Basic Information | |
---|---|
Family ID | F081094 |
Family Type | Metagenome / Metatranscriptome |
Number of Sequences | 114 |
Average Sequence Length | 40 residues |
Representative Sequence | REPDAGKPPVRFDERDVETEHGLASEAPADERAGNR |
Number of Associated Samples | 106 |
Number of Associated Scaffolds | 114 |
Quality Assessment | |
---|---|
Transcriptomic Evidence | Yes |
Most common taxonomic group | Unclassified |
% of genes with valid RBS motifs | 26.26 % |
% of genes near scaffold ends (potentially truncated) | 66.67 % |
% of genes from short scaffolds (< 2000 bps) | 66.67 % |
Associated GOLD sequencing projects | 103 |
AlphaFold2 3D model prediction | Yes |
3D model pTM-score | 0.21 |
Hidden Markov Model |
---|
Powered by Skylign |
Most Common Taxonomy | |
---|---|
Group | Unclassified (53.509 % of family members) |
NCBI Taxonomy ID | N/A |
Taxonomy | N/A |
Most Common Ecosystem | |
---|---|
GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil (7.018 % of family members) |
Environment Ontology (ENVO) | Unclassified (14.912 % of family members) |
Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (44.737 % of family members) |
⦗Top⦘ |
⦗Top⦘ |
Predicted Topology & Secondary Structure | |||||
---|---|---|---|---|---|
Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 6.25% β-sheet: 0.00% Coil/Unstructured: 93.75% | Feature Viewer |
|
|||||
Powered by Feature Viewer |
Structure Viewer | |
---|---|
| |
Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.21 |
Powered by PDBe Molstar |
⦗Top⦘ |
Pfam ID | Name | % Frequency in 114 Family Scaffolds |
---|---|---|
PF08388 | GIIM | 36.84 |
PF13701 | DDE_Tnp_1_4 | 2.63 |
PF01548 | DEDD_Tnp_IS110 | 2.63 |
PF03795 | YCII | 1.75 |
PF00078 | RVT_1 | 1.75 |
PF03050 | DDE_Tnp_IS66 | 1.75 |
PF01609 | DDE_Tnp_1 | 1.75 |
PF00589 | Phage_integrase | 1.75 |
PF00106 | adh_short | 0.88 |
PF07729 | FCD | 0.88 |
PF00582 | Usp | 0.88 |
PF08264 | Anticodon_1 | 0.88 |
PF05598 | DUF772 | 0.88 |
PF04542 | Sigma70_r2 | 0.88 |
PF03781 | FGE-sulfatase | 0.88 |
PF09369 | MZB | 0.88 |
PF03544 | TonB_C | 0.88 |
PF02371 | Transposase_20 | 0.88 |
PF04616 | Glyco_hydro_43 | 0.88 |
PF01904 | DUF72 | 0.88 |
PF02517 | Rce1-like | 0.88 |
PF13751 | DDE_Tnp_1_6 | 0.88 |
PF13358 | DDE_3 | 0.88 |
PF10387 | DUF2442 | 0.88 |
PF12760 | Zn_Tnp_IS1595 | 0.88 |
PF12704 | MacB_PCD | 0.88 |
COG ID | Name | Functional Category | % Frequency in 114 Family Scaffolds |
---|---|---|---|
COG3547 | Transposase | Mobilome: prophages, transposons [X] | 3.51 |
COG2350 | YciI superfamily enzyme, includes 5-CHQ dehydrochlorinase, contains active-site pHis | Secondary metabolites biosynthesis, transport and catabolism [Q] | 1.75 |
COG3039 | Transposase and inactivated derivatives, IS5 family | Mobilome: prophages, transposons [X] | 1.75 |
COG3293 | Transposase | Mobilome: prophages, transposons [X] | 1.75 |
COG3385 | IS4 transposase InsG | Mobilome: prophages, transposons [X] | 1.75 |
COG3436 | Transposase | Mobilome: prophages, transposons [X] | 1.75 |
COG5421 | Transposase | Mobilome: prophages, transposons [X] | 1.75 |
COG5433 | Predicted transposase YbfD/YdcC associated with H repeats | Mobilome: prophages, transposons [X] | 1.75 |
COG5659 | SRSO17 transposase | Mobilome: prophages, transposons [X] | 1.75 |
COG0568 | DNA-directed RNA polymerase, sigma subunit (sigma70/sigma32) | Transcription [K] | 0.88 |
COG0810 | Periplasmic protein TonB, links inner and outer membranes | Cell wall/membrane/envelope biogenesis [M] | 0.88 |
COG1191 | DNA-directed RNA polymerase specialized sigma subunit | Transcription [K] | 0.88 |
COG1262 | Formylglycine-generating enzyme, required for sulfatase activity, contains SUMF1/FGE domain | Posttranslational modification, protein turnover, chaperones [O] | 0.88 |
COG1266 | Membrane protease YdiL, CAAX protease family | Posttranslational modification, protein turnover, chaperones [O] | 0.88 |
COG1595 | DNA-directed RNA polymerase specialized sigma subunit, sigma24 family | Transcription [K] | 0.88 |
COG1801 | Sugar isomerase-related protein YecE, UPF0759/DUF72 family | General function prediction only [R] | 0.88 |
COG1802 | DNA-binding transcriptional regulator, GntR family | Transcription [K] | 0.88 |
COG2186 | DNA-binding transcriptional regulator, FadR family | Transcription [K] | 0.88 |
