Basic Information | |
---|---|
Family ID | F081259 |
Family Type | Metagenome / Metatranscriptome |
Number of Sequences | 114 |
Average Sequence Length | 47 residues |
Representative Sequence | MLKKLIDWFTQPQITEIEYYICSHNPKNTADVEQLINEFNYKRKLQCF |
Number of Associated Samples | 81 |
Number of Associated Scaffolds | 114 |
Quality Assessment | |
---|---|
Transcriptomic Evidence | Yes |
Most common taxonomic group | Viruses |
% of genes with valid RBS motifs | 85.09 % |
% of genes near scaffold ends (potentially truncated) | 25.44 % |
% of genes from short scaffolds (< 2000 bps) | 69.30 % |
Associated GOLD sequencing projects | 74 |
AlphaFold2 3D model prediction | Yes |
3D model pTM-score | 0.64 |
Hidden Markov Model |
---|
Powered by Skylign |
Most Common Taxonomy | |
---|---|
Group | Duplodnaviria (45.614 % of family members) |
NCBI Taxonomy ID | 2731341 |
Taxonomy | All Organisms → Viruses → Duplodnaviria |
Most Common Ecosystem | |
---|---|
GOLD Ecosystem | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater (17.544 % of family members) |
Environment Ontology (ENVO) | Unclassified (57.895 % of family members) |
Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Water (non-saline) (57.895 % of family members) |
⦗Top⦘ |
⦗Top⦘ |
Predicted Topology & Secondary Structure | |||||
---|---|---|---|---|---|
Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 47.37% β-sheet: 0.00% Coil/Unstructured: 52.63% | Feature Viewer |
|
|||||
Powered by Feature Viewer |
Structure Viewer | |
---|---|
| |
Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.64 |
Powered by PDBe Molstar |
⦗Top⦘ |
Pfam ID | Name | % Frequency in 114 Family Scaffolds |
---|---|---|
PF00565 | SNase | 24.56 |
PF13580 | SIS_2 | 14.04 |
PF00768 | Peptidase_S11 | 4.39 |
PF01223 | Endonuclease_NS | 3.51 |
PF01541 | GIY-YIG | 3.51 |
PF13609 | Porin_4 | 0.88 |
PF00106 | adh_short | 0.88 |
PF07460 | NUMOD3 | 0.88 |
PF00149 | Metallophos | 0.88 |
PF00534 | Glycos_transf_1 | 0.88 |
PF02867 | Ribonuc_red_lgC | 0.88 |
PF00383 | dCMP_cyt_deam_1 | 0.88 |
PF13759 | 2OG-FeII_Oxy_5 | 0.88 |
COG ID | Name | Functional Category | % Frequency in 114 Family Scaffolds |
---|---|---|---|
COG1686 | D-alanyl-D-alanine carboxypeptidase | Cell wall/membrane/envelope biogenesis [M] | 4.39 |
COG1864 | DNA/RNA endonuclease G, NUC1 | Nucleotide transport and metabolism [F] | 3.51 |
COG0209 | Ribonucleotide reductase alpha subunit | Nucleotide transport and metabolism [F] | 0.88 |
⦗Top⦘ |
Name | Rank | Taxonomy | Distribution |
All Organisms | root | All Organisms | 64.91 % |
Unclassified | root | N/A | 35.09 % |
Visualization |
---|
Powered by ApexCharts |
Scaffold | Taxonomy | Length | IMG/M Link |
---|---|---|---|
3300001850|RCM37_1043567 | Not Available | 2426 | Open in IMG/M |
3300001851|RCM31_10036690 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1177 | Open in IMG/M |
3300002092|JGI24218J26658_1001996 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 5591 | Open in IMG/M |
3300003413|JGI25922J50271_10019657 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1718 | Open in IMG/M |
3300004112|Ga0065166_10119945 | Not Available | 977 | Open in IMG/M |
3300004240|Ga0007787_10099487 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1358 | Open in IMG/M |
3300004240|Ga0007787_10329970 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 756 | Open in IMG/M |
3300004448|Ga0065861_1083511 | All Organisms → Viruses → Predicted Viral | 2376 | Open in IMG/M |
3300005527|Ga0068876_10382634 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 787 | Open in IMG/M |
3300005528|Ga0068872_10676767 | Not Available | 543 | Open in IMG/M |
3300005581|Ga0049081_10050101 | Not Available | 1582 | Open in IMG/M |
3300005582|Ga0049080_10284534 | Not Available | 535 | Open in IMG/M |
3300005662|Ga0078894_10590069 | Not Available | 990 | Open in IMG/M |
3300005662|Ga0078894_11054005 | Not Available | 697 | Open in IMG/M |
3300005662|Ga0078894_11536490 | Not Available | 551 | Open in IMG/M |
3300005662|Ga0078894_11605151 | Not Available | 536 | Open in IMG/M |
3300005805|Ga0079957_1113582 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1447 | Open in IMG/M |
3300006641|Ga0075471_10007464 | Not Available | 6894 | Open in IMG/M |
3300006641|Ga0075471_10413402 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 676 | Open in IMG/M |
3300006641|Ga0075471_10676328 | Not Available | 503 | Open in IMG/M |
3300006802|Ga0070749_10070491 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 2097 | Open in IMG/M |
3300006802|Ga0070749_10332454 | Not Available | 847 | Open in IMG/M |
3300006863|Ga0075459_1000515 | Not Available | 5958 | Open in IMG/M |
3300006875|Ga0075473_10235679 | All Organisms → cellular organisms → Bacteria | 740 | Open in IMG/M |
