria → Terrabacteria group	671	Open in IMG/M
3300012961\|Ga0164302_10558498	Not Available	821	Open in IMG/M
3300012984\|Ga0164309_10768972	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium	772	Open in IMG/M
3300012985\|Ga0164308_11025020	Not Available	735	Open in IMG/M
3300012988\|Ga0164306_11862810	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium	523	Open in IMG/M
3300012989\|Ga0164305_11228613	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium	651	Open in IMG/M
3300013297\|Ga0157378_11082890	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium	838	Open in IMG/M
3300014311\|Ga0075322_1170416	Not Available	544	Open in IMG/M
3300014325\|Ga0163163_11949029	All Organisms → cellular organisms → Bacteria → Terrabacteria group	647	Open in IMG/M
3300014829\|Ga0120104_1114630	Not Available	546	Open in IMG/M
3300015162\|Ga0167653_1003449	All Organisms → cellular organisms → Bacteria	3558	Open in IMG/M
3300015203\|Ga0167650_1061190	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium	924	Open in IMG/M
3300015371\|Ga0132258_10860041	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium	2289	Open in IMG/M
3300015372\|Ga0132256_100530645	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium	1289	Open in IMG/M
3300017792\|Ga0163161_11610102	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium	573	Open in IMG/M
3300017792\|Ga0163161_11650817	Not Available	566	Open in IMG/M
3300017965\|Ga0190266_11087861	Not Available	544	Open in IMG/M
3300017997\|Ga0184610_1007938	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria	2586	Open in IMG/M
3300018000\|Ga0184604_10010672	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium	1934	Open in IMG/M
3300018071\|Ga0184618_10074815	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium	1284	Open in IMG/M
3300018433\|Ga0066667_11817546	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium	552	Open in IMG/M
3300019888\|Ga0193751_1020193	All Organisms → cellular organisms → Bacteria	3298	Open in IMG/M
3300021073\|Ga0210378_10001506	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium	12193	Open in IMG/M
3300021073\|Ga0210378_10252900	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium	667	Open in IMG/M
3300021080\|Ga0210382_10333982	Not Available	668	Open in IMG/M
3300021090\|Ga0210377_10096799	All Organisms → cellular organisms → Bacteria	1976	Open in IMG/M
3300021344\|Ga0193719_10043591	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium	1944	Open in IMG/M
3300021363\|Ga0193699_10072879	Not Available	1358	Open in IMG/M
3300024181\|Ga0247693_1051895	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium	595	Open in IMG/M
3300025910\|Ga0207684_11301779	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium	598	Open in IMG/M
3300025911\|Ga0207654_10731301	Not Available	712	Open in IMG/M
3300025922\|Ga0207646_10011423	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium	8606	Open in IMG/M
3300025937\|Ga0207669_11810057	All Organisms → cellular organisms → Bacteria → Terrabacteria group	522	Open in IMG/M
3300025941\|Ga0207711_11246223	Not Available	685	Open in IMG/M
3300026023\|Ga0207677_10299753	All Organisms → cellular organisms → Bacteria	1327	Open in IMG/M
3300026041\|Ga0207639_12113019	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium	524	Open in IMG/M
3300026109\|Ga0208774_1045742	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria	669	Open in IMG/M
3300026116\|Ga0207674_11263987	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium	708	Open in IMG/M
3300026142\|Ga0207698_11870885	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium	615	Open in IMG/M
3300026320\|Ga0209131_1040124	All Organisms → cellular organisms → Bacteria	2694	Open in IMG/M
3300028589\|Ga0247818_10833364	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium	645	Open in IMG/M
3300028722\|Ga0307319_10007836	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium	3244	Open in IMG/M
3300028784\|Ga0307282_10315229	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium	754	Open in IMG/M
3300028793\|Ga0307299_10029618	All Organisms → cellular organisms → Bacteria	1986	Open in IMG/M
3300028799\|Ga0307284_10094489	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium	1111	Open in IMG/M
3300028824\|Ga0307310_10002034	All Organisms → cellular organisms → Bacteria	7597	Open in IMG/M
3300028828\|Ga0307312_10187465	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium	1325	Open in IMG/M
3300028878\|Ga0307278_10026887	All Organisms → cellular organisms → Bacteria	2642	Open in IMG/M
3300028880\|Ga0307300_10037327	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium	1343	Open in IMG/M
3300028889\|Ga0247827_10660064	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium	677	Open in IMG/M
3300030006\|Ga0299907_10738061	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium	749	Open in IMG/M
3300031716\|Ga0310813_10818030	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium	840	Open in IMG/M
3300032002\|Ga0307416_100377614	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium	1446	Open in IMG/M
3300032126\|Ga0307415_100202424	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium	1577	Open in IMG/M
3300033811\|Ga0364924_000432	All Organisms → cellular organisms → Bacteria	6401	Open in IMG/M

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:

Habitat	Taxonomy	Distribution
Environmental	Environmental	71.93%
Host-Associated	Host-Associated	28.07%