COG4449 | Predicted protease, Abi (CAAX) family | General function prediction only [R] | 0.88 |
COG4941 | Predicted RNA polymerase sigma factor, contains C-terminal TPR domain | Transcription [K] | 0.88 |
⦗Top⦘ |
Name | Rank | Taxonomy | Distribution |
Unclassified | root | N/A | 53.51 % |
All Organisms | root | All Organisms | 46.49 % |
Visualization |
---|
Powered by ApexCharts |
Scaffold | Taxonomy | Length | IMG/M Link |
---|---|---|---|
2170459011|GI3SL7401ES6GY | Not Available | 556 | Open in IMG/M |
3300000956|JGI10216J12902_105625402 | Not Available | 791 | Open in IMG/M |
3300001213|JGIcombinedJ13530_102746509 | Not Available | 775 | Open in IMG/M |
3300001356|JGI12269J14319_10053030 | Not Available | 2390 | Open in IMG/M |
3300001661|JGI12053J15887_10386794 | Not Available | 673 | Open in IMG/M |
3300002123|C687J26634_10037150 | Not Available | 1887 | Open in IMG/M |
3300002231|KVRMV2_101875389 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Planctomycetales → Planctomycetaceae → unclassified Planctomycetaceae → Planctomycetaceae bacterium | 551 | Open in IMG/M |
3300004805|Ga0007792_10017124 | Not Available | 2208 | Open in IMG/M |
3300005552|Ga0066701_10958681 | Not Available | 506 | Open in IMG/M |
3300005713|Ga0066905_101344952 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Planctomycetales → Planctomycetaceae → unclassified Planctomycetaceae → Planctomycetaceae bacterium | 644 | Open in IMG/M |
3300005764|Ga0066903_100483683 | Not Available | 2088 | Open in IMG/M |
3300005764|Ga0066903_101714133 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1197 | Open in IMG/M |
3300005844|Ga0068862_100061430 | All Organisms → cellular organisms → Bacteria | 3230 | Open in IMG/M |
3300006102|Ga0075015_100956035 | All Organisms → cellular organisms → Bacteria | 522 | Open in IMG/M |
3300006800|Ga0066660_10933527 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Edaphobacter | 704 | Open in IMG/M |
3300006800|Ga0066660_11406597 | All Organisms → cellular organisms → Bacteria | 547 | Open in IMG/M |
3300007076|Ga0075435_101468124 | Not Available | 598 | Open in IMG/M |
3300009012|Ga0066710_101702999 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes | 959 | Open in IMG/M |
3300009095|Ga0079224_101370224 | Not Available | 1005 | Open in IMG/M |
3300009685|Ga0116142_10106721 | All Organisms → Viruses → Predicted Viral | 1516 | Open in IMG/M |
3300009700|Ga0116217_10833739 | Not Available | 567 | Open in IMG/M |
3300009776|Ga0116154_10478378 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes | 530 | Open in IMG/M |
3300009873|Ga0131077_10110767 | All Organisms → cellular organisms → Bacteria | 3266 | Open in IMG/M |
3300010366|Ga0126379_11117104 | Not Available | 894 | Open in IMG/M |
3300010376|Ga0126381_100084303 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium AB60 | 4011 | Open in IMG/M |
3300010379|Ga0136449_100534690 | Not Available | 2022 | Open in IMG/M |
3300010379|Ga0136449_101883478 | Not Available | 890 | Open in IMG/M |
3300010413|Ga0136851_10586269 | All Organisms → cellular organisms → Bacteria | 1105 | Open in IMG/M |
3300010430|Ga0118733_108555888 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Planctomycetales → Planctomycetaceae → unclassified Planctomycetaceae → Planctomycetaceae bacterium | 528 | Open in IMG/M |
3300011118|Ga0114922_10884329 | Not Available | 728 | Open in IMG/M |
3300011271|Ga0137393_11338457 | Not Available | 605 | Open in IMG/M |
3300012205|Ga0137362_11356881 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 597 | Open in IMG/M |
3300012363|Ga0137390_10402776 | All Organisms → cellular organisms → Bacteria | 1347 | Open in IMG/M |
3300012985|Ga0164308_10468906 | Not Available | 1046 | Open in IMG/M |
3300014158|Ga0181521_10618372 | Not Available | 506 | Open in IMG/M |
3300014200|Ga0181526_10595168 | All Organisms → cellular organisms → Bacteria | 699 | Open in IMG/M |
3300014262|Ga0075301_1126160 | Not Available | 576 | Open in IMG/M |
3300014269|Ga0075302_1155758 | Not Available | 557 | Open in IMG/M |
3300014489|Ga0182018_10046409 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium erythrophlei | 2676 | Open in IMG/M |
3300014492|Ga0182013_10539004 | Not Available | 602 | Open in IMG/M |
3300014493|Ga0182016_10004323 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 15806 | Open in IMG/M |