3300007177|Ga0102978_1387039 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1275 | Open in IMG/M |
3300007541|Ga0099848_1300130 | Not Available | 551 | Open in IMG/M |
3300007622|Ga0102863_1182498 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 617 | Open in IMG/M |
3300007639|Ga0102865_1007155 | All Organisms → Viruses → Predicted Viral | 3023 | Open in IMG/M |
3300007973|Ga0105746_1097487 | Not Available | 963 | Open in IMG/M |
3300008107|Ga0114340_1049014 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1856 | Open in IMG/M |
3300008110|Ga0114343_1147961 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 752 | Open in IMG/M |
3300008114|Ga0114347_1082915 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1278 | Open in IMG/M |
3300008116|Ga0114350_1001486 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 13333 | Open in IMG/M |
3300008116|Ga0114350_1070607 | All Organisms → Viruses → Predicted Viral | 1193 | Open in IMG/M |
3300008116|Ga0114350_1096901 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 941 | Open in IMG/M |
3300008266|Ga0114363_1002782 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 9632 | Open in IMG/M |
3300009026|Ga0102829_1334904 | Not Available | 508 | Open in IMG/M |
3300009068|Ga0114973_10001995 | Not Available | 14959 | Open in IMG/M |
3300009154|Ga0114963_10000257 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 34931 | Open in IMG/M |
3300009158|Ga0114977_10314768 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 889 | Open in IMG/M |
3300009159|Ga0114978_10096853 | All Organisms → Viruses → Predicted Viral | 1952 | Open in IMG/M |
3300009161|Ga0114966_10102457 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1923 | Open in IMG/M |
3300009183|Ga0114974_10042370 | Not Available | 3087 | Open in IMG/M |
3300009183|Ga0114974_10083041 | All Organisms → Viruses → Predicted Viral | 2084 | Open in IMG/M |
3300009183|Ga0114974_10280038 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 988 | Open in IMG/M |
3300010370|Ga0129336_10382241 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 771 | Open in IMG/M |
3300010885|Ga0133913_10025252 | Not Available | 15922 | Open in IMG/M |
3300010885|Ga0133913_10317358 | All Organisms → Viruses → Predicted Viral | 4127 | Open in IMG/M |
3300010885|Ga0133913_11019223 | Not Available | 2139 | Open in IMG/M |
3300012730|Ga0157602_1236456 | Not Available | 670 | Open in IMG/M |
3300013004|Ga0164293_10260334 | Not Available | 1220 | Open in IMG/M |
3300013005|Ga0164292_10205057 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1400 | Open in IMG/M |
(restricted) 3300013126|Ga0172367_10071676 | All Organisms → cellular organisms → Bacteria | 2584 | Open in IMG/M |
3300013295|Ga0170791_13584560 | Not Available | 594 | Open in IMG/M |
3300017766|Ga0181343_1001665 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 8790 | Open in IMG/M |
3300017766|Ga0181343_1021583 | Not Available | 1985 | Open in IMG/M |
3300017774|Ga0181358_1033036 | All Organisms → Viruses → Predicted Viral | 2018 | Open in IMG/M |
3300017780|Ga0181346_1331819 | Not Available | 508 | Open in IMG/M |
3300017785|Ga0181355_1130308 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1025 | Open in IMG/M |
3300020172|Ga0211729_10698578 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 2171 | Open in IMG/M |
3300020172|Ga0211729_11080048 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 828 | Open in IMG/M |
3300020536|Ga0207939_1009587 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1547 | Open in IMG/M |
3300021438|Ga0213920_1006167 | All Organisms → Viruses → Predicted Viral | 4230 | Open in IMG/M |
3300021961|Ga0222714_10009601 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 8486 | Open in IMG/M |
3300021961|Ga0222714_10190572 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1192 | Open in IMG/M |
3300021961|Ga0222714_10486854 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 635 | Open in IMG/M |
3300021962|Ga0222713_10228670 | Not Available | 1225 | Open in IMG/M |
3300021963|Ga0222712_10063999 | All Organisms → Viruses → Predicted Viral | 2684 | Open in IMG/M |
3300021963|Ga0222712_10297471 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1013 | Open in IMG/M |
3300021963|Ga0222712_10588691 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 644 | Open in IMG/M |
3300021963|Ga0222712_10630631 | Not Available | 614 | Open in IMG/M |
3300022179|Ga0181353_1025340 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1568 | Open in IMG/M |
3300022407|Ga0181351_1025290 | All Organisms → Viruses → Predicted Viral | 2522 | Open in IMG/M |
3300022407|Ga0181351_1080635 | Not Available | 1298 | Open in IMG/M |
