NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome / Metatranscriptome Family F081102

Metagenome / Metatranscriptome Family F081102

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F081102
Family Type Metagenome / Metatranscriptome
Number of Sequences 114
Average Sequence Length 55 residues
Representative Sequence PFYHASGINGQQIFVHGPSQTVVAKLSTWPTALSPWRDATADGVLAIAAELERTP
Number of Associated Samples 102
Number of Associated Scaffolds 114

Quality Assessment
Transcriptomic Evidence Yes
Most common taxonomic group Bacteria
% of genes with valid RBS motifs 1.77 %
% of genes near scaffold ends (potentially truncated) 96.49 %
% of genes from short scaffolds (< 2000 bps) 92.11 %
Associated GOLD sequencing projects 100
AlphaFold2 3D model prediction Yes
3D model pTM-score0.60

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Bacteria (87.719 % of family members)
NCBI Taxonomy ID 2
Taxonomy All Organisms → cellular organisms → Bacteria

Most Common Ecosystem
GOLD Ecosystem Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil
(22.807 % of family members)
Environment Ontology (ENVO) Unclassified
(24.561 % of family members)
Earth Microbiome Project Ontology (EMPO) Free-living → Non-saline → Soil (non-saline)
(43.860 % of family members)



 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      


 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Globular Signal Peptide: No Secondary Structure distribution: α-helix: 25.30%    β-sheet: 18.07%    Coil/Unstructured: 56.63%
Feature Viewer
Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer
Per-residue confidence (pLDDT):
  0-50   51-70   71-90   91-100  
pTM-score: 0.60
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.


 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 114 Family Scaffolds
PF00326Peptidase_S9 44.74
PF13180PDZ_2 8.77
PF02897Peptidase_S9_N 7.02
PF13365Trypsin_2 4.39
PF00232Glyco_hydro_1 1.75
PF13472Lipase_GDSL_2 1.75
PF02687FtsX 0.88
PF13561adh_short_C2 0.88
PF12706Lactamase_B_2 0.88
PF00296Bac_luciferase 0.88
PF02415Chlam_PMP 0.88
PF04185Phosphoesterase 0.88
PF02978SRP_SPB 0.88
PF13185GAF_2 0.88
PF04542Sigma70_r2 0.88

Neighboring Clusters of Orthologous Genes (COGs)

COG IDNameFunctional Category % Frequency in 114 Family Scaffolds
COG1505Prolyl endopeptidase PreP, S9A serine peptidase familyAmino acid transport and metabolism [E] 7.02
COG1770Protease IIAmino acid transport and metabolism [E] 7.02
COG2723Beta-glucosidase/6-phospho-beta-glucosidase/beta-galactosidaseCarbohydrate transport and metabolism [G] 1.75
COG0541Signal recognition particle GTPaseIntracellular trafficking, secretion, and vesicular transport [U] 0.88
COG0568DNA-directed RNA polymerase, sigma subunit (sigma70/sigma32)Transcription [K] 0.88
COG1191DNA-directed RNA polymerase specialized sigma subunitTranscription [K] 0.88
COG1595DNA-directed RNA polymerase specialized sigma subunit, sigma24 familyTranscription [K] 0.88
COG2141Flavin-dependent oxidoreductase, luciferase family (includes alkanesulfonate monooxygenase SsuD and methylene tetrahydromethanopterin reductase)Coenzyme transport and metabolism [H] 0.88
COG3511Phospholipase CCell wall/membrane/envelope biogenesis [M] 0.88
COG4941Predicted RNA polymerase sigma factor, contains C-terminal TPR domainTranscription [K] 0.88