Habitat	Taxonomy	Distribution
Terrestrial	Environmental → Terrestrial	64.91%
Plants	Host-Associated → Plants	28.07%
Aquatic	Environmental → Aquatic	7.02%

Habitat	Taxonomy	Distribution
Soil	Environmental → Terrestrial → Soil	64.04%
Rhizosphere	Host-Associated → Plants → Rhizosphere	14.04%
Rhizoplane	Host-Associated → Plants → Rhizoplane	13.16%
Freshwater	Environmental → Aquatic → Freshwater	3.51%
Sediment	Environmental → Aquatic → Sediment	3.51%
Floodplain	Environmental → Terrestrial → Floodplain	0.88%
Roots	Host-Associated → Plants → Roots	0.88%

Habitat	Taxonomy	Distribution
Unclassified	Environmental → Terrestrial → Soil → Unclassified	45.61%
Loam	Environmental → Terrestrial → Soil → Loam	15.79%
Epiphytes	Host-Associated → Plants → Rhizoplane → Epiphytes	12.28%
Unclassified	Host-Associated → Plants → Rhizosphere → Unclassified	10.53%
Sediment	Environmental → Aquatic → Freshwater → Sediment	3.51%
Unclassified	Environmental → Aquatic → Sediment → Unclassified	3.51%
Soil	Host-Associated → Plants → Rhizosphere → Soil	3.51%
Wetlands	Environmental → Terrestrial → Soil → Wetlands	2.63%
Sediment	Environmental → Terrestrial → Floodplain → Sediment	0.88%
Unclassified	Host-Associated → Plants → Rhizoplane → Unclassified	0.88%
Rhizosphere	Host-Associated → Plants → Roots → Rhizosphere	0.88%

Habitat	Taxonomy	Distribution
Unclassified	Environmental → Terrestrial → Soil → Unclassified → Unclassified	32.46%
Agricultural Soil	Environmental → Terrestrial → Soil → Loam → Agricultural Soil	12.28%
Unclassified	Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified	12.28%
Unclassified	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified	10.53%
Agricultural Land	Environmental → Terrestrial → Soil → Unclassified → Agricultural Land	6.14%
Unclassified	Environmental → Aquatic → Freshwater → Sediment → Unclassified	3.51%
Unclassified	Environmental → Aquatic → Sediment → Unclassified → Unclassified	3.51%
Grasslands	Environmental → Terrestrial → Soil → Unclassified → Grasslands	3.51%
Forest Soil	Environmental → Terrestrial → Soil → Loam → Forest Soil	3.51%
Unclassified	Host-Associated → Plants → Rhizosphere → Soil → Unclassified	3.51%
Unclassified	Environmental → Terrestrial → Soil → Wetlands → Unclassified	2.63%
Agricultural	Environmental → Terrestrial → Soil → Unclassified → Agricultural	1.75%
Permafrost	Environmental → Terrestrial → Soil → Unclassified → Permafrost	0.88%
Forest Soil	Environmental → Terrestrial → Soil → Unclassified → Forest Soil	0.88%
Unclassified	Environmental → Terrestrial → Floodplain → Sediment → Unclassified	0.88%
Unclassified	Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified	0.88%
Soil	Host-Associated → Plants → Roots → Rhizosphere → Soil	0.88%

Habitat	Taxonomy	Distribution
Soil	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil	21.05%
Corn, Switchgrass And Miscanthus Rhizosphere	Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere	9.65%
Corn Rhizosphere	Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere	5.26%
Groundwater Sediment	Environmental → Aquatic → Freshwater → Sediment → Unclassified → Groundwater Sediment	3.51%
Soil	Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil	3.51%
Tropical Forest Soil	Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil	3.51%
Groundwater Sediment	Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment	2.63%
Vadose Zone Soil	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil	2.63%
Glacier Forefield Soil	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Glacier Forefield Soil	2.63%
Grasslands Soil	Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil	2.63%
Corn Rhizosphere	Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere	2.63%
Miscanthus Rhizosphere	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere	2.63%
Soil	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil	1.75%
Terrestrial Soil	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil	1.75%
Serpentine Soil	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Serpentine Soil	1.75%
Agricultural Soil	Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil	1.75%
Soil	Environmental → Terrestrial → Soil → Unclassified → Agricultural → Soil	1.75%
Rice Paddy Soil	Environmental → Terrestrial → Soil → Wetlands → Unclassified → Rice Paddy Soil	1.75%
Arabidopsis Thaliana Rhizosphere	Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Arabidopsis Thaliana Rhizosphere	1.75%
Miscanthus Rhizosphere	Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere	1.75%
Switchgrass Rhizosphere	Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere	1.75%
Populus Rhizosphere	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere	1.75%
Rhizosphere	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere	1.75%
Switchgrass Rhizosphere	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere	1.75%
Corn Rhizosphere	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere	1.75%
Soil	Environmental → Aquatic → Sediment → Unclassified → Unclassified → Soil	0.88%
Tropical Forest Soil	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil	0.88%
Sugarcane Root And Bulk Soil	Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Sugarcane Root And Bulk Soil	0.88%
Permafrost	Environmental → Terrestrial → Soil → Unclassified → Permafrost → Permafrost	0.88%
Grass Soil	Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grass Soil	0.88%
Soil	Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil	0.88%
Natural And Restored Wetlands	Environmental → Terrestrial → Soil → Wetlands → Unclassified → Natural And Restored Wetlands	0.88%
Sediment	Environmental → Terrestrial → Floodplain → Sediment → Unclassified → Sediment	0.88%
Arabidopsis Rhizosphere	Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere	0.88%
Tabebuia Heterophylla Rhizosphere	Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Tabebuia Heterophylla Rhizosphere	0.88%
Switchgrass Rhizosphere	Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere	0.88%
Switchgrass Rhizosphere	Host-Associated → Plants → Roots → Rhizosphere → Soil → Switchgrass Rhizosphere	0.88%
Miscanthus Rhizosphere	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere	0.88%
Switchgrass Rhizosphere	Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere	0.88%
Miscanthus Rhizosphere	Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Miscanthus Rhizosphere	0.88%
Corn Rhizosphere	Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere	0.88%
Arabidopsis Rhizosphere	Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Arabidopsis Rhizosphere	0.88%