3300014493|Ga0182016_10268669 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1058 | Open in IMG/M |
3300014498|Ga0182019_10132975 | Not Available | 1560 | Open in IMG/M |
3300014501|Ga0182024_10020675 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 12014 | Open in IMG/M |
3300015242|Ga0137412_10395860 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1070 | Open in IMG/M |
3300015360|Ga0163144_10304276 | All Organisms → cellular organisms → Bacteria | 2026 | Open in IMG/M |
3300015373|Ga0132257_103727438 | All Organisms → cellular organisms → Bacteria | 554 | Open in IMG/M |
3300016387|Ga0182040_11806390 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Planctomycetales → Planctomycetaceae → unclassified Planctomycetaceae → Planctomycetaceae bacterium | 523 | Open in IMG/M |
3300016750|Ga0181505_10395762 | All Organisms → cellular organisms → Bacteria → Nitrospirae → Nitrospira → Nitrospirales → Nitrospiraceae → unclassified Nitrospiraceae → Nitrospiraceae bacterium | 1593 | Open in IMG/M |
3300017823|Ga0187818_10172052 | Not Available | 944 | Open in IMG/M |
3300017972|Ga0187781_10080522 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Geodermatophilales → Geodermatophilaceae → unclassified Geodermatophilaceae → Geodermatophilaceae bacterium | 2250 | Open in IMG/M |
3300018012|Ga0187810_10174009 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 870 | Open in IMG/M |
3300018044|Ga0187890_10620040 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia | 610 | Open in IMG/M |
3300018432|Ga0190275_13391396 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Phycisphaerae → unclassified Phycisphaerae → Phycisphaerae bacterium RAS2 | 516 | Open in IMG/M |
3300018468|Ga0066662_11355443 | Not Available | 733 | Open in IMG/M |
3300020214|Ga0194132_10424830 | Not Available | 672 | Open in IMG/M |
3300020221|Ga0194127_10063852 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 2861 | Open in IMG/M |
3300021070|Ga0194056_10261759 | Not Available | 590 | Open in IMG/M |
3300021071|Ga0194058_10007252 | All Organisms → cellular organisms → Bacteria | 4651 | Open in IMG/M |
3300021071|Ga0194058_10010631 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → unclassified Planctomycetota → Planctomycetota bacterium | 3627 | Open in IMG/M |
3300021401|Ga0210393_10592456 | Not Available | 905 | Open in IMG/M |
3300021407|Ga0210383_10448783 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1114 | Open in IMG/M |
(restricted) 3300021517|Ga0224723_1043804 | Not Available | 1627 | Open in IMG/M |
3300022502|Ga0242646_1012979 | Not Available | 721 | Open in IMG/M |
3300022509|Ga0242649_1002249 | Not Available | 1629 | Open in IMG/M |
3300022529|Ga0242668_1033519 | Not Available | 849 | Open in IMG/M |
3300023101|Ga0224557_1269257 | Not Available | 555 | Open in IMG/M |
3300025460|Ga0208562_1101185 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Planctomycetales → Planctomycetaceae → unclassified Planctomycetaceae → Planctomycetaceae bacterium | 560 | Open in IMG/M |
3300025906|Ga0207699_10035485 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2838 | Open in IMG/M |
3300026322|Ga0209687_1112636 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Edaphobacter | 879 | Open in IMG/M |
3300027562|Ga0209735_1126978 | Not Available | 555 | Open in IMG/M |
3300027576|Ga0209003_1065488 | All Organisms → cellular organisms → Bacteria | 662 | Open in IMG/M |
3300027610|Ga0209528_1000993 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 5373 | Open in IMG/M |
3300028380|Ga0268265_10045602 | Not Available | 3272 | Open in IMG/M |
3300028747|Ga0302219_10221833 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Burkholderiaceae → Cupriavidus → unclassified Cupriavidus → Cupriavidus sp. UYPR2.512 | 731 | Open in IMG/M |
3300028863|Ga0302218_10281965 | All Organisms → cellular organisms → Bacteria | 537 | Open in IMG/M |
3300030007|Ga0311338_11791364 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Edaphobacter | 553 | Open in IMG/M |
3300031231|Ga0170824_120247664 | Not Available | 532 | Open in IMG/M |
3300031231|Ga0170824_123056651 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 618 | Open in IMG/M |
3300031344|Ga0265316_10074331 | Not Available | 2615 | Open in IMG/M |