3300022407|Ga0181351_1117066 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1005 | Open in IMG/M |
3300023184|Ga0214919_10000794 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 53984 | Open in IMG/M |
3300023184|Ga0214919_10078166 | All Organisms → Viruses → Predicted Viral | 2939 | Open in IMG/M |
3300023184|Ga0214919_10430419 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 842 | Open in IMG/M |
3300025595|Ga0208248_1038503 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1104 | Open in IMG/M |
3300025616|Ga0208613_1067090 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 819 | Open in IMG/M |
3300025889|Ga0208644_1136751 | Not Available | 1145 | Open in IMG/M |
3300026572|Ga0255270_1153816 | Not Available | 573 | Open in IMG/M |
3300027608|Ga0208974_1021892 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1976 | Open in IMG/M |
3300027734|Ga0209087_1014446 | All Organisms → Viruses → Predicted Viral | 3968 | Open in IMG/M |
3300027736|Ga0209190_1008521 | Not Available | 6289 | Open in IMG/M |
3300027741|Ga0209085_1000007 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Myoviridae | 146310 | Open in IMG/M |
3300027759|Ga0209296_1032772 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 2848 | Open in IMG/M |
3300027770|Ga0209086_10146435 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1147 | Open in IMG/M |
3300027782|Ga0209500_10012586 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 5168 | Open in IMG/M |
3300027969|Ga0209191_1246875 | Not Available | 682 | Open in IMG/M |
3300028025|Ga0247723_1001349 | Not Available | 14526 | Open in IMG/M |
3300028025|Ga0247723_1047944 | All Organisms → Viruses → Predicted Viral | 1236 | Open in IMG/M |
3300029930|Ga0119944_1009545 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1474 | Open in IMG/M |
3300031758|Ga0315907_10098494 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 2508 | Open in IMG/M |
3300031758|Ga0315907_10949917 | Not Available | 626 | Open in IMG/M |
3300031787|Ga0315900_10489588 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 936 | Open in IMG/M |
3300031857|Ga0315909_10173271 | All Organisms → Viruses → Predicted Viral | 1744 | Open in IMG/M |
3300031951|Ga0315904_10077646 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 3569 | Open in IMG/M |
3300031951|Ga0315904_10523841 | All Organisms → Viruses → Predicted Viral | 1039 | Open in IMG/M |
3300031951|Ga0315904_10663320 | Not Available | 884 | Open in IMG/M |
3300034061|Ga0334987_0220271 | Not Available | 1318 | Open in IMG/M |
3300034061|Ga0334987_0291878 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1086 | Open in IMG/M |
3300034061|Ga0334987_0415429 | Not Available | 847 | Open in IMG/M |
3300034061|Ga0334987_0641250 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 619 | Open in IMG/M |
3300034073|Ga0310130_0157078 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 698 | Open in IMG/M |
3300034092|Ga0335010_0208530 | All Organisms → cellular organisms → Bacteria | 1186 | Open in IMG/M |
3300034093|Ga0335012_0116387 | Not Available | 1482 | Open in IMG/M |
3300034093|Ga0335012_0130390 | All Organisms → Viruses → Predicted Viral | 1385 | Open in IMG/M |
3300034093|Ga0335012_0401366 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Rhizobiaceae → Rhizobium/Agrobacterium group → Agrobacterium | 670 | Open in IMG/M |
3300034101|Ga0335027_0234030 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1281 | Open in IMG/M |
3300034105|Ga0335035_0200258 | All Organisms → Viruses → Predicted Viral | 1229 | Open in IMG/M |
3300034106|Ga0335036_0093094 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 2224 | Open in IMG/M |
3300034108|Ga0335050_0311643 | Not Available | 746 | Open in IMG/M |
3300034168|Ga0335061_0481457 | Not Available | 634 | Open in IMG/M |
Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
⦗Top⦘ |
Habitat | Taxonomy | Distribution |
Freshwater | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater | 17.54% |
Freshwater Lake | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lake | 16.67% |
Freshwater Lake | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake | 15.79% |
Aqueous | Environmental → Aquatic → Marine → Coastal → Unclassified → Aqueous | 7.89% |
Estuarine Water | Environmental → Aquatic → Marine → Unclassified → Unclassified → Estuarine Water | 7.02% |
Freshwater, Plankton | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater, Plankton | 6.14% |
Freshwater | Environmental → Aquatic → Freshwater → Unclassified → Unclassified → Freshwater | 6.14% |
Freshwater | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater | 2.63% |
Freshwater Lentic | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lentic | 2.63% |