Visualization

Powered by ApexCharts

Associated Samples

Taxon OID	Sample Name	Habitat Type	IMG/M Link
2170459005	Grass soil microbial communities from Rothamsted Park, UK - July 2009 direct MP BIO1O1 lysis 0-21cm	Environmental	Open in IMG/M
3300003324	Sugarcane bulk soil Sample H2	Environmental	Open in IMG/M
3300004114	Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of AARS Block 5	Environmental	Open in IMG/M
3300004156	Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Combined assembly of AARS Block 1	Environmental	Open in IMG/M
3300004463	Combined assembly of Arabidopsis thaliana microbial communities	Host-Associated	Open in IMG/M
3300004479	Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of All WPAs	Environmental	Open in IMG/M
3300004480	Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of AARS Block 4	Environmental	Open in IMG/M
3300005329	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG	Environmental	Open in IMG/M
3300005331	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG	Host-Associated	Open in IMG/M
3300005332	Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly)	Environmental	Open in IMG/M
3300005337	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG	Environmental	Open in IMG/M
3300005338	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2	Host-Associated	Open in IMG/M
3300005344	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG	Host-Associated	Open in IMG/M
3300005406	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG	Environmental	Open in IMG/M
3300005438	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG	Environmental	Open in IMG/M
3300005439	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG	Environmental	Open in IMG/M
3300005468	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG	Environmental	Open in IMG/M
3300005471	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG	Environmental	Open in IMG/M
3300005518	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG	Environmental	Open in IMG/M
3300005536	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG	Environmental	Open in IMG/M
3300005545	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG	Environmental	Open in IMG/M
3300005577	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2	Host-Associated	Open in IMG/M
3300005614	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2	Host-Associated	Open in IMG/M
3300005616	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2	Host-Associated	Open in IMG/M
3300005764	Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2)	Environmental	Open in IMG/M
3300005842	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2	Host-Associated	Open in IMG/M
3300005889	Rice paddy soil microbial communities from Twitchell Island, California, USA - SF_Rice_20C_80N_201	Environmental	Open in IMG/M
3300005937	Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1	Host-Associated	Open in IMG/M
3300006573	Soil and rhizosphere microbial communities from Centre INRS-Institut Armand-Frappier, Laval, Canada - Soil microcosm metaTmtLAC (Metagenome Metatranscriptome)	Environmental	Open in IMG/M
3300006603	Soil and rhizosphere microbial communities from Centre INRS-Institut Armand-Frappier, Laval, Canada - Soil microcosm metaTmtHMC (Metagenome Metatranscriptome)	Environmental	Open in IMG/M
3300006755	Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Plitter	Environmental	Open in IMG/M
3300007004	Agricultural soil microbial communities from Utah to study Nitrogen management - NC Compost	Environmental	Open in IMG/M
3300009090	Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con1.8 metaG	Environmental	Open in IMG/M
3300009094	Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2)	Host-Associated	Open in IMG/M
3300009098	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG	Host-Associated	Open in IMG/M
3300009137	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_158	Environmental	Open in IMG/M
3300009143	Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_2	Environmental	Open in IMG/M
3300009162	Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD2	Host-Associated	Open in IMG/M
3300009174	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG	Host-Associated	Open in IMG/M
3300009176	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG	Host-Associated	Open in IMG/M
3300009177	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG	Host-Associated	Open in IMG/M
3300009789	Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot28	Environmental	Open in IMG/M
3300010044	Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot60	Environmental	Open in IMG/M
3300010362	Tropical forest soil microbial communities from Panama - MetaG Plot_22	Environmental	Open in IMG/M
3300010397	Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-4	Environmental	Open in IMG/M
3300010400	Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-2	Environmental	Open in IMG/M
3300011119	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG	Host-Associated	Open in IMG/M
3300011444	Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMGT800_2	Environmental	Open in IMG/M
3300012200	Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_20_16 metaG	Environmental	Open in IMG/M
3300012668	Arctic soils microbial communities. Combined Assembly of 23 SPs	Environmental	Open in IMG/M
3300012896	Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S118-311C-2	Environmental	Open in IMG/M
3300012912	Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S163-409C-2	Environmental	Open in IMG/M
3300012914	Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S028-104C-2	Environmental	Open in IMG/M
3300012955	Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_216_MG	Environmental	Open in IMG/M