3300031670|Ga0307374_10041377 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes | 5014 | Open in IMG/M |
3300031671|Ga0307372_10068264 | All Organisms → cellular organisms → Bacteria | 3158 | Open in IMG/M |
3300031833|Ga0310917_10758030 | Not Available | 656 | Open in IMG/M |
3300031837|Ga0302315_10765448 | Not Available | 502 | Open in IMG/M |
3300031880|Ga0318544_10126752 | Not Available | 972 | Open in IMG/M |
3300031890|Ga0306925_10531335 | Not Available | 1249 | Open in IMG/M |
3300031896|Ga0318551_10260811 | Not Available | 970 | Open in IMG/M |
3300031912|Ga0306921_12054651 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 607 | Open in IMG/M |
3300032076|Ga0306924_11871384 | All Organisms → cellular organisms → Bacteria | 623 | Open in IMG/M |
3300032076|Ga0306924_12017412 | All Organisms → cellular organisms → Bacteria | 594 | Open in IMG/M |
3300032160|Ga0311301_10291905 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2624 | Open in IMG/M |
3300032177|Ga0315276_12528358 | Not Available | 513 | Open in IMG/M |
3300032261|Ga0306920_102129918 | All Organisms → cellular organisms → Bacteria | 782 | Open in IMG/M |
3300032420|Ga0335397_10460228 | Not Available | 1040 | Open in IMG/M |
3300032668|Ga0316230_1196516 | Not Available | 717 | Open in IMG/M |
3300033487|Ga0316630_10501587 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes | 994 | Open in IMG/M |
3300033513|Ga0316628_101522933 | All Organisms → cellular organisms → Bacteria | 891 | Open in IMG/M |
3300033829|Ga0334854_095032 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Burkholderiaceae → Cupriavidus → unclassified Cupriavidus → Cupriavidus sp. UYPR2.512 | 713 | Open in IMG/M |
3300033887|Ga0334790_032851 | Not Available | 2121 | Open in IMG/M |
Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
⦗Top⦘ |
Habitat | Taxonomy | Distribution |
Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 7.02% |
Peatlands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil | 6.14% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 5.26% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 5.26% |
Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 4.39% |
Palsa | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Palsa | 4.39% |
Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 3.51% |
Anoxic Zone Freshwater | Environmental → Aquatic → Freshwater → Lake → Unclassified → Anoxic Zone Freshwater | 2.63% |
Freshwater Lake | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake | 2.63% |
Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 2.63% |
Bog | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Bog | 2.63% |
Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 2.63% |
Soil | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Soil | 2.63% |
Sediment | Environmental → Aquatic → Freshwater → Lake → Sediment → Sediment | 1.75% |
Peatland | Environmental → Aquatic → Freshwater → Wetlands → Bog → Peatland | 1.75% |
Bog | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog | 1.75% |
Freshwater Sediment | Environmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment | 1.75% |
Watersheds | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds | 1.75% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 1.75% |
Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 1.75% |
Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil | 1.75% |
Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 1.75% |
Natural And Restored Wetlands | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Natural And Restored Wetlands | 1.75% |
Soil | Environmental → Terrestrial → Soil → Clay → Unclassified → Soil | 1.75% |
Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 1.75% |
Anaerobic Digestor Sludge | Engineered → Wastewater → Anaerobic Digestor → Unclassified → Unclassified → Anaerobic Digestor Sludge | 1.75% |
Freshwater | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater | 0.88% |
Freshwater | Environmental → Aquatic → Freshwater → Lentic → Hypolimnion → Freshwater | 0.88% |
Freshwater Microbial Mat | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Microbial Mat | 0.88% |
Freshwater Sediment | Environmental → Aquatic → Freshwater → Lake → Sediment → Freshwater Sediment | 0.88% |