 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms87.72 %
UnclassifiedrootN/A12.28 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
2189573002|GZIGXIF02IQ8R3All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium558Open in IMG/M
3300002914|JGI25617J43924_10072579All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia1257Open in IMG/M
3300004479|Ga0062595_101566971All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia612Open in IMG/M
3300005332|Ga0066388_105182939All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia661Open in IMG/M
3300005338|Ga0068868_100167651All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia1817Open in IMG/M
3300005434|Ga0070709_11289688All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia589Open in IMG/M
3300005440|Ga0070705_100077177All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia2034Open in IMG/M
3300005445|Ga0070708_100973886All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia796Open in IMG/M
3300005450|Ga0066682_10153423All Organisms → cellular organisms → Bacteria1467Open in IMG/M
3300005456|Ga0070678_102388422All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium502Open in IMG/M
3300005553|Ga0066695_10843858All Organisms → cellular organisms → Bacteria526Open in IMG/M
3300005712|Ga0070764_10340455All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia874Open in IMG/M
3300005764|Ga0066903_108150351All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium536Open in IMG/M
3300006797|Ga0066659_11918926Not Available503Open in IMG/M
3300006914|Ga0075436_101003101All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia627Open in IMG/M
3300009174|Ga0105241_10302667All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia1373Open in IMG/M
3300010046|Ga0126384_11799175All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium582Open in IMG/M
3300010358|Ga0126370_11820883All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium590Open in IMG/M
3300010358|Ga0126370_12664961All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii501Open in IMG/M
3300010360|Ga0126372_10644022All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia1025Open in IMG/M
3300010361|Ga0126378_11738739All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia709Open in IMG/M
3300010362|Ga0126377_10925259All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia935Open in IMG/M
3300010366|Ga0126379_13344411All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium537Open in IMG/M
3300010376|Ga0126381_100238019All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia2458Open in IMG/M
3300010376|Ga0126381_102953273All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii676Open in IMG/M
3300010397|Ga0134124_10106834Not Available2443Open in IMG/M
3300010398|Ga0126383_12366730All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia616Open in IMG/M
3300010880|Ga0126350_10573003All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia1442Open in IMG/M
3300011119|Ga0105246_10808181All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia833Open in IMG/M
3300011120|Ga0150983_13994293All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii515Open in IMG/M
3300012353|Ga0137367_10889183All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia614Open in IMG/M
3300012358|Ga0137368_10022608All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia5906Open in IMG/M
3300012929|Ga0137404_10812758All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia849Open in IMG/M
3300012984|Ga0164309_11370004All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium602Open in IMG/M
3300013104|Ga0157370_11293536All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia657Open in IMG/M
3300013105|Ga0157369_10728340All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia1021Open in IMG/M
3300013308|Ga0157375_11448054All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia810Open in IMG/M
3300014968|Ga0157379_10788225All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia896Open in IMG/M
3300014969|Ga0157376_12756197All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium531Open in IMG/M
3300015373|Ga0132257_103205602All Organisms → cellular organisms → Bacteria596Open in IMG/M
3300016270|Ga0182036_10346731All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia1143Open in IMG/M
3300016270|Ga0182036_11763038All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium524Open in IMG/M
3300016294|Ga0182041_11475189All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium626Open in IMG/M
3300016387|Ga0182040_11756868All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales530Open in IMG/M
3300016404|Ga0182037_11611792Not Available577Open in IMG/M
3300017928|Ga0187806_1320025All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii550Open in IMG/M
3300017942|Ga0187808_10021097All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia2638Open in IMG/M
3300017942|Ga0187808_10354420All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii666Open in IMG/M
3300017942|Ga0187808_10509044Not Available558Open in IMG/M
3300017955|Ga0187817_10642079Not Available677Open in IMG/M
3300017973|Ga0187780_10870655All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia653Open in IMG/M
3300017999|Ga0187767_10092659All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia827Open in IMG/M
3300017999|Ga0187767_10209210All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium621Open in IMG/M
3300018009|Ga0187884_10474613Not Available502Open in IMG/M
3300018062|Ga0187784_11096934All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia632Open in IMG/M
3300018064|Ga0187773_10983980All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium552Open in IMG/M
3300018089|Ga0187774_10140023All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia1254Open in IMG/M
3300020580|Ga0210403_11413499All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium527Open in IMG/M
3300020581|Ga0210399_11506454All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii522Open in IMG/M
3300021402|Ga0210385_11060059Not Available623Open in IMG/M
3300021433|Ga0210391_11084485All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia622Open in IMG/M
3300024227|Ga0228598_1067382All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia715Open in IMG/M
3300025910|Ga0207684_11622491All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii523Open in IMG/M
3300025922|Ga0207646_10967311All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia753Open in IMG/M
3300025961|Ga0207712_11407633All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia624Open in IMG/M
3300026023|Ga0207677_10248667All Organisms → cellular organisms → Bacteria1443Open in IMG/M
3300026524|Ga0209690_1140486Not Available908Open in IMG/M
3300026557|Ga0179587_10067196All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria2102Open in IMG/M
3300027652|Ga0209007_1097155Not Available740Open in IMG/M
3300027783|Ga0209448_10288080All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii539Open in IMG/M
3300027855|Ga0209693_10456394All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii614Open in IMG/M
3300027884|Ga0209275_10193028All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia1098Open in IMG/M
3300027895|Ga0209624_10709879Not Available663Open in IMG/M
3300028381|Ga0268264_11544555All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia674Open in IMG/M
3300028782|Ga0307306_10231226All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium537Open in IMG/M
3300028784|Ga0307282_10254493All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia844Open in IMG/M
3300028792|Ga0307504_10241271All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia658Open in IMG/M
3300028884|Ga0307308_10005354All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria5524Open in IMG/M
3300031231|Ga0170824_125314513All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii655Open in IMG/M
3300031544|Ga0318534_10708472All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium568Open in IMG/M
3300031549|Ga0318571_10275796All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium625Open in IMG/M
3300031573|Ga0310915_10783366All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia671Open in IMG/M
3300031668|Ga0318542_10628876All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium560Open in IMG/M
3300031740|Ga0307468_100494308All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii968Open in IMG/M
3300031764|Ga0318535_10105254All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia1238Open in IMG/M
3300031771|Ga0318546_10584373All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia785Open in IMG/M
3300031771|Ga0318546_11178514All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium538Open in IMG/M
3300031781|Ga0318547_10112999All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia1566Open in IMG/M
3300031782|Ga0318552_10488799All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia628Open in IMG/M
3300031796|Ga0318576_10419759All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia632Open in IMG/M
3300031799|Ga0318565_10208849All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia949Open in IMG/M
3300031846|Ga0318512_10402069All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia688Open in IMG/M
3300031860|Ga0318495_10088217All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia1391Open in IMG/M
3300031894|Ga0318522_10387877All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium529Open in IMG/M
3300031896|Ga0318551_10758659All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia563Open in IMG/M
3300031912|Ga0306921_12496333All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium536Open in IMG/M
3300032008|Ga0318562_10151209All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia1336Open in IMG/M
3300032035|Ga0310911_10387961All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia808Open in IMG/M
3300032054|Ga0318570_10511090Not Available548Open in IMG/M
3300032065|Ga0318513_10411209All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia660Open in IMG/M
3300032067|Ga0318524_10311359All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia815Open in IMG/M
3300032068|Ga0318553_10222466All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia985Open in IMG/M
3300032783|Ga0335079_10612908All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1147Open in IMG/M
3300032895|Ga0335074_10204439All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria2400Open in IMG/M
3300032895|Ga0335074_11145614All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii663Open in IMG/M
3300032895|Ga0335074_11482565Not Available541Open in IMG/M
3300032896|Ga0335075_10848142All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia847Open in IMG/M
3300032896|Ga0335075_11697403All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii513Open in IMG/M
3300032898|Ga0335072_10928608All Organisms → cellular organisms → Bacteria810Open in IMG/M
3300032954|Ga0335083_10406161All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia1163Open in IMG/M
3300033134|Ga0335073_11619415Not Available616Open in IMG/M
3300033158|Ga0335077_10442750All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia1386Open in IMG/M
3300033158|Ga0335077_11739406All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia588Open in IMG/M