Freshwater | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater | 2.63% |
Estuarine | Environmental → Aquatic → Marine → Intertidal Zone → Estuary → Estuarine | 2.63% |
Marine Plankton | Environmental → Aquatic → Freshwater → Lotic → Unclassified → Marine Plankton | 1.75% |
Deep Subsurface Sediment | Environmental → Terrestrial → Deep Subsurface → Unclassified → Unclassified → Deep Subsurface Sediment | 1.75% |
Lentic | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Lentic | 0.88% |
Freshwater Lake | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake | 0.88% |
Lake | Environmental → Aquatic → Freshwater → Lake → Unclassified → Lake | 0.88% |
Aquatic | Environmental → Aquatic → Freshwater → Drinking Water → Unclassified → Aquatic | 0.88% |
Freshwater | Environmental → Aquatic → Freshwater → River → Unclassified → Freshwater | 0.88% |
Freshwater | Environmental → Aquatic → Freshwater → Creek → Unclassified → Freshwater | 0.88% |
Freshwater To Marine Saline Gradient | Environmental → Aquatic → Marine → Coastal → Unclassified → Freshwater To Marine Saline Gradient | 0.88% |
Marine | Environmental → Aquatic → Marine → Coastal → Unclassified → Marine | 0.88% |
Estuary Water | Environmental → Aquatic → Marine → Coastal → Unclassified → Estuary Water | 0.88% |
Fracking Water | Environmental → Terrestrial → Deep Subsurface → Unclassified → Unclassified → Fracking Water | 0.88% |
Visualization |
---|
Powered by ApexCharts |
Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
Taxon OID | Sample Name | Habitat Type | IMG/M Link |
---|---|---|---|
3300001850 | Marine plankton microbial communities from the Amazon River plume, Atlantic Ocean - RCM37, ROCA_DNA234_0.2um_Ob_C_2a | Environmental | Open in IMG/M |
3300001851 | Marine plankton microbial communities from the Amazon River plume, Atlantic Ocean - RCM31, ROCA_DNA206_0.2um_MCP-S_C_3b | Environmental | Open in IMG/M |
3300002092 | Lentic bog actinobacteria communities from Grosse Fuchskuhle, Germany - Sample acI-B2 co-culture F-B6 metagenome | Environmental | Open in IMG/M |
3300003413 | Freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MLB.DD | Environmental | Open in IMG/M |
3300004112 | Freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MLB.SD (version 2) | Environmental | Open in IMG/M |
3300004240 | Freshwater lake microbial communities from Lake Michigan, USA - Fa13.BD.MLB.SN | Environmental | Open in IMG/M |
3300004448 | Marine viral communities from Newfoundland, Canada BC-1 | Environmental | Open in IMG/M |
3300005527 | Freshwater lake microbial communities from Lake Erie, under a cyanobacterial bloom - NOAA_Erie_Diel5S_2200h metaG | Environmental | Open in IMG/M |
3300005528 | Freshwater lake microbial communities from Lake Erie, under a cyanobacterial bloom - NOAA_Erie_Diel1S_2200h metaG | Environmental | Open in IMG/M |
3300005581 | Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG ER78MSRF | Environmental | Open in IMG/M |
3300005582 | Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG ER15MSRF | Environmental | Open in IMG/M |
3300005662 | Freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MLB.SD (version 4) | Environmental | Open in IMG/M |
3300005805 | Microbial and algae communities from Cheney Reservoir in Wichita, Kansas, USA | Environmental | Open in IMG/M |
3300006641 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_0.19_D_>0.8_DNA | Environmental | Open in IMG/M |
3300006802 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_18 | Environmental | Open in IMG/M |
3300006863 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Fall_0.3_>0.8_DNA | Environmental | Open in IMG/M |
3300006875 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_0.19_N_>0.8_DNA | Environmental | Open in IMG/M |
3300007177 | Combined Assembly of cyanobacterial bloom in Marina Bay water reservoir, Singapore (Diel cycle-Surface and Bottom layers) 16 sequencing projects | Environmental | Open in IMG/M |
3300007541 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1508_1S Viral MetaG | Environmental | Open in IMG/M |
3300007622 | Estuarine microbial communities from the Columbia River estuary - metaG 1449A-02 | Environmental | Open in IMG/M |
3300007639 | Estuarine microbial communities from the Columbia River estuary - metaG 1449C-02 | Environmental | Open in IMG/M |
3300007973 | Coastal water column microbial communities from Columbia River Estuary, Oregon, USA - CMOP_DNA_1460A_0.2um | Environmental | Open in IMG/M |
3300008107 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE2, Sample E2014-0046-3-NA | Environmental | Open in IMG/M |
3300008110 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE12, Sample E2014-0048-3-NA | Environmental | Open in IMG/M |