Peatland | Environmental → Aquatic → Freshwater → Wetlands → Unclassified → Peatland | 0.88% |
Groundwater | Environmental → Aquatic → Freshwater → Groundwater → Unclassified → Groundwater | 0.88% |
Freshwater | Environmental → Aquatic → Freshwater → Ice → Glacial Lake → Freshwater | 0.88% |
Marine Sediment | Environmental → Aquatic → Marine → Oceanic → Sediment → Marine Sediment | 0.88% |
Deep Subsurface | Environmental → Aquatic → Marine → Oceanic → Sediment → Deep Subsurface | 0.88% |
Marine Sediment | Environmental → Aquatic → Marine → Coastal → Sediment → Marine Sediment | 0.88% |
Wetland | Environmental → Aquatic → Marine → Wetlands → Sediment → Wetland | 0.88% |
Marine Sediment | Environmental → Aquatic → Marine → Hydrothermal Vents → Sediment → Marine Sediment | 0.88% |
Deep Subsurface | Environmental → Aquatic → Marine → Volcanic → Unclassified → Deep Subsurface | 0.88% |
Soil | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Soil | 0.88% |
Mangrove Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Mangrove Sediment | 0.88% |
Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Agricultural Soil | 0.88% |
Grass Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grass Soil | 0.88% |
Tropical Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland | 0.88% |
Fen | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Fen | 0.88% |
Palsa | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Palsa | 0.88% |
Permafrost | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Permafrost | 0.88% |
Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 0.88% |
Soil | Environmental → Terrestrial → Soil → Loam → Unclassified → Soil | 0.88% |
Sand | Environmental → Terrestrial → Soil → Sand → Unclassified → Sand | 0.88% |
Bog | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Bog | 0.88% |
Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere | 0.88% |
Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 0.88% |
Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Rhizosphere | 0.88% |
Wastewater | Engineered → Wastewater → Activated Sludge → Unclassified → Unclassified → Wastewater | 0.88% |
Visualization |
---|
Powered by ApexCharts |
Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
Taxon OID | Sample Name | Habitat Type | IMG/M Link |
---|---|---|---|
2170459011 | Grass soil microbial communities from Rothamsted Park, UK - July 2009 indirect Gram positive lysis 0-10cm | Environmental | Open in IMG/M |
3300000364 | Soil microbial communities from Great Prairies - Iowa, Native Prairie soil | Environmental | Open in IMG/M |
3300000956 | Soil microbial communities from Great Prairies - Kansas, Native Prairie soil | Environmental | Open in IMG/M |
3300001213 | Combined assembly of wetland microbial communities from Twitchell Island in the Sacramento Delta (Jan 2013 JGI Velvet Assembly) | Environmental | Open in IMG/M |
3300001356 | Peat soil microbial communities from Weissenstadt, Germany - SII-SIP-2007 | Environmental | Open in IMG/M |
3300001661 | Mediterranean Blodgett CA OM1_O3 (Mediterranean Blodgett coassembly) | Environmental | Open in IMG/M |
3300002123 | Soil microbial communities from Rifle, Colorado - Rifle CSP2_sed 16_3 | Environmental | Open in IMG/M |
3300002231 | Marine sediment microbial communities from Santorini caldera mats, Greece - red mat | Environmental | Open in IMG/M |
3300004805 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - MA6M | Environmental | Open in IMG/M |
3300005552 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_150 | Environmental | Open in IMG/M |
3300005713 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 36 (version 2) | Environmental | Open in IMG/M |
3300005764 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2) | Environmental | Open in IMG/M |
3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Host-Associated | Open in IMG/M |
3300005956 | Groundwater microbial communities from the Columbia River, Washington, USA, for microbe roles in carbon and contaminant biogeochemistry - GW-RW metaG T4_23-Sept-14 | Environmental | Open in IMG/M |
3300006057 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Straight Creek_MetaG_SC_2012 | Environmental | Open in IMG/M |
3300006102 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Alex Branch Run_MetaG_ABR_2013 | Environmental | Open in IMG/M |