 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil22.81%
SoilEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Soil9.65%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil8.77%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil5.26%
Tropical PeatlandEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland5.26%
Freshwater SedimentEnvironmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment4.39%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil4.39%
Corn, Switchgrass And Miscanthus RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere4.39%
Vadose Zone SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil3.51%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Soil3.51%
Forest SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil2.63%
SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Soil2.63%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil1.75%
Miscanthus RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere1.75%
Corn RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere1.75%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere1.75%
PeatlandEnvironmental → Aquatic → Freshwater → Wetlands → Bog → Peatland0.88%
Bog Forest SoilEnvironmental → Aquatic → Freshwater → Wetlands → Bog → Bog Forest Soil0.88%
Terrestrial SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil0.88%
Grass SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Grass Soil0.88%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil0.88%
Grasslands SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil0.88%
Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil0.88%
Hardwood Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil0.88%
Arabidopsis RhizosphereHost-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere0.88%
Switchgrass RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere0.88%
Miscanthus RhizosphereHost-Associated → Plants → Rhizoplane → Soil → Unclassified → Miscanthus Rhizosphere0.88%
Populus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere0.88%
RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere0.88%
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere0.88%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere0.88%
Corn RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere0.88%
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere0.88%
Boreal Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Boreal Forest Soil0.88%