3300008114 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE2, Sample E2014-0106-C-NA | Environmental | Open in IMG/M |
3300008116 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE2, Sample E2014-0106-3-NA | Environmental | Open in IMG/M |
3300008266 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE12, Sample HABS-E2014-0108-C-NA | Environmental | Open in IMG/M |
3300009026 | Estuarine microbial communities from the Columbia River estuary - Freshwater metaG S.575 | Environmental | Open in IMG/M |
3300009068 | Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_140807_MF_MetaG | Environmental | Open in IMG/M |
3300009154 | Freshwater microbial communities from Lake Croche, Canada to study carbon cycling - C_131016_EF_MetaG | Environmental | Open in IMG/M |
3300009158 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130805_MF_MetaG | Environmental | Open in IMG/M |
3300009159 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_140212_EF_MetaG | Environmental | Open in IMG/M |
3300009161 | Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_130207_XF_MetaG | Environmental | Open in IMG/M |
3300009183 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130206_EF_MetaG | Environmental | Open in IMG/M |
3300010370 | Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Sum_0.6_0.2_DNA | Environmental | Open in IMG/M |
3300010885 | northern Canada Lakes Co-assembly | Environmental | Open in IMG/M |
3300012730 | Eutrophic lake water microbial communities from Lake Mendota, Wisconsin, USA - GEODES126 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300013004 | Eutrophic lake water microbial communities from Lake Mendota, Wisconsin, USA - GEODES118 metaG | Environmental | Open in IMG/M |
3300013005 | Eutrophic lake water microbial communities from Lake Mendota, Wisconsin, USA - GEODES117 metaG | Environmental | Open in IMG/M |
3300013126 (restricted) | Freshwater microbial communities from Kabuno Bay, South-Kivu, Congo ? kab_022012_10m | Environmental | Open in IMG/M |
3300013295 | northern Canada Lakes metatranscriptome co-assembly | Environmental | Open in IMG/M |
3300017766 | Freshwater viral communities from Lake Michigan, USA - Su13.VD.MLB.S.D | Environmental | Open in IMG/M |
3300017774 | Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM110.S.D | Environmental | Open in IMG/M |
3300017780 | Freshwater viral communities from Lake Michigan, USA - Su13.VD.MM15.D.N | Environmental | Open in IMG/M |
3300017785 | Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM15.D.N | Environmental | Open in IMG/M |
3300020172 | Freshwater lake microbial communities from Lake Erken, Sweden - P4710_102 megahit1 | Environmental | Open in IMG/M |
3300020536 | Freshwater microbial communities from Lake Mendota, WI - 02JUN2012 deep hole epilimnion (SPAdes) | Environmental | Open in IMG/M |
3300021438 | Freshwater microbial communities from McNutts Creek, Athens, Georgia, United States - 11-17 MG | Environmental | Open in IMG/M |
3300021961 | Estuarine water microbial communities from San Francisco Bay, California, United States - C33_3D | Environmental | Open in IMG/M |
3300021962 | Estuarine water microbial communities from San Francisco Bay, California, United States - C33_649D | Environmental | Open in IMG/M |
3300021963 | Estuarine water microbial communities from San Francisco Bay, California, United States - C33_657D | Environmental | Open in IMG/M |
3300022179 | Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MLB.D.N | Environmental | Open in IMG/M |
3300022407 | Freshwater viral communities from Lake Michigan, USA - Su13.VD.MM15.S.D | Environmental | Open in IMG/M |
3300023184 | Freshwater microbial communities from Lake Lanier, Atlanta, Georgia, United States - LL-1503 | Environmental | Open in IMG/M |
3300025595 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - MA5M (SPAdes) | Environmental | Open in IMG/M |
3300025616 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - MA6M (SPAdes) | Environmental | Open in IMG/M |
3300025889 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_18 (SPAdes) | Environmental | Open in IMG/M |
3300026572 | Metatranscriptome of freshwater microbial communities from Altamaha River, Georgia, United States - Atl_Atl_RepB_8h (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300027608 | Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG ER15MSRF (SPAdes) | Environmental | Open in IMG/M |
3300027734 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130805_EF_MetaG (SPAdes) | Environmental | Open in IMG/M |
3300027736 | Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_140205_XF_MetaG (SPAdes) | Environmental | Open in IMG/M |
3300027741 | Freshwater microbial communities from Lake Croche, Canada to study carbon cycling - C_131016_EF_MetaG (SPAdes) | Environmental | Open in IMG/M |