3300006800 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_109 | Environmental | Open in IMG/M |
3300007076 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Host-Associated | Open in IMG/M |
3300009012 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_159 | Environmental | Open in IMG/M |
3300009095 | Agricultural soil microbial communities from Utah to study Nitrogen management - Steer compost 2015 | Environmental | Open in IMG/M |
3300009685 | Active sludge microbial communities of municipal wastewater-treating anaerobic digesters from USA - AD_UKC033_MetaG | Engineered | Open in IMG/M |
3300009700 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_4_PS metaG | Environmental | Open in IMG/M |
3300009702 | Deep subsurface microbial communities from Kolumbo volcano to uncover new lineages of life (NeLLi) - 2SBTROV14_V59a metaG | Environmental | Open in IMG/M |
3300009776 | Active sludge microbial communities of municipal wastewater-treating anaerobic digesters from USA - AD_UKC030_MetaG | Engineered | Open in IMG/M |
3300009873 | Activated sludge microbial diversity in wastewater treatment plant from Taiwan - Wenshan plant | Engineered | Open in IMG/M |
3300010366 | Tropical forest soil microbial communities from Panama - MetaG Plot_24 | Environmental | Open in IMG/M |
3300010376 | Tropical forest soil microbial communities from Panama - MetaG Plot_28 | Environmental | Open in IMG/M |
3300010379 | Sb_50d combined assembly | Environmental | Open in IMG/M |
3300010413 | Mangrove sediment microbial communities from Mai Po Nature Reserve Marshes in Hong Kong, China - Maipo_9 | Environmental | Open in IMG/M |
3300010430 | Marine sediment microbial communities from Gulf of Thailand under amendment with organic carbon and nitrate - JGI co-assembly of 8 samples | Environmental | Open in IMG/M |
3300011118 | Deep subsurface microbial communities from Aarhus Bay to uncover new lineages of life (NeLLi) - Aarhus_00045 metaG | Environmental | Open in IMG/M |
3300011271 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h3.4B metaG | Environmental | Open in IMG/M |
3300011430 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMZT600_2 | Environmental | Open in IMG/M |
3300012205 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_100_16 metaG | Environmental | Open in IMG/M |
3300012363 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h2.4A metaG | Environmental | Open in IMG/M |
3300012985 | Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_246_MG | Environmental | Open in IMG/M |
3300014158 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin02_60_metaG | Environmental | Open in IMG/M |
3300014200 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin06_30_metaG | Environmental | Open in IMG/M |
3300014262 | Natural and restored wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - Browns_TuleA_D1 | Environmental | Open in IMG/M |
3300014269 | Natural and restored wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - Browns_TuleB_D1 | Environmental | Open in IMG/M |
3300014489 | Permafrost microbial communities from Stordalen Mire, Sweden - 812P2M metaG | Environmental | Open in IMG/M |
3300014492 | Permafrost microbial communities from Stordalen Mire, Sweden - 612S2M metaG | Environmental | Open in IMG/M |
3300014493 | Permafrost microbial communities from Stordalen Mire, Sweden - 712S2M metaG | Environmental | Open in IMG/M |
3300014498 | Permafrost microbial communities from Stordalen Mire, Sweden - 812E2M metaG | Environmental | Open in IMG/M |
3300014501 | Permafrost microbial communities from Stordalen Mire, Sweden - P3-2 metaG (Illumina Assembly) | Environmental | Open in IMG/M |
3300015242 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_16fungal (Hybrid Assembly) | Environmental | Open in IMG/M |
3300015360 | Freshwater microbial mat bacterial communities from Lake Vanda, McMurdo Dry Valleys, Antarctica - Oligotrophic Lake LV.19.BULKMAT1 | Environmental | Open in IMG/M |
3300015370 | Groundwater microbial communities from the Aspo Hard Rock Laboratory (HRL) deep subsurface site, Sweden - OS_PC_MetaG | Environmental | Open in IMG/M |
3300015373 | Combined assembly of cpr5 rhizosphere | Host-Associated | Open in IMG/M |
3300016387 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.176 | Environmental | Open in IMG/M |