Visualization
Powered by ApexCharts



Associated Samples

Taxon OIDSample NameHabitat TypeIMG/M Link
2189573002Grass soil microbial communities from Rothamsted Park, UK - FE1 (NaCl 30g/L 5ml)EnvironmentalOpen in IMG/M
3300002914Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_115cmEnvironmentalOpen in IMG/M
3300004479Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of All WPAsEnvironmentalOpen in IMG/M
3300005332Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly)EnvironmentalOpen in IMG/M
3300005338Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2Host-AssociatedOpen in IMG/M
3300005434Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaGEnvironmentalOpen in IMG/M
3300005440Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaGEnvironmentalOpen in IMG/M
3300005445Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaGEnvironmentalOpen in IMG/M
3300005450Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_131EnvironmentalOpen in IMG/M
3300005456Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaGHost-AssociatedOpen in IMG/M
3300005553Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_144EnvironmentalOpen in IMG/M
3300005712Warmed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WRM 4EnvironmentalOpen in IMG/M
3300005764Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2)EnvironmentalOpen in IMG/M
3300006797Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_108EnvironmentalOpen in IMG/M
3300006914Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5Host-AssociatedOpen in IMG/M
3300009174Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaGHost-AssociatedOpen in IMG/M
3300010046Tropical forest soil microbial communities from Panama - MetaG Plot_36EnvironmentalOpen in IMG/M
3300010358Tropical forest soil microbial communities from Panama - MetaG Plot_3EnvironmentalOpen in IMG/M
3300010360Tropical forest soil microbial communities from Panama - MetaG Plot_6EnvironmentalOpen in IMG/M
3300010361Tropical forest soil microbial communities from Panama - MetaG Plot_23EnvironmentalOpen in IMG/M
3300010362Tropical forest soil microbial communities from Panama - MetaG Plot_22EnvironmentalOpen in IMG/M
3300010366Tropical forest soil microbial communities from Panama - MetaG Plot_24EnvironmentalOpen in IMG/M
3300010376Tropical forest soil microbial communities from Panama - MetaG Plot_28EnvironmentalOpen in IMG/M
3300010397Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-4EnvironmentalOpen in IMG/M
3300010398Tropical forest soil microbial communities from Panama - MetaG Plot_35EnvironmentalOpen in IMG/M
3300010880Boreal forest soil eukaryotic communities from Alaska, USA - C5-1 Metatranscriptome (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300011119Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaGHost-AssociatedOpen in IMG/M
3300011120Combined assembly of Microbial Forest Soil metaTEnvironmentalOpen in IMG/M
3300012353Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_80_16 metaGEnvironmentalOpen in IMG/M
3300012358Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_100_16 metaGEnvironmentalOpen in IMG/M
3300012929Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_16fungal (Illumina Assembly)EnvironmentalOpen in IMG/M
3300012984Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_247_MGEnvironmentalOpen in IMG/M
3300013104Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaGHost-AssociatedOpen in IMG/M
3300013105Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaGHost-AssociatedOpen in IMG/M
3300013308Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaGHost-AssociatedOpen in IMG/M
3300014968Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaGHost-AssociatedOpen in IMG/M
3300014969Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaGHost-AssociatedOpen in IMG/M
3300015373Combined assembly of cpr5 rhizosphereHost-AssociatedOpen in IMG/M
3300016270Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.080EnvironmentalOpen in IMG/M
3300016294Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.178EnvironmentalOpen in IMG/M
3300016387Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.176EnvironmentalOpen in IMG/M
3300016404Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.082EnvironmentalOpen in IMG/M
3300017928Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - ASW_1EnvironmentalOpen in IMG/M
3300017942Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - ASW_3EnvironmentalOpen in IMG/M
3300017955Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_2EnvironmentalOpen in IMG/M
3300017973Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_Q2_SP10_20_MGEnvironmentalOpen in IMG/M
3300017999Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_QUI02_MP10_10_MGEnvironmentalOpen in IMG/M
3300018009Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_20_40EnvironmentalOpen in IMG/M
3300018062Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_SJ02_MP15_20_MGEnvironmentalOpen in IMG/M
3300018064Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_BV02_MP05_10_MGEnvironmentalOpen in IMG/M
3300018089Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_BV02_MP05_20_MGEnvironmentalOpen in IMG/M
3300020580Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-19-MEnvironmentalOpen in IMG/M
3300020581Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-14-MEnvironmentalOpen in IMG/M
3300021402Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-26-OEnvironmentalOpen in IMG/M
3300021433Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-12-OEnvironmentalOpen in IMG/M
3300024227Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU4Host-AssociatedOpen in IMG/M
3300025910Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025922Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025961Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300026023Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300026524Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_150 (SPAdes)EnvironmentalOpen in IMG/M
3300026557Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_08_16fungalEnvironmentalOpen in IMG/M
3300027652Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM1H0_O2 (SPAdes)EnvironmentalOpen in IMG/M
3300027783Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP14_OM2 (SPAdes)EnvironmentalOpen in IMG/M
3300027855Warmed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WRM 3 (SPAdes)EnvironmentalOpen in IMG/M
3300027884Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF2 (SPAdes)EnvironmentalOpen in IMG/M
3300027895Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM2H0_O1 (SPAdes)EnvironmentalOpen in IMG/M
3300028381Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300028782Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_193EnvironmentalOpen in IMG/M
3300028784Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_121EnvironmentalOpen in IMG/M
3300028792Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 19_SEnvironmentalOpen in IMG/M
3300028884Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_195EnvironmentalOpen in IMG/M
3300031231Coassembly Site 11 (all samples) - Champenoux / Amance forestEnvironmentalOpen in IMG/M
3300031544Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.117b4f26EnvironmentalOpen in IMG/M
3300031549Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.088b5f24EnvironmentalOpen in IMG/M
3300031573Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.AN111EnvironmentalOpen in IMG/M
3300031668Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.168b4f23EnvironmentalOpen in IMG/M
3300031740Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gases AM2C_05EnvironmentalOpen in IMG/M
3300031764Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.117b4f27EnvironmentalOpen in IMG/M
3300031771Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f19EnvironmentalOpen in IMG/M
3300031781Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f20EnvironmentalOpen in IMG/M
3300031782Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f20EnvironmentalOpen in IMG/M
3300031796Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f24EnvironmentalOpen in IMG/M
3300031799Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.066b5f21EnvironmentalOpen in IMG/M
3300031846Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.171b2f19EnvironmentalOpen in IMG/M
3300031860Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.108b1f25EnvironmentalOpen in IMG/M
3300031894Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f18EnvironmentalOpen in IMG/M
3300031896Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f19EnvironmentalOpen in IMG/M
3300031912Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.080 (v2)EnvironmentalOpen in IMG/M
3300032008Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.066b5f18EnvironmentalOpen in IMG/M
3300032035Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.HF170EnvironmentalOpen in IMG/M
3300032054Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.088b5f23EnvironmentalOpen in IMG/M
3300032065Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.171b2f20EnvironmentalOpen in IMG/M
3300032067Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.052b4f22EnvironmentalOpen in IMG/M
3300032068Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f21EnvironmentalOpen in IMG/M
3300032783Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.3EnvironmentalOpen in IMG/M
3300032895Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_2.3EnvironmentalOpen in IMG/M
3300032896Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_2.4EnvironmentalOpen in IMG/M
3300032898Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_2.1EnvironmentalOpen in IMG/M
3300032954Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.2EnvironmentalOpen in IMG/M
3300033134Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_2.2EnvironmentalOpen in IMG/M
3300033158Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.1EnvironmentalOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap



 ⦗Top⦘

Family Sequences

Protein ID Sample Taxon ID Habitat Sequence
FE1_072216102189573002Grass SoilIRHVPSQTVVAKLSTWPTALSPWLEATGAGVLAIAAELERTA
JGI25617J43924_1007257913300002914Grasslands SoilDPGVPFFHASGINGQNVFVHVPSQTVVAKLSTWPTALSPALDVTAAAALAMSGALLDGRL
Ga0062595_10156697113300004479SoilLPFYHASGINGQHIFVHGPSQTVVAKLSTWPTALSPALEATAAGVLAIAAELERAA*
Ga0066388_10518293913300005332Tropical Forest SoilDDPGLPFYHASGINGQHIFVHGPSQTVVAKLSTWPTALSPSLEATVAGVLAIAAELEHTA
Ga0068868_10016765123300005338Miscanthus RhizosphereNGQQIFVHGPSQTVVAKLSTWPTALSPWRDATADGVLAIAAELERTP*
Ga0070709_1128968823300005434Corn, Switchgrass And Miscanthus RhizosphereSGINGQHIFVHVPSQTVVVKLSTWPTALSPWIEATVHGVYAIAAELQRRG*
Ga0070705_10007717723300005440Corn, Switchgrass And Miscanthus RhizospherePFYHASGINGQQIFVHGPSQTVVAKLSTWPTALSPWRDATADGVLAIAAELERTP*
Ga0070708_10097388613300005445Corn, Switchgrass And Miscanthus RhizosphereSGINGQNVFVHVPSQTVVAKLSTWPTALSPALDLTVAGVLAMSSALQEGRL*
Ga0066682_1015342323300005450SoilRNCWWVDDPGLPFYQASGINGQHILVHVPSQTVMVKLSTWPTALSPWIDATVHGVYAIAAELQRRG*
Ga0070678_10238842223300005456Miscanthus RhizosphereVHGPSQTVVAKLSTWPTALSPWRDATADGVLAIAAELERTP*
Ga0066695_1084385823300005553SoilNGQHIFVHVPSQTVVVKLSTWPTALSPWIEATVHGVYAIAAEFQRRG*
Ga0070764_1034045513300005712SoilPAVPFYQASGINGQNIFVHVPSQTVVAKLSTWPTALNPAAIPTREAVLAIVSALQADGPAAGH*
Ga0066903_10815035123300005764Tropical Forest SoilPSQTVVAKLSTWPTALSPWREATAAGVLAIAAELERTA*
Ga0066659_1191892623300006797SoilGLPFFHASGINGQHVFVHMPSQTVIVKLSTWPTALSPASVTTVQAVLAISSALHEGRL*
Ga0075436_10100310113300006914Populus RhizosphereVPFYHASGINGQQIFVHGPSQTVVAKLSTWPTALSPWRDATADCVLAIAAELERTL*
Ga0105241_1030266723300009174Corn RhizosphereYRNCWWVRDPGVPFFHASGINGQNVFVHVPSQTVVAKLSTWPTALSDWRQATGACVLAIAAELEGTG*
Ga0126384_1179917523300010046Tropical Forest SoilWWVRDPGLPFYEASGINGQHVFVHVPSQTVVVKLSTWPVALSPWITATVQGVLAITDALRRRG*
Ga0126370_1182088313300010358Tropical Forest SoilDPGLPFYHASGINGQQIFIHVPSQTVVAKLSTWPTALSPWREATGAGVLAIAAELERTG*
Ga0126370_1266496123300010358Tropical Forest SoilFFHASGINGQNVFVHGPTGTVVVKLSTWPTALSPMIKVTTDAARAIAEALG*
Ga0126372_1064402223300010360Tropical Forest SoilNGQHIFVHGPSQTVVAKLSTWPTALSPSLEATVAGVLAIAAELERTA*
Ga0126378_1173873913300010361Tropical Forest SoilVHVPSQTVVAKLSTWPTALSPWREATGDGVLAIAAELERTV*
Ga0126377_1092525913300010362Tropical Forest SoilVHGPSQTVVAKLSTWPTALSPWRDTTAAGVLAIAAELERAP*
Ga0126379_1334441123300010366Tropical Forest SoilYRNCWWIDDPGLPFYHASGINGQQVFIHVPSQTVVAKLSTWPTALSPWREATGDGVLAIAAELERTG*
Ga0126381_10023801913300010376Tropical Forest SoilSEPAVPFFNAAGINGQNVFVHVPSETVVAKFSTWPTALSSKIGITTDAARAIAEALGSRE
Ga0126381_10295327313300010376Tropical Forest SoilWWVSEPAVPFFNAAGINGQNVFVHVPSETVVAKFSTWPTALSSKIQVTTDAARAIAEALGPRE*
Ga0134124_1010683413300010397Terrestrial SoilGPHYRNCWWVDDPGVPFYHASGINGQQIFVHGPSQTVVAKLSTWPTALSPWRDATADGVLAIAAELERTP*