3300012957	Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_207_MG	Environmental	Open in IMG/M
3300012961	Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_202_MG	Environmental	Open in IMG/M
3300012984	Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_247_MG	Environmental	Open in IMG/M
3300012985	Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_246_MG	Environmental	Open in IMG/M
3300012988	Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_242_MG	Environmental	Open in IMG/M
3300012989	Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_237_MG	Environmental	Open in IMG/M
3300013297	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG	Host-Associated	Open in IMG/M
3300014311	Natural and restored wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - MayberryNW_CattailB_D1	Environmental	Open in IMG/M
3300014325	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG	Host-Associated	Open in IMG/M
3300014829	Permafrost microbial communities from Nunavut, Canada - A10_35cm_6M	Environmental	Open in IMG/M
3300015162	Arctic soil microbial communities from a glacier forefield, Storglaci?ren, Tarfala, Sweden (Sample st-4c, rock/ice/stream interface)	Environmental	Open in IMG/M
3300015203	Arctic soil microbial communities from a glacier forefield, Storglaci?ren, Tarfala, Sweden (Sample st-3c, vegetated patch on medial moraine)	Environmental	Open in IMG/M
3300015371	Combined assembly of cpr5 and col0 rhizosphere and soil	Host-Associated	Open in IMG/M
3300015372	Soil combined assembly	Host-Associated	Open in IMG/M
3300017792	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG	Host-Associated	Open in IMG/M
3300017965	Populus adjacent soil microbial communities from riparian zone of Indian Creek, Utah, USA - 220 T	Environmental	Open in IMG/M
3300017997	Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_100_coex	Environmental	Open in IMG/M
3300018000	Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM0_5_coex	Environmental	Open in IMG/M
3300018071	Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM0_30_b1	Environmental	Open in IMG/M
3300018433	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_116	Environmental	Open in IMG/M
3300019888	Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? L1c2	Environmental	Open in IMG/M
3300021073	Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_60_b1 redo	Environmental	Open in IMG/M
3300021080	Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM0_60_coex redo	Environmental	Open in IMG/M
3300021090	Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM4_65_b1 redo	Environmental	Open in IMG/M
3300021344	Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U2a2	Environmental	Open in IMG/M
3300021363	Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? L3c2	Environmental	Open in IMG/M
3300024181	Soil microbial communities from Purdue University Martell Research Forest, Indiana, United States - CNK34	Environmental	Open in IMG/M
3300025910	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes)	Environmental	Open in IMG/M
3300025911	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes)	Host-Associated	Open in IMG/M
3300025922	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes)	Environmental	Open in IMG/M
3300025937	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes)	Host-Associated	Open in IMG/M
3300025941	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes)	Host-Associated	Open in IMG/M
3300026023	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes)	Host-Associated	Open in IMG/M
3300026041	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes)	Host-Associated	Open in IMG/M
3300026109	Rice paddy soil microbial communities from Twitchell Island, California, USA - SF_Rice_5C_80N_405 (SPAdes)	Environmental	Open in IMG/M
3300026116	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes)	Host-Associated	Open in IMG/M
3300026142	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes)	Host-Associated	Open in IMG/M
3300026320	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_40cm (SPAdes)	Environmental	Open in IMG/M
3300028589	Soil microbial communities from agricultural site in Penn Yan, New York, United States - 13C_Glucose_Day1	Environmental	Open in IMG/M
3300028722	Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_368	Environmental	Open in IMG/M
3300028784	Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_121	Environmental	Open in IMG/M
3300028793	Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_159	Environmental	Open in IMG/M
3300028799	Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_123	Environmental	Open in IMG/M
3300028824	Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_197	Environmental	Open in IMG/M
3300028828	Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_202	Environmental	Open in IMG/M
3300028878	Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_117	Environmental	Open in IMG/M
3300028880	Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_181	Environmental	Open in IMG/M
3300028889	Soil microbial communities from agricultural site in Penn Yan, New York, United States - 12C_Control_Day2	Environmental	Open in IMG/M
3300030006	Soil microbial communities from uranium-contaminated site in the Upper Colorado River Basin, Wyoming, United States - RVT152D67	Environmental	Open in IMG/M
3300031716	Soil microbial communities from experimental microcosm in Duke University, North Carolina, United States - YN3	Environmental	Open in IMG/M
3300032002	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3	Host-Associated	Open in IMG/M
3300032126	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2	Host-Associated	Open in IMG/M
3300033811	Sediment microbial communities from East River floodplain, Colorado, United States - 28_j17	Environmental	Open in IMG/M