3300016750 | Metatranscriptome of peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin05_30_metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300017823 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_3 | Environmental | Open in IMG/M |
3300017972 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0715_SJ02_MP02_20_MG | Environmental | Open in IMG/M |
3300018012 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - ASW_5 | Environmental | Open in IMG/M |
3300018044 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_21_10 | Environmental | Open in IMG/M |
3300018432 | Populus adjacent soil microbial communities from riparian zone of Yellowstone River, Montana, USA - 550 T | Environmental | Open in IMG/M |
3300018468 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_111 | Environmental | Open in IMG/M |
3300020198 | Freshwater microbial communities from Lake Tanganyika, Tanzania - TA2015019 Mahale Deep Cast 65m | Environmental | Open in IMG/M |
3300020214 | Freshwater microbial communities from Lake Tanganyika, Tanzania - TA2015054 Kigoma Offshore 80m | Environmental | Open in IMG/M |
3300020221 | Freshwater microbial communities from Lake Tanganyika, Tanzania - TA2015036 Kigoma Deep Cast 100m | Environmental | Open in IMG/M |
3300021070 | Anoxic zone freshwater microbial communities from boreal shield lake in IISD Experimental Lakes Area, Ontario, Canada - Sep2016-L442-13m | Environmental | Open in IMG/M |
3300021071 | Anoxic zone freshwater microbial communities from boreal shield lake in IISD Experimental Lakes Area, Ontario, Canada - Sep2016-L442-17m | Environmental | Open in IMG/M |
3300021401 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-27-O | Environmental | Open in IMG/M |
3300021407 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-14-O | Environmental | Open in IMG/M |
3300021517 (restricted) | Freshwater sediment microbial communities from Lake Towuti, South Sulawesi, Indonesia - Balambano_FR2_MetaG | Environmental | Open in IMG/M |
3300021560 | Tropical forest soil microbial communities from Panama - MetaG Plot_4 | Environmental | Open in IMG/M |
3300022502 | Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-C-19-O (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
3300022509 | Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-C-27-O (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
3300022529 | Metatranscriptome of lab incubated forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-32-O (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
3300023101 | Peat soil microbial communities from Stordalen Mire, Sweden - 717 S3 10-14 | Environmental | Open in IMG/M |
3300025460 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_16_150 (SPAdes) | Environmental | Open in IMG/M |
3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) | Environmental | Open in IMG/M |
3300026322 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_136 (SPAdes) | Environmental | Open in IMG/M |
3300027562 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_Ref_M2 (SPAdes) | Environmental | Open in IMG/M |
3300027576 | Forest soil microbial communities from Davy Crockett National Forest, Groveton, Texas, USA - Texas A ecozone_OM3H0_M3 (SPAdes) | Environmental | Open in IMG/M |
3300027610 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM2H0_M3 (SPAdes) | Environmental | Open in IMG/M |
3300027727 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM3H0_M1 (SPAdes) | Environmental | Open in IMG/M |
3300027917 | Marine sediment microbial communities from White Oak River estuary, North Carolina - WOR-2-8_12 (SPAdes) | Environmental | Open in IMG/M |
3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) | Host-Associated | Open in IMG/M |
3300028747 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Palsa_E1_2 | Environmental | Open in IMG/M |
3300028863 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Palsa_E1_1 | Environmental | Open in IMG/M |
3300029911 | III_Bog_N2 coassembly | Environmental | Open in IMG/M |
3300030007 | I_Palsa_E1 coassembly | Environmental | Open in IMG/M |
3300030399 | II_Palsa_E2 coassembly | Environmental | Open in IMG/M |
3300030659 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_a_PC metaG (v2) | Environmental | Open in IMG/M |