Ga0126383_1236673013300010398Tropical Forest SoilGLPFYHASGINGQHVFVHVPSQTVVVKLSTWPVALSPWITATVQGVLAITDALRRRG*
Ga0126350_1057300313300010880Boreal Forest SoilPSQTVVVKLSSWPDALNPGLRRATIAAVTAIAAELG*
Ga0105246_1080818123300011119Miscanthus RhizosphereVPFYHASGINGQQIFVHGPSQTVVAKLSTWPTALSPWRDATADGVLAIAAELERTP*
Ga0150983_1399429323300011120Forest SoilEPAVPFFYAAGINGQQVFVHQPSQVVVVKLSTWPSALNPVSRLTIDAVLAIAAALQSGPDG*
Ga0137367_1088918323300012353Vadose Zone SoilPSFSALGINGQHVFVHVPSQTVVVKFSTWPVALSPAMRRTTIGAMLAIADALASDTA*
Ga0137368_1002260883300012358Vadose Zone SoilWVEDPVAPSFSALGINGQHVFVHVPSQTVVVKFSTWPVALSPAMRRTTIGAMLAIADALASDTA*
Ga0137404_1081275823300012929Vadose Zone SoilFHASGINGQHVFVHMPSQTVIVKLSTWPTALSPASVTTVQAVLAISSALHEGRL*
Ga0164309_1137000423300012984SoilYHASGINGQHIFVHVPSQTVVAKLSTWPTALSDWLQATGAGVLAIAAELERTG*
Ga0157370_1129353623300013104Corn RhizosphereMHYRNCWWVDDPGVPFYHASGINGQQIFVHGPSQTVVAKLSTWPTALSPWRDATADGVLAIAAELERTP*
Ga0157369_1072834013300013105Corn RhizosphereHASGINGQHIFVHVPSQTVVAKLSTWPTALSDWRQATGACVLAIAAELEGTG*
Ga0157375_1144805413300013308Miscanthus RhizosphereIFVHGPSQTVVAKLSTWPTALSPWRDATADGVLAIAAELERTP*
Ga0157379_1078822513300014968Switchgrass RhizosphereGPDAFAAGGSLPPGHPAGPHYRNCWWVDDPGVPFYHASGINGQQIFVHGPSQTVVAKLSTWPTALSPWRDATADGVLAIAAELERTP*
Ga0157376_1275619723300014969Miscanthus RhizosphereYRNCWWVDDPGVPFYHASGINGQQIFVHGPSQTVVAKLSTWPTALSPWRDATADGVLAIAAELERTP*
Ga0132257_10320560213300015373Arabidopsis RhizosphereGPSQTVVAKLSTWPTALSPWRDATADGVLAIAAELERTP*
Ga0182036_1034673113300016270SoilVADPGLPFYHASGINGQHVFVHGPSQTVVVKFSTWPTALSVWRQATSAAVLAIAAELERT
Ga0182036_1176303823300016270SoilPGLPFYHASGINGQHIFVHAPSQTVVAKLSTWPTALSPWRDATGAGVLAIAAELERTR
Ga0182041_1147518913300016294SoilVHTPSQTVVAKLSTWPTALSPWRDATGAGVLAIAAELERTT
Ga0182040_1175686813300016387SoilWVRDPGLPFYHASGINGQHIFVHGPAQTVVVKLSTWPTALSANWKEMTVAGVIATAAALHEGRC
Ga0182037_1161179223300016404SoilASGINGQNVFVHVPSQTVVAKLSTWPTALSPALAATVQAVLAMASALQAGDLRG
Ga0187806_132002523300017928Freshwater SedimentNCWWVREPAVPFFHASGINGQNVFVHVPSRTIVVKFSTWPTALSPLIKVTTDAARAIADALGSGRI
Ga0187808_1002109723300017942Freshwater SedimentWWVREPAVPFFHASGINGQNVFVHVPSQTVVVKLSTWPTALSPQIRVTTDAARAIAESLSART
Ga0187808_1035442023300017942Freshwater SedimentVAEPAVPFFYAWGINGQNVFVHQPSGVVVVKLSTLPSAASPTSRLTIDAVKAIADRLGGSSP
Ga0187808_1050904423300017942Freshwater SedimentREPSVPFFYAAGINGQNVFVHVPSQTVVAKLSTWPTALSSKIRVTTDAALAIAESLNR
Ga0187817_1064207923300017955Freshwater SedimentFHTSGINGQPVFVHGVSQTVLVKLSTWPTALSSSLLGQTVATVLAIADALEARG
Ga0187780_1087065513300017973Tropical PeatlandAHYRNCWWVRYPGIPLFNASGINGQNVFVHVPTQTVVAKFSTWPTALSPRFSRLTVAGVLAIAAALDEGRV
Ga0187767_1009265913300017999Tropical PeatlandDGPGLPFYHASGINGQHVFVHGPSETVVVKFSTWPTALSVWRQATGAAVLAIAAELERTA
Ga0187767_1020921023300017999Tropical PeatlandPAGAHYRNCWWIDDPGVPFYHASGINGQHIFIHAPSQTVVAKLSTWPAALSPWLEATAAGVLAIAAELERTA