3300027759 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130206_EF_MetaG (SPAdes) | Environmental | Open in IMG/M |
3300027770 | Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_130207_XF_MetaG (SPAdes) | Environmental | Open in IMG/M |
3300027782 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_140212_EF_MetaG (SPAdes) | Environmental | Open in IMG/M |
3300027969 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130626_EF_MetaG (SPAdes) | Environmental | Open in IMG/M |
3300028025 | Subsurface sediment microbial communities from gas well in West Virginia, United States - MSEEL Well Study Marcellus 5H_FC | Environmental | Open in IMG/M |
3300029930 | Aquatic microbial communities from drinking water treatment plant in Pearl River Delta area, China - influent_20120727 | Environmental | Open in IMG/M |
3300031758 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 12 MA123 | Environmental | Open in IMG/M |
3300031787 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 12 MA114 | Environmental | Open in IMG/M |
3300031857 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 2 MA125 | Environmental | Open in IMG/M |
3300031951 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 12 MA120 | Environmental | Open in IMG/M |
3300034061 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME02Sep2004-rr0028 | Environmental | Open in IMG/M |
3300034073 | Fracking water microbial communities from deep shales in Oklahoma, United States - MC-6-XL | Environmental | Open in IMG/M |
3300034092 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME03Aug2012-rr0069 | Environmental | Open in IMG/M |
3300034093 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME08Jun2014-rr0072 | Environmental | Open in IMG/M |
3300034101 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME19Sep2005-rr0107 | Environmental | Open in IMG/M |
3300034105 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME15May2014-rr0127 | Environmental | Open in IMG/M |
3300034106 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME23Aug2013-rr0131 | Environmental | Open in IMG/M |
3300034108 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME24Jun2014-rr0157 | Environmental | Open in IMG/M |
3300034168 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME06Apr2016-rr0183 | Environmental | Open in IMG/M |
Geographical Distribution | |
---|---|
Zoom: | Powered by OpenStreetMap |
⦗Top⦘ |
Note: Some of these sequences are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
Protein ID | Sample Taxon ID | Habitat | Sequence |
RCM37_10435678 | 3300001850 | Marine Plankton | MLTKFIEWLTKPQLSELEYYVTSNNPKNEVDVEQLIKEFNYKRRLQCF* |
RCM31_100366904 | 3300001851 | Marine Plankton | MLTKFIEWLTKPQLSELEYYVNSRQPKNAADVEQLIKEFNYKRRLQCF* |
JGI24218J26658_10019967 | 3300002092 | Lentic | MIKKLIQWFTQPQITEIEYYICSRNPKNTADVEQLINEFNYKRKLQCF* |
JGI25922J50271_100196573 | 3300003413 | Freshwater Lake | MLKKVINWFTKSQMSEIEEYITAHDPKSTADVELLIQEFNYKRKLQCF* |
Ga0065166_101199452 | 3300004112 | Freshwater Lake | MLKQFIDWFTKSQMSEIEEYISSHNPKSTADVEQLINEFNYKRKLQCF* |
Ga0007787_100994872 | 3300004240 | Freshwater Lake | LFKKLVEWFTKPQITEIEYYIASRDPKSPADVEQLIKEFNQKRKLQCF* |
Ga0007787_103299703 | 3300004240 | Freshwater Lake | MEGETTMFKKFIHWFTQHQMTEIEYYIASRDPKNAADVEQLIKEFNYKRKLQCF* |
Ga0065861_10835117 | 3300004448 | Marine | MLKKLIQWFVQPQITEIEQYISAHNPKNTADVEMLINEFNYKRKLQCF* |
Ga0068876_103826341 | 3300005527 | Freshwater Lake | MFRKFINWFSQRQMTEIEYFIATRDPKTTADVEQLIKEFNYKRRLQCF* |
Ga0068872_106767671 | 3300005528 | Freshwater Lake | MFKKFINWFTQRQMTEIEYFIATRDPKTTADVEQLIKEFNYKRRLQCF* |
Ga0049081_100501012 | 3300005581 | Freshwater Lentic | MLKKLIQWFIRPQLTEIEYYVCSHNPKNTADVEMLINEFNYKRKLQCF* |
Ga0049080_102845343 | 3300005582 | Freshwater Lentic | PQITEIEYYICSHNPKNTADVEMLINEFNYKRKLQCF* |
Ga0078894_105900694 | 3300005662 | Freshwater Lake | MLKQIIDWFTRPQLTEIEYYISAHNPKNTADVEMLINEFNYKRKLQCF* |
Ga0078894_110540051 | 3300005662 | Freshwater Lake | MLNKLIQWFIRPQLSEIEYYISSHNPKNTADVEMLINEFNYKRKLQCF* |
Ga0078894_115364901 | 3300005662 | Freshwater Lake | MLKKIIDWFTRPQITEIEYYICSHNPKNTADVEQLINEFNYKRKLQCF* |
Ga0078894_116051511 | 3300005662 | Freshwater Lake | MLKKIIEWFTRPQLNEIEQYISTHNPKNTADVEMLINEFNYKRKLQCF* |
Ga0079957_11135824 | 3300005805 | Lake | MFRRIIEWLTQPQLSELEQYVSSRQPKNAADVEQLIKEFNQKRRLQCF* |
Ga0075471_100074649 | 3300006641 | Aqueous | MLNKLIDWFTRPQISEIEQYISAHNPKNTADVEQLINEFNYKRKLQCY* |
Ga0075471_104134021 | 3300006641 | Aqueous | MFSKMIEWFTRPQMQEIEKYISAHNPKTPADVDMLINEFNYKRKLQCF* |
Ga0075471_106763282 | 3300006641 | Aqueous | MFKKLIDWFTRPQISEIEQYISAHDPKNTADVEQLINEFNYKRKLQCF* |
Ga0070749_100704912 | 3300006802 | Aqueous | MLKQIIDWFTRPQISEIEQYISAHNPKNTADVEQLINEFNYKRKLQCY* |