Geographical Distribution

Zoom:	Powered by OpenStreetMap

Family Sequences

Protein ID	Sample Taxon ID	Habitat	Sequence
E41_12070010	2170459005	Grass Soil	MDPLGTLILSLGTLIVLDLAALKLGGIRRPRSRTRATRSR
soilH2_100250042	3300003324	Sugarcane Root And Bulk Soil	MDPLGTLIVSLGTLIVLDLAALQLGGPRRQRTRTRAARTR*
Ga0062593_1018329951	3300004114	Soil	MDPLGTLIVTLGTLLILDIAALQLGGARRPRNRARGPRR*
Ga0062589_1005438643	3300004156	Soil	MDPLGTLIVTLGTLVILDIAALQLGGYRRPRSRARGSRR*
Ga0063356_1011937392	3300004463	Arabidopsis Thaliana Rhizosphere	MDPLGTLIISLGALIVLDLAALRMGRSARPRPRVRTARPR*
Ga0063356_1039218362	3300004463	Arabidopsis Thaliana Rhizosphere	MDPLATLIVSLGTLLVLDLAALQLGGVRRPKNRARATRSR*
Ga0062595_1010519912	3300004479	Soil	MDPLGTLIVTLGTLLILDIAALQLGKASRPRDRVRGSRR*
Ga0062592_1016926512	3300004480	Soil	ASARIGHMDPLGTLIVTLGTLVILDIAALQLGGYRRPRSRARGSRR*
Ga0070683_1017713421	3300005329	Corn Rhizosphere	MDPLGTLIVTLGTLVILDIAALQLGKVRRPRDRARGSRR*
Ga0070670_1011681842	3300005331	Switchgrass Rhizosphere	MDPLGTLIVSLGTLIVLDLAALQLGAPRRSRTRTRATRSR*
Ga0066388_1042178372	3300005332	Tropical Forest Soil	MDPLGTLIVSLGTLIVLDLVALQLGGPRRPRTRTRATRSR*
Ga0066388_1087345511	3300005332	Tropical Forest Soil	MDPLTTLIVSLGALIVLDLAALQLGGPRRPRTRSRVVRPR*
Ga0070682_1016548681	3300005337	Corn Rhizosphere	MDPLGTLIVTLGTLVILDIAALQLGKTRRPRDRARGSRR*
Ga0070682_1019636412	3300005337	Corn Rhizosphere	MDPLGTLIVSLGTLIVLDLAARQLGAPQRPRSRSKATRSR*
Ga0068868_1003296572	3300005338	Miscanthus Rhizosphere	MDPLGTLIVSLGALIVIDLAAHQLGGPRRPRPRPRVTRSR*
Ga0070661_1005310301	3300005344	Corn Rhizosphere	MDPLGTLIVTLGTLVILDIAALQLGKSSRPRPRVKGSRR*
Ga0070703_100127423	3300005406	Corn, Switchgrass And Miscanthus Rhizosphere	MDPLGTLIVSLGALIVLDLAALQLGGIRRPRSRTRATRSR*
Ga0070701_111351171	3300005438	Corn, Switchgrass And Miscanthus Rhizosphere	RHREDRNMDPLGTLIVTLGTLVILDIAALQLGKVRRPRDRARGSRR*
Ga0070711_1013573292	3300005439	Corn, Switchgrass And Miscanthus Rhizosphere	PMDPLGTLIVSLGTLIVLDLAARQLGGGRRSRTRSRATRSR*
Ga0070707_1000900751	3300005468	Corn, Switchgrass And Miscanthus Rhizosphere	ATKGWTEMDPLGTLLVSLGTLIVLDLAARQLGGPRRSRTRTRATRSR*
Ga0070698_1000773494	3300005471	Corn, Switchgrass And Miscanthus Rhizosphere	MDPLGTLIVTLGTLLILDLAALSLGGSRKSRSRARTARSR*
Ga0070698_1010272282	3300005471	Corn, Switchgrass And Miscanthus Rhizosphere	MDPLGTLVVSLGTLIVLNLAALQLGGIRRPRTRSRATRPR*
Ga0070699_1000178583	3300005518	Corn, Switchgrass And Miscanthus Rhizosphere	MDPLGTLIVTLGTLLILDLAALSLGGSRKSRTKARTARSR*
Ga0070697_1004422642	3300005536	Corn, Switchgrass And Miscanthus Rhizosphere	MDPIATLIVSLGTLIVLDLAALQLGGVRRPRTRTRATRPR*
Ga0070695_1006182071	3300005545	Corn, Switchgrass And Miscanthus Rhizosphere	MATKGWTEMDPLGTLIVSLGTLIVLDLAALQLGGPRRPRTRTRAARSR*
Ga0068857_1012741702	3300005577	Corn Rhizosphere	LPMATKGWTEMDPLGTLIVSLGTLIVLDLAALQLGGTRRSRTRARAARSR*
Ga0068856_1011260502	3300005614	Corn Rhizosphere	MDPLGTLIVSLGALIVIDLAAHQPAGHDGLVPSRVIRSR*