Ga0187884_1047461313300018009PeatlandASGINGQNVFVHVPSQTVVAKFSTWPSALSDVMLGMTADAVLAICAALPDGPR
Ga0187784_1109693413300018062Tropical PeatlandRDPGLPFYQASGINGQNIFVHVPSQTVVAKFSTWPTALSPAAGVTAQAALALGNALQDGQFGV
Ga0187773_1098398023300018064Tropical PeatlandPFYHASGINGQHIFVHAPSQTVVAKLSTWPTALSPWLEATAAGVLAIAAELERTA
Ga0187774_1014002313300018089Tropical PeatlandPGLPFYHASGINGQHIFVHAPSQTVVAKLSTWPTALSPWRDATGAGVLAIAAELERTA
Ga0210403_1141349913300020580SoilFYHASGINGQHIFVHVPSQTVVAKLSTWPTALSDWLQATGAGVLAIAAELERTG
Ga0210399_1150645423300020581SoilFHASGINGQNVFVHVPTRTVVVKLSTWPTALSPMIKVTTDAVTAIAEALDSGRI
Ga0210385_1106005923300021402SoilAGINGQNVYVHRPSQLVVAKLSTWPSALHPVSMTTIDGVKAIAAALG
Ga0210391_1108448513300021433SoilGINGQNIFVHVPSQTVVAKFSTWPTALSLAAGVTTQAALAISNALQNGQLGG
Ga0228598_106738223300024227RhizosphereRDSAPGAHYRNCWWIWRPDVPFYQASGINGQAVYVHVPSQTVVAKFSTWPAALSVPAADRAAHAVLAISNALQDGQLGG
Ga0207684_1162249113300025910Corn, Switchgrass And Miscanthus RhizosphereGINGQQIFVHGPSQTVVAKLSTWPTALSPWRDATADGVLAIAAELERTP
Ga0207646_1096731123300025922Corn, Switchgrass And Miscanthus RhizosphereYASGINGQNIFVHVPSQTVVAKLSTWPTALSPALDVTVRGVLALSDALRAGRL
Ga0207712_1140763313300025961Switchgrass RhizospherePGPPFYHASGINGQHIFVHVPSQTVVVKLSTWPTALSPWIEATVHGVYAIAAELQRRG
Ga0207677_1024866733300026023Miscanthus RhizosphereNGQQIFVHGPSQTVVAKLSTWPTALSPWRDATADGVLAIAAELERTP
Ga0209690_114048613300026524SoilNVFVHPPSQTVVAKFSTWPEALRPSLKRVTVAGVLAIAEELTRRSR
Ga0179587_1006719613300026557Vadose Zone SoilPFFHASGINGQNVFVHVPSQTVVVKLSTWPTALSPALEVTVRAVLALASALHAGGL
Ga0209007_109715513300027652Forest SoilMPVHAADVASGINGQNVFVHVPSQTVVAKFSTWPTALSPLLGVTTDAVRAIATA
Ga0209448_1028808013300027783Bog Forest SoilPAVPFFHASGINGQNVFVHVPSQTVVVKLSTWPTALSPAIQMTVDAVLAIAAALGGRA
Ga0209693_1045639413300027855SoilHASGINGQNVFVHVPSQTVVVKLSTWPTALSPMLKVTTDAVRAIAEALGSGRI
Ga0209275_1019302813300027884SoilSGINGQNIFVHVPSQTVVAKFSTWPTALSLAAGVTTQAALAISNALQNGQLGG
Ga0209624_1070987923300027895Forest SoilSEPAVPFFYAAGINGQNVYVHVPSQVVVAKLSTWPSALHPVSRATIDAVSAIAAALGNGR
Ga0268264_1154455513300028381Switchgrass RhizosphereTVVAKLSTWPTALSPWRDATADGVLAIAAELERTP
Ga0307306_1023122623300028782SoilQHIFVHVPAQTVVVKLSTWPTALSPWIEATVHGVYAIAAELQRRG
Ga0307282_1025449323300028784SoilPFYHASGINGQHIFVHVPAQTVVVKLSTWPTALSPWIEATVHGVYAIAAELQRRG
Ga0307504_1024127113300028792SoilASGINGQHIFVHVPSQTVVAKLSTWPTALSDWLQATGAGVLAIAAELERTG
Ga0307308_1000535413300028884SoilNGQHIFVHVPAQTVVVKLSTWPTALSPWIEATVHGVYAIAAELQRRG
Ga0170824_12531451323300031231Forest SoilVRDPAVPFFHASGINGQNVFVHVPSQTVVVKLSTWPTALSPAIQMTVDAVLAIAAALDGRPGRPKS
Ga0318534_1043806713300031544SoilQNVFVHVPSQTVVAKLSTWPTALSPALAATVQAVLAMASALQAGDLRG
Ga0318534_1070847213300031544SoilPGLPFYHASGINGQQVFVHGPSQTVVVKFSTWPTALSVWREATGAAVLAIAAELERTP
Ga0318571_1027579623300031549SoilGQHIFVHTPSQTVVAKLSTWPTALSPWRDATGAGVLAIAAELERTT
Ga0310915_1078336613300031573SoilQHIFVHAPSQTVVAKLSTWPTALSPWRDATGAGVLAIAAELERTT