Ga0070749_103324541 | 3300006802 | Aqueous | LYRRVFLFKRIIEWLTRPQITEIEYYIASRDPKSPADVEQLIKEFNQKRKLQCF* |
Ga0075459_10005159 | 3300006863 | Aqueous | MLKQIIDWFTRPQISEIEQYISSHNPKNTADVELLINEFNYKRKLQCY* |
Ga0075473_102356792 | 3300006875 | Aqueous | LFKKIIEWFTKPQITEIEYYIASRDPKSPADVEQFIKEFNQKRKLQCF* |
Ga0102978_13870394 | 3300007177 | Freshwater Lake | MFRKCIHWFTQRQMSEIEYYIASRDPKNAADVEQLIKEFNYKRRLQCF* |
Ga0099848_13001302 | 3300007541 | Aqueous | FLFKRIIEWLTRPQITEIEYYIASKNPKTPADVEQLIKEFNQKRKLQCF* |
Ga0102863_11824981 | 3300007622 | Estuarine | MLKKLIEWFIRPQLSEIEYYISSHNPKNTADVEMLINEFN |
Ga0102865_10071555 | 3300007639 | Estuarine | MLKKLIEWFIRPQLSEIEYYISSHNPKNTADVEMLINEFNYKRKLQCF* |
Ga0105746_10974874 | 3300007973 | Estuary Water | MLKKLIEWFTRPQLNEIEYYISAHNPKNTADVEMLINEFNYKRKLQCF* |
Ga0114340_10490144 | 3300008107 | Freshwater, Plankton | MLKQLIDWFTRPQLTEIEQYISSHNPKNTADVELLINEFNYKRKLQCF* |
Ga0114343_11479612 | 3300008110 | Freshwater, Plankton | MFKKMIEWFTRPQITEIEYYISSHNPKNTADVELLINEFNYKRRLQCF* |
Ga0114347_10829154 | 3300008114 | Freshwater, Plankton | MFKKFINWFTQRQMTEIEYFIATREPKTTADVEQLIKEFNYKRRL* |
Ga0114350_10014864 | 3300008116 | Freshwater, Plankton | MFNKILEWLTKPQLSDIEYYIASKNPQTTADVEQLIKEFNYKRRLQCF* |
Ga0114350_10706074 | 3300008116 | Freshwater, Plankton | MLKRIIEWLTQPQITELEQYVSSRHPKNAADVEQLIQEFNQKRRLQCF* |
Ga0114350_10969012 | 3300008116 | Freshwater, Plankton | MFRRIIEWLTQPQITELEQYVSSRQPKNAADVEQLIQEFNQKRRLQCF* |
Ga0114363_100278215 | 3300008266 | Freshwater, Plankton | MLKKLIEWFTRPQISEIEQYISAHNPKTPADVDMLLNEFNYKRKLQCF* |
Ga0102829_13349041 | 3300009026 | Estuarine | LIDWFTQPQITEIEYYICSHNPKNTADVEQLINEFNYKRKLQCF* |
Ga0114973_100019954 | 3300009068 | Freshwater Lake | MLKKLIQWFIRPQLSEIEYYISSHNPKNTADVEMLINEFNYKRKLQCF* |
Ga0114963_1000025728 | 3300009154 | Freshwater Lake | MLNKLIQWFIRPQITEIEQYISAHNPKNTADVEMLINEFNYKRKLQCF* |
Ga0114977_103147682 | 3300009158 | Freshwater Lake | MLKKLIQWFIRPQLSEIEQYISAHNPKNTADVEMLINEFNYKRKLQCF* |
Ga0114978_100968531 | 3300009159 | Freshwater Lake | MLKKLIQWFVQPQITEIEQYISSHNPKNTADVEMLINEFNYKRKLQCF* |
Ga0114966_101024573 | 3300009161 | Freshwater Lake | MFKKLIEWFTRPQITEIEYYISKHDPKTPADVDMLINEFNYKRKLQCF* |
Ga0114974_100423702 | 3300009183 | Freshwater Lake | MLKQIIDWFTRPQITEIEYYISAHNPKNTADVEMLINEFNYKRKLQCF* |
Ga0114974_100830414 | 3300009183 | Freshwater Lake | MLKKLIQWFIRPQLSEIEYYISSHNPKNTADVDMLLNEFNYKRKLQCF* |
Ga0114974_102800384 | 3300009183 | Freshwater Lake | MLKQIIDWFTRPQITEIEYYICSHNPKNTADVEQLINEFNYKRKLQCF* |
Ga0129336_103822411 | 3300010370 | Freshwater To Marine Saline Gradient | MFRRIIEWLTQPQLSELEQYVSSRQPKNAADVEQLIQEFNQ |
Ga0133913_1002525241 | 3300010885 | Freshwater Lake | MLNKLIEWFIRPQLSEIEQYISAHNPKNTADVEMLINEFNYKRKLQCF* |
Ga0133913_103173588 | 3300010885 | Freshwater Lake | MLEKLIQWFTQPQITEIEYYICSRNPKNTADVEQLINEFNYKRKLQCF* |
Ga0133913_110192235 | 3300010885 | Freshwater Lake | MLKQFIDWFTKSQMSEIEEYISSHNPKTTADVELLIQEFNYKRKLQCF* |
Ga0157602_12364561 | 3300012730 | Freshwater | VEWFTKPQITDIEYYIASKDPKTTADVEQLIKEFNQKRKLQCF* |
Ga0164293_102603341 | 3300013004 | Freshwater | MLKKLIQWFVQPQLSEIEQYISSHNPKSTADVEMLINEFNHKRKLQCF* |
Ga0164292_102050574 | 3300013005 | Freshwater | MFKKMIEWLTRPQITEIEYYICSHNPKNTADVEQLINEFNYKRKLQCF* |
(restricted) Ga0172367_100716765 | 3300013126 | Freshwater | MFKKLIDWFVKPQITEIEYYIASRDPKTTADVEQLIKEFNQKRRLQCF* |
Ga0170791_135845601 | 3300013295 | Freshwater | KKLIQWFVQPQITEIEQYISSHNPKNTADVEMLINEFNYKRKLQCF* |
Ga0181343_10016658 | 3300017766 | Freshwater Lake | MLKQFIDWFTKSQMSEIEEYISSHNPKSTADVEQLINEFNYKRKLQCF |
Ga0181343_10215833 | 3300017766 | Freshwater Lake | MLKQIIDWFTRPQLTEIEYYISAHNPKNTADVEMLINEFNYKRKLQCF |
Ga0181358_10330364 | 3300017774 | Freshwater Lake | MLKKLIQWFIQPQITEIEYYICSHNPKNTADVEMLINEFNYKRKLQCF |
Ga0181346_13318193 | 3300017780 | Freshwater Lake | LKKVINWFTKSQMSEIEEYITAHDPKSTADVELLIQEFNYKRKLQCF |
Ga0181355_11303081 | 3300017785 | Freshwater Lake | MLKKLIEWFIRPQLSEIEYYISSHNPKNTADVEMLINEFNYKRK |
Ga0211729_106985783 | 3300020172 | Freshwater | MLKQIIDWFTRPQITEIEYYICSHNPKNTADVEMLINEFNYKRKLQCF |
Ga0211729_110800483 | 3300020172 | Freshwater | MLKKLIQWFTRPQITEIEYYICSHNPKNTADVEQLI |
Ga0207939_10095874 | 3300020536 | Freshwater | MFKKFINWFTQRQMTEIEYFIATRDPKTTADVEQLIKEFNYKRRLQCF |
Ga0213920_10061675 | 3300021438 | Freshwater | MIKKMIEWFTRPQIHEIEQYISDHEPKTAADVDKLINEFNYKRKLQCF |
Ga0222714_100096018 | 3300021961 | Estuarine Water | MFNKMLQWFIKPQLTEIEYYISAHNPKNTADVEMLINEFNYKRRLQCF |
Ga0222714_101905724 | 3300021961 | Estuarine Water | MFNKMLQWFIKPQLTEIEYYISAHNPKNTADVEMLIN |
Ga0222714_104868542 | 3300021961 | Estuarine Water | MFRKFIHWFTQRQMSEIEYYIASRDPKNAADVEQLIKEFNYKRRLQCF |
Ga0222713_102286705 | 3300021962 | Estuarine Water | MLNKLIDWFTRPQISEIEQYISAHNPKNTADVEQLINEFNYKRKLQCY |