Ga0068852_1020654732	3300005616	Corn Rhizosphere	VVAGTKRHREDRNMDPLGTLIVTLGTLVILDIAALQLGGYRRPRSRARGSRR*
Ga0066903_1004710731	3300005764	Tropical Forest Soil	MDPLGTLIVSLGTLIVLDLAALQLGGGRRSRNRSRATRSR*
Ga0066903_1057967131	3300005764	Tropical Forest Soil	MDPLGTLIVTLGTLVILDLAALQLGRTSRPRSRARGSRR*
Ga0068858_1011100311	3300005842	Switchgrass Rhizosphere	VVAGTKRHREDRNMDPLGTLIVTLGTLVILDIAALQLGKARRPRDRARGSRR*
Ga0075290_10257771	3300005889	Rice Paddy Soil	MDPLGTLIVSLGTLIVLDLAALQLGGPRRTRTRPRPSRSR*
Ga0081455_101506692	3300005937	Tabebuia Heterophylla Rhizosphere	MDPLGTLIVTLGTLVILDFAALKLGERKQPRGRARSTRRAPPTSAIRT*
Ga0074055_115013682	3300006573	Soil	MDPLGTLIVTLGTLVILDIAALQLGKARRPRTRARGSRR*
Ga0074064_116497242	3300006603	Soil	ARDGPMDPLGTLIVSLGALIVIDLAAHQLGGPRRPRPRSRAIRSR*
Ga0079222_126768001	3300006755	Agricultural Soil	MVRSRHLPMATKGWTEMDPLGTLIVSLGTLILLDLAALQLGGSRRSRTRSKATRTR*
Ga0079218_109065433	3300007004	Agricultural Soil	MDPLGTLIVTLGTLLILDLAALQLGGYRRPRARARGRR*
Ga0099827_109297082	3300009090	Vadose Zone Soil	KYRMDPLGTLIVSLGALLVLDLAALQLGGSKRRRRTRPRYR*
Ga0111539_108359052	3300009094	Populus Rhizosphere	MDPLGTLIVTLGTLVVLDLAALQLGGYRRPRARARGRR*
Ga0105245_105884511	3300009098	Miscanthus Rhizosphere	RDGPMDPLGTLIVSLGTLIVLDLAARQLGAPQRPRSRSKATRSR*
Ga0066709_1005376491	3300009137	Grasslands Soil	MDPLGTLLVSLGTLIVLDLAALQLGAPRRSRTRIRAIRSR*
Ga0099792_100049215	3300009143	Vadose Zone Soil	MDPLGTLIVTLGALLVLDLAALQLGGSRRRRQTRPRYR*
Ga0075423_106211303	3300009162	Populus Rhizosphere	MDPLGTLIVTLGTLLILDIAALQLGKASRPRDRVR
Ga0105241_113407082	3300009174	Corn Rhizosphere	DPLGTLIVSLGTLIVLDLAALQLGGPRRPRTRTRAARSR*
Ga0105242_102037392	3300009176	Miscanthus Rhizosphere	VVAGTKRHREDRNMDPLGTLIVTLGTLVILDIAALQLGKVRRPRDRARGSRR*
Ga0105248_112661721	3300009177	Switchgrass Rhizosphere	ASGGIVVAGTKRHREDRNMDPLGTLIVTLGTLVILDIAALQLGKVRRPRDRARGSRR*
Ga0126307_101431321	3300009789	Serpentine Soil	MDPLGTLIVSLGALIVLDLAARQLGAPRRSRTRIRATRSR*
Ga0126310_106303692	3300010044	Serpentine Soil	MDPLATLIVSLGTLIVLDLAAIQLGGSRRSRNRIRPARSR*
Ga0126377_103202502	3300010362	Tropical Forest Soil	MDPLGTLIVTLGTLVILDLAALQLGGTRRPRSRSRGRRSA*
Ga0134124_114260852	3300010397	Terrestrial Soil	MATKGWTEMDPLGTLLVSLGTLIVLDLAALQLGGPRRSRTRTRATRSR*
Ga0134122_133467962	3300010400	Terrestrial Soil	MDLKDGPMDPLGTLIVSLGALIVLDLAALQLGGPRRRTRSRVTRSR*
Ga0105246_109163042	3300011119	Miscanthus Rhizosphere	MDPLGTLIVSLGTLIVLDLAARQLGAPRRPRTRTRATRSR*
Ga0137463_11064772	3300011444	Soil	MATKGWTEMDPLGTLIVSLGTLIVLDLAALQLGGSRRSRTRTRATRSR*
Ga0137382_112275872	3300012200	Vadose Zone Soil	MDPLGTLIVSLGALIVLNLAALQLGGIRRPRSRTRATRSR*
Ga0157216_100367131	3300012668	Glacier Forefield Soil	MATKGWTEMDPLGTLIVSLGTLIVLDLAALQLGGPRRSRTRTRATRSR*
Ga0157303_101492461	3300012896	Soil	NMDPLGTLIVTLGTLLILDIAALQLGKASRPRDRVRGSRR*
Ga0157306_100385863	3300012912	Soil	MDPLGTLIVTLGTLLILDIAALQLGGGRRPRNRVRGPRR*