Ga0318542_1062887623300031668SoilLPFYHASGINGQQVFVHGPSQTVVVKFSTWPTALSVWREATGAAVLAIAAELERTP
Ga0307468_10049430813300031740Hardwood Forest SoilDAFAAGGGLPPGHPAGPHYRNCWWVDDPGVPFYHASGINGQQIFVHGPSQTVVAKLSTWPTALSPWRDAPADGVLAIAAELERTA
Ga0318535_1010525423300031764SoilDPGLPFYHASGINGQQVFVHGPSQTVVVKFSTWPTALSVWREATGAAVLAIAAELERTP
Ga0318546_1058437313300031771SoilGQNVFVHVPSQTVVAKLSTWPTALSPALAPTVQAVLAMASALQAGDLRG
Ga0318546_1117851413300031771SoilIFVHTPSQTVVAKLSTWPTALSPWRDATGAGVLAIAAELERTR
Ga0318547_1011299913300031781SoilRDPAVPFFHGSGINGQNVFVHVPSQTVVAKLSTWPTALSPALGPTVQAALAIASALQAGDLRG
Ga0318552_1048879923300031782SoilSGINGQNVFVHVPSQTVVAKLSTWPTALSPALAPTVQAVLAMASALQAGDLRG
Ga0318576_1041975923300031796SoilVDDPGLPFYHASGINGQQVFVHGPSQTVVVKFSTWPTALSVWREATGAAVLAIAAELERT
Ga0318565_1020884923300031799SoilINGQHIFVHAPSQTVVAKLSTWPTALSPWRDATGAGVLAIAAELERTT
Ga0318512_1040206913300031846SoilHASGINGQNIFVHVPSQTVVAKLSTWPTALSPALDMTVAGVLALSDALRDGRL
Ga0318495_1008821713300031860SoilPFYYASGINGQHIFVHTPSQTVVAKLSTWPTALSPWRDATGAGVLAIAAELERTT
Ga0318522_1038787723300031894SoilINGQHIFVHTPSQTVVAKLSTWPTALSPWRDATGAGVLAIAAELERTR
Ga0318551_1075865913300031896SoilPSQTVVVKFSTWPTALSVWREATGAAVLAIAAELERTP
Ga0306921_1249633323300031912SoilHHASGINGQQVFVHGPSQTVVVKFSTWPTALSVWREATGAAVLAIAAELERTP
Ga0318562_1015120913300032008SoilDPAVPFFHASGINGQNVFVHVPSQTVVAKLSTWPTALSPALAPTVQAVLAMASALQAGDLRG
Ga0310911_1038796123300032035SoilVFVHGPSQTVVVKFSTWPTALSVWRQATSAAVLAIAAELERTP
Ga0318570_1051109013300032054SoilNCWWIRDPSVPFYHASGINGQHIFVHVPTQTVVAKFSTWPTALSANWLRMTVTGVIAAATALHEGGC
Ga0318513_1041120923300032065SoilHIFVHAPSQTVVAKLSTWPTALSPWRDATGAGVLAIAAELERTT
Ga0318524_1031135913300032067SoilYYASGINGQHIFVHTPSQTVVAKLSTWPTALSPWRDATGAGVLAIAAELERTR
Ga0318553_1022246613300032068SoilAVPFFYASGINGQNVFVHVPSQTVVAKLSTWPSPLSPAAGPTVQAVLAIASALQAGDLRG
Ga0335079_1061290813300032783SoilPFYHASGINGQHVFVHAPSRTVVAKLSTWPTALNTELLGQTAAAALAIAAALSGS
Ga0335074_1020443933300032895SoilSVPFFYAAGINGQNVFVHVPSQTVVAKLSTWPTALSSKIRVTTDAALAIAQALIR
Ga0335074_1114561423300032895SoilASGINGQNVFVHVPTQTVVAKLSTWPTALSPAIGVTTDAARAIAASLS
Ga0335074_1148256513300032895SoilWWVRDPGVPFYQASGINGQNIFVHVPSQTVIAKFSTWPTALSPVAGVTTQAALAISNALQDGQLGG
Ga0335075_1084814223300032896SoilRDPGVPFFQASGINGQNVFVHVPSQTVVAKLSTWPTALSPAALCVTTGAVLAIGNALRTGQLDG
Ga0335075_1169740323300032896SoilGINGQNVFVHVPTQTVVAKLSTWPTALSPAIGVTTDAARAIAASLS
Ga0335072_1092860813300032898SoilINGQNIFVHVPSQTVVAKLSTWPTALSPAAGPTVAAVLALSAALHEGRL
Ga0335083_1040616113300032954SoilGQHIFVHGASQTVVVKLSTWPTALSPSLEATAAGVLAIAAELERTA
Ga0335073_1161941523300033134SoilLFHASGINGQNVFVHVPSQTVVAKFSTWPTALSPKIRVTTDAARAIAESLGGRKPAPRQG
Ga0335077_1044275013300033158SoilDPGLPFYHASGINGQHIFVHVPSQTVVAKLSTWPTALSPWRDTTADGVLAIAAELERTP
Ga0335077_1173940613300033158SoilFHASGINGQNVFVHVPSQTVVAKLSTWPTALSPAAGPTVQAVLAMASALQAGDLRG


 ⦗Top⦘


© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.