Ga0222712_100639993 | 3300021963 | Estuarine Water | MLKQLIDWFTRPQITEIEQYISSQNPKTTADVEQLINEFNYKRKLQCF |
Ga0222712_102974713 | 3300021963 | Estuarine Water | MLHKLIDWFTRPQISEIEQYISAHNPKNTADVEQLINEFNYKRKLQCY |
Ga0222712_105886912 | 3300021963 | Estuarine Water | MLKKLIEWFIRPQLSEIEYYISAHNPKNTADVEMLINEFNYKRKLQ |
Ga0222712_106306311 | 3300021963 | Estuarine Water | MFKKMIDWFTRPQISEIEQYISAHDPKNTADVEQLINEFNYKRKLQCF |
Ga0181353_10253404 | 3300022179 | Freshwater Lake | MEGETTMFKKFIHWFTQHQMTEIEYYIASRDPKNAADVEQLIKEFNYKRKLQCF |
Ga0181351_10252907 | 3300022407 | Freshwater Lake | MLKKLIQWFVQPQITEIEYYICSHNPKNTADVEMLINEFNYKRKLQCF |
Ga0181351_10806351 | 3300022407 | Freshwater Lake | MLKKVINWFTKSQMSEIEEYITAHDPKSTADVELLIQEFNYKRKLQCF |
Ga0181351_11170663 | 3300022407 | Freshwater Lake | MLKKLIEWFIRPQLSEIEYYISSHNPKNTADVEMLINEFNYKRKLQCF |
Ga0214919_1000079436 | 3300023184 | Freshwater | MLYNNIGGNAMFKKMIEWFTQPQITEIEYYICSHNPKNTADVEQLINEFNYKRKLQCF |
Ga0214919_100781664 | 3300023184 | Freshwater | MLKKLIQWFVQPQITEIERYISAHNPKNTADVEMLINEFNYKRKLQCF |
Ga0214919_104304192 | 3300023184 | Freshwater | MLKKLIQWFTQPQMQEIEKYISAHNPTSPADVDKLINEFNYKRRLQCF |
Ga0208248_10385033 | 3300025595 | Freshwater | MLKKIVEWFIQPQLSDIEKYVTAHNPTSPADVEILIREFNCKRGLQCF |
Ga0208613_10670903 | 3300025616 | Freshwater | MLKKLIQWFVQPQITEIEQYISAHNPKNTADVEMLINEFNYKRKLQCF |
Ga0208644_11367515 | 3300025889 | Aqueous | NKLIDWFTRPQISEIEQYISAHNPKNTADVEQLINEFNYKRKLQCY |
Ga0255270_11538161 | 3300026572 | Freshwater | QPQLSELEQYVSSRQPKNAADVEQLIKEFNQKRRLQCF |
Ga0208974_10218924 | 3300027608 | Freshwater Lentic | MLKKLIQWFIRPQLTEIEYYVCSHNPKNTADVEMLINEFNYKRKLQCF |
Ga0209087_10144467 | 3300027734 | Freshwater Lake | MLNKLIEWFIRPQLSEIEQYISAHNPKNTADVEMLINEFNYKRKLQCF |
Ga0209190_10085214 | 3300027736 | Freshwater Lake | MLKKLIQWFIRPQLSEIEYYISSHNPKNTADVEMLINEFNYKRKLQCF |
Ga0209085_1000007132 | 3300027741 | Freshwater Lake | MLNKLIQWFIRPQITEIEQYISAHNPKNTADVEMLINEFNYKRKLQCF |
Ga0209296_10327721 | 3300027759 | Freshwater Lake | MLNKLIEWFTRPQLNEIEQYISAHNPKNTADVEMLINEFNYKRKLQCF |
Ga0209086_101464353 | 3300027770 | Freshwater Lake | MFKKLIEWFTRPQITEIEYYISKHDPKTPADVDMLINEFNYKRKLQCF |
Ga0209500_100125865 | 3300027782 | Freshwater Lake | MLKKLIQWFVQPQITEIEQYISSHNPKNTADVEMLINEFNYKRKLQCF |
Ga0209191_12468753 | 3300027969 | Freshwater Lake | MLKKLIQWFIRPQLSEIEQYISAHNPKNTADVEMLINEFNYKRKLQCF |
Ga0247723_10013497 | 3300028025 | Deep Subsurface Sediment | MIQKMIQWFIKPQLTEIEYYISSHDPKTTSDVEHLINEFNYKRRLQCF |
Ga0247723_10479444 | 3300028025 | Deep Subsurface Sediment | MFSKMIEWFTRPQMQEIEKYISAHNPKTPADVDMLINEFNYKRKLQCF |
Ga0119944_10095452 | 3300029930 | Aquatic | MFRRIIEWLTQPQLSELEQYVSSRQPKNAADVEQLIKEFNQKRRLQCF |
Ga0315907_100984946 | 3300031758 | Freshwater | MFNKILEWLTKPQLSDIEYYIASKNPQTTADVEQLIKEFNYKRRLQCF |
Ga0315907_109499172 | 3300031758 | Freshwater | MLKKLIEWFTRPQISEIEQYISAHNPKTPADVDMLLNEFNYKRKLQCF |
Ga0315900_104895881 | 3300031787 | Freshwater | MFKKFINWFTQRQMTEIEYFIATRDPKTTADVEQLIKEFNYKRRL |
Ga0315909_101732714 | 3300031857 | Freshwater | MLKRIIEWLTQPQITELEQYVSSRHPKNAADVEQLIQEFNQKRRLQCF |
Ga0315904_100776464 | 3300031951 | Freshwater | MFKQFIEWLTKPQLTELEYYVSSRQPKNAADVEQLIKEFNYKRRLQCF |
Ga0315904_105238414 | 3300031951 | Freshwater | MFRRIIEWLTQPQITELEQYVSSRQPKNAADVEQLIQEFNQKRRLQCF |
Ga0315904_106633202 | 3300031951 | Freshwater | MFKKFINWFTQRQMTEIEYFIATREPKTTADVEQLIKEFNYKRRL |
Ga0334987_0220271_1_123 | 3300034061 | Freshwater | FTQRQMTEIEYYIASRDPKTTADVEQLIKEFNYKRRLQCF |
Ga0334987_0291878_967_1086 | 3300034061 | Freshwater | MFKKMIEWLTRPQITEIEYYICSHNPKNTADVEQLINEFN |
Ga0334987_0415429_697_846 | 3300034061 | Freshwater | VLFKKLVEWFTKPQITEIEYYIASRDPKSPADVEQLIKEFNQKRKLQCF |
Ga0334987_0641250_2_139 | 3300034061 | Freshwater | MFKKIVEWFTKPQITEIEYYIASRDPKSPADVEQLIKEFNQKRKLQ |
Ga0310130_0157078_592_696 | 3300034073 | Fracking Water | MFKKIVEWLTRPQMTEIEYYIASKDPKTPADVEQL |
Ga0335010_0208530_106_252 | 3300034092 | Freshwater | MLKKLIQWFTRPQMTEIEYYISAHNPKSTADVEMLINEFNHKRKLQCF |
Ga0335012_0116387_2_130 | 3300034093 | Freshwater | DWFTQPQITEIEYYICSHNPKNTADVEQLINEFNYKRKLQCF |
Ga0335012_0130390_1247_1384 | 3300034093 | Freshwater | MLKKLIQWFTQPQITEIEQYISSHNPKSTADVEMLINEFNHKRKLQ |
Ga0335012_0401366_311_457 | 3300034093 | Freshwater | MLKKLIQWFVQPQLSEIEQYISSHNPKSTADVEMLINEFNHKRKLQCF |
Ga0335027_0234030_1161_1280 | 3300034101 | Freshwater | MFKKFIDWFTQRQMTEIEYYIASRDPKTTADVEQLIKEFN |
Ga0335035_0200258_64_210 | 3300034105 | Freshwater | MLKKLIDWFTQPQITEIEYYICSHNPKNTADVEQLINEFNYKRKLQCF |
Ga0335036_0093094_811_957 | 3300034106 | Freshwater | MLKKLIEWFTRPQISEIERYISSHNPKTPADVDMLLNEFNYKRKLQCF |
Ga0335050_0311643_2_112 | 3300034108 | Freshwater | QLSEIEQYISSHNPKSTADVEMLINEFNHKRKLQCF |
Ga0335061_0481457_3_125 | 3300034168 | Freshwater | FVQPQLSEIEQYISSHNPKSTADVEMLINEFNHKRKLQCF |
⦗Top⦘ |