Ga0157297_100797253	3300012914	Soil	MDPLGTLIVTLGTLVILDIAALQLGKASRPRDRVRGSRR*
Ga0164298_101685031	3300012955	Soil	LIVSLGALIVIDLAAHQLGGPRRPRPRPRVTRSR*
Ga0164303_107318512	3300012957	Soil	MDPLGTLIVTLGTLVILDIAALQLGKARRPRDRARGSRR*
Ga0164302_105584981	3300012961	Soil	AEIARDGSMDPLGTLIVSLGALIVIDLAAHQLGGSRRPRPRPRVTRSR*
Ga0164309_107689722	3300012984	Soil	MDPLGTLIVTLGTLLILDIAALQLGKARRPRDRARGSRR*
Ga0164308_110250201	3300012985	Soil	MDPLGTLLVSLGALIVIDLAAHQLGGPRRPRPRSRVIRSR*
Ga0164306_118628102	3300012988	Soil	MDPLGTLIVSLGTLILLDLAALQLGGIRRPRNRTRATRSR*
Ga0164305_112286131	3300012989	Soil	MDPLGTLIVSLGTLIVLDLAARQLGAPQRPRSRSKATLT
Ga0157378_110828902	3300013297	Miscanthus Rhizosphere	MDPLGTLIVTLGTLVILDIDAHQLGKIRRPRARARGSRR*
Ga0075322_11704161	3300014311	Natural And Restored Wetlands	MDPLGTLIVSLGTLIVLDLAALQLGGSRRTRARTRPSRSR*
Ga0163163_119490292	3300014325	Switchgrass Rhizosphere	MDPLGTLIVTLGTLVILDIAALQLGKVRRPRDRATGSRR*
Ga0120104_11146302	3300014829	Permafrost	LGTLIVSLGTLILLDLAALQLGGIRRPRNRIRATRSR*
Ga0167653_10034492	3300015162	Glacier Forefield Soil	MDPLGTLIVSLGTLILLDLAALQLGGVRRPRTRTRATRSR*
Ga0167650_10611902	3300015203	Glacier Forefield Soil	MDPLGTLILSLGTLIVLDLAALQLGGPRRQRSRIRAHRPR*
Ga0132258_108600413	3300015371	Arabidopsis Rhizosphere	MDPLGTLIVTLGTLVILDIAALQLGKTRRPRNRARGSRR*
Ga0132256_1005306453	3300015372	Arabidopsis Rhizosphere	MDPLGTLIVTLGTLVILDIAALQLGKARRPRDRARSSRR*
Ga0163161_116101021	3300017792	Switchgrass Rhizosphere	MDPLGTLIVTLGTLLIMDLAALQLGRVQKPRTRARG
Ga0163161_116508171	3300017792	Switchgrass Rhizosphere	MDPLGTLIVTLGTLVILDIAALQLGKVRRPRDRARGSRR
Ga0190266_110878611	3300017965	Soil	MDPLGTLIVTLGTLVVLDLAALQLGGYRRPRARARGRR
Ga0184610_10079382	3300017997	Groundwater Sediment	MDPLGTLIIALGTLIVIDLAALRLGRSARPRPRVRTARPR
Ga0184604_100106722	3300018000	Groundwater Sediment	MDPLGTLIVSLGALLILDLAALQLGGPKRRRRARPRYR
Ga0184618_100748151	3300018071	Groundwater Sediment	MDPLGTLIVSLGALIVLNLAAHQLGGIRRPRSRTRATRSR
Ga0066667_118175461	3300018433	Grasslands Soil	MDPLGTLLVSLGTLIVLDLAALQLGAPRRSRTRIRAIRSR
Ga0193751_10201933	3300019888	Soil	MDPLGTLIVSLGTLILLDLAALQLGGIRRPRNRTRATRSR
Ga0210378_100015063	3300021073	Groundwater Sediment	MDPLGTLIIALGALIVIDVAALRLGRSARPRPRVRTARPR
Ga0210378_102529001	3300021073	Groundwater Sediment	MDPLATLIVSLGTLLVLDLAALQLGGVRRPKNRVRATRSR
Ga0210382_103339822	3300021080	Groundwater Sediment	MDPFGTLIVSVGALIVLNLAAHQLGGIRRPRSRTRATRSR
Ga0210377_100967993	3300021090	Groundwater Sediment	MATKGWTEMDPLGTLLVSLGTLIVLDLAALQLGGSRRSRTRTRATRSR
Ga0193719_100435913	3300021344	Soil	MDPLGTLIVSLGTLLILDLAALSLGGSRKSRNKARTARSR
Ga0193699_100728791	3300021363	Soil	MDPLGTLIVSLGALLVIDLAARQLGRPRRRPAPRPRYR
Ga0247693_10518952	3300024181	Soil	MATKGWTEMDPLGTLLVSLGTLIVLDLAALQLGGPRRSRTRTRATRSR
Ga0207684_113017791	3300025910	Corn, Switchgrass And Miscanthus Rhizosphere	MDPLGTLIVSLGTLIVLDLAALKLGAPRRPRTRTRATRSR
Ga0207654_107313011	3300025911	Corn Rhizosphere	DPLGTLIVSLGTLIVLDLAALQLGGPRRPRTRTRAARSR
Ga0207646_100114236	3300025922	Corn, Switchgrass And Miscanthus Rhizosphere	MDPLGTLIVSLGALIVLDLAALQLGGIRRPRSRTRATRSR
Ga0207669_118100572	3300025937	Miscanthus Rhizosphere	MDPLGTLIVTLGTLLILDIAALQLGGARRPRNRARGPRR
Ga0207711_112462232	3300025941	Switchgrass Rhizosphere	NMDPLGTLIVTLGTLVILDIAALQLGKVRRPRDRARGSRR
Ga0207677_102997532	3300026023	Miscanthus Rhizosphere	MDPLGTLIVSLGALIVIDLAAHQLGGPRRPRPRPRVTRSR
Ga0207639_121130192	3300026041	Corn Rhizosphere	MDPLGTLIVTLGTLVILDIAALQLGKTRRPRDRARGS
Ga0208774_10457423	3300026109	Rice Paddy Soil	TEMDPLGTLIVSLGTLIVLDLAALQLGGPRRTRTRPRPSRSRDAAARRLP
Ga0207674_112639871	3300026116	Corn Rhizosphere	MATKGWTEMDPLGTLIVSLGTLIVLDLAALQLGAPRRSRTRTRAIRAR
Ga0207698_118708852	3300026142	Corn Rhizosphere	MDPLGTLIVTLGTLVILDIAALQLGKARRPRDRARGSRR
Ga0209131_10401244	3300026320	Grasslands Soil	MDPLGTLIVTLGALLVLDLAALQLGGSRRRRQTRPRYR
Ga0247818_108333641	3300028589	Soil	MATKGWTEMDPLGTLIVSLGTLIVLDLAALQLGGTRRSRTRTRAARSR
Ga0307319_100078364	3300028722	Soil	MDPLATLIVSLGTLLVLDLAALQLGGVRRPKNRIRATRSR
Ga0307282_103152292	3300028784	Soil	MARILWSRHLPMATKGWTEMDPLGTLLVSLGTLIVLDLAALQLGGPRRSRTRTRATRSR
Ga0307299_100296183	3300028793	Soil	MDPLGTLIVSLGALLILDLAALQLGGSKRRRPTRPRYR
Ga0307284_100944891	3300028799	Soil	MDPLGTLIVSLGALLVIDLAARQLGRPRRRPAPRP
Ga0307310_100020342	3300028824	Soil	MDPFGTLIATLGALLILDLAALQLGGSRQRRPRARGRAR
Ga0307312_101874652	3300028828	Soil	MATKGWTEMDPLGTLLVSLGALIVLDLAALQLGGPRRARTRTRATRSR
Ga0307278_100268873	3300028878	Soil	MDPFGTLIVSLGALIVLNLAAHQLGGIRRPRSRTRATRSR
Ga0307300_100373273	3300028880	Soil	MDPLGTLIVSLGALLILDLAALQLGGPKRRRRARP
Ga0247827_106600642	3300028889	Soil	MDPLGTLIVTLGTLLILDIAALQLGGARRPRSRARGPRR
Ga0299907_107380612	3300030006	Soil	MDPLGTLIVSLGTLIVLDFAALRLGVTNRQRPRRSRGR
Ga0310813_108180302	3300031716	Soil	MDPLGTLIVTLGTLVILDIAALQLGKTRRPRDRARGSRR
Ga0307416_1003776143	3300032002	Rhizosphere	LGTLIVSLGTLIVLDLAALQLGGTRRSRTRTRAARSR
Ga0307415_1002024241	3300032126	Rhizosphere	MDPFGTLIVSLGTLLVLDFAALKLGASSRQRPRARASSRQR
Ga0364924_000432_139_261	3300033811	Sediment	MDPLGTLIVSLGTLIVIDLAALKLGASRRPRPRVRTPRPR

Structure Viewer


Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100	pTM-score: 0.45
Secondary Structure: α-helix β-sheet Coil Turn	pTM-score: 0.45
Powered by PDBe Molstar

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

Metagenome / Metatranscriptome Family F081315

Overview

Multiple Sequence Alignments

Structure & Topology

Predicted Secondary Structure and Topology

Predicted 3D Structure

Low Quality Model:

Gene Neighborhood

Neighboring Pfam domains

Neighboring Clusters of Orthologous Genes (COGs)

Phylogeny

NCBI Taxonomy

Associated Scaffolds

Environmental Properties

Associated Habitat Types

Associated Samples

Family Sequences

Hidden Markov Model


Click on a Sequence Logo column to get its information.
Powered by Skylign