3300031231 | Coassembly Site 11 (all samples) - Champenoux / Amance forest | Environmental | Open in IMG/M |
3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Host-Associated | Open in IMG/M |
3300031670 | Soil microbial communities from Risofladan, Vaasa, Finland - OX-3 | Environmental | Open in IMG/M |
3300031671 | Soil microbial communities from Risofladan, Vaasa, Finland - OX-1 | Environmental | Open in IMG/M |
3300031833 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.LF178 | Environmental | Open in IMG/M |
3300031837 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - III_Palsa_N3_1 | Environmental | Open in IMG/M |
3300031880 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.168b4f25 | Environmental | Open in IMG/M |
3300031890 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.176 (v2) | Environmental | Open in IMG/M |
3300031896 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f19 | Environmental | Open in IMG/M |
3300031912 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.080 (v2) | Environmental | Open in IMG/M |
3300032076 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.111 (v2) | Environmental | Open in IMG/M |
3300032118 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G05_15 | Environmental | Open in IMG/M |
3300032160 | Sb_50d combined assembly (MetaSPAdes) | Environmental | Open in IMG/M |
3300032177 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G05_0 | Environmental | Open in IMG/M |
3300032261 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170 (v2) | Environmental | Open in IMG/M |
3300032420 | Freshwater microbial communities from Lake Fryxell liftoff mats and glacier meltwater in Antarctica - MAT-04 (spades assembly) | Environmental | Open in IMG/M |
3300032668 | Freshwater microbial communities from Trout Bog Lake, Wisconsin, USA - TBH18025 | Environmental | Open in IMG/M |
3300033487 | Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_May_M1_C1_D6_A | Environmental | Open in IMG/M |
3300033513 | Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_Aug_M2_C1_D5_C | Environmental | Open in IMG/M |
3300033829 | Peat soil microbial communities from Stordalen Mire, Sweden - 715 P2 1-5 | Environmental | Open in IMG/M |
3300033887 | Peat soil microbial communities from Stordalen Mire, Sweden - 713 P-1-X1 | Environmental | Open in IMG/M |
Geographical Distribution | |
---|---|
Zoom: | Powered by OpenStreetMap |
⦗Top⦘ |
Note: Some of these sequences are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
Protein ID | Sample Taxon ID | Habitat | Sequence |
F64_02442090 | 2170459011 | Grass Soil | GEPDALIGHVRFDERGVETEHGGVSEAPADERAGHG |
INPhiseqgaiiFebDRAFT_1012466061 | 3300000364 | Soil | VGDSVSLLRELGAGNPPAQFDERDVETEQGSASEAPAYERAGTDRPSLNHR |
JGI10216J12902_1056254021 | 3300000956 | Soil | VGDTVSLLREPDAGNPHVRFDERDVETEHGPASEAPADERAGNR* |
JGIcombinedJ13530_1027465091 | 3300001213 | Wetland | VNKNLLREPDAGNPHVRFAERDVEKEHGPAIEAPANERAGN |
JGI12269J14319_100530303 | 3300001356 | Peatlands Soil | MDENVSLFREPDAGKPPVRFDERDVETEHGLASEAPADERAGNR* |
JGI12053J15887_103867941 | 3300001661 | Forest Soil | VSLLREPDAGDPPVRFDERDVETEQGEPSEAPADERAGNR* |
C687J26634_100371503 | 3300002123 | Soil | VNLLREPDAGDPHVRFDERDVETEHGWDIQAPITERVG |
KVRMV2_1018753892 | 3300002231 | Marine Sediment | LVRKPDAGNPHVRFDERDVETEHGWASEAPSNERGGNR* |
Ga0007792_100171244 | 3300004805 | Freshwater | MNLVREPDAVNPPVRFDEREVETEHGEASEALADERASNR* |
Ga0066701_109586812 | 3300005552 | Soil | MILVREPDAVTPHVRFDEGDVEPEHGVASEAPADERA |
Ga0066905_1013449522 | 3300005713 | Tropical Forest Soil | LVRKPDAGNLHVRFDEREVETEHGWASEAPANERAGNR* |
Ga0066903_1004836831 | 3300005764 | Tropical Forest Soil | VSDNVSFLREPDAIAPHVRFDERDVETEHGEASEAPADERVGQRIGPTYTT |
Ga0066903_1017141331 | 3300005764 | Tropical Forest Soil | LIREPDAGDPHVRFDERDLETEQGRASEAPANERAGQRIGMT* |
Ga0068862_1000614302 | 3300005844 | Switchgrass Rhizosphere | MKRGKPDAGNLHVRFDERDVETGHGQDTEAPAIERVGNG* |
Ga0073920_10453082 | 3300005956 | Sand | MKNNLVREPDAGKPPVRFDEREVETEHGWASEAPATERAGNR* |
Ga0075026_1004982552 | 3300006057 | Watersheds | MNRILVREPDAGKPPVRFDEREVETEHGEAIEAPANERAGNR* |
Ga0075015_1009560352 | 3300006102 | Watersheds | KPDAGNLHVRFDERDVEMGHGRDSEAPATERAGNS* |
Ga0066660_109335272 | 3300006800 | Soil | MDTQFSVGESVSLLREPDAGDPPVRFDERDVETEQGEPSEAPADERAGNR* |
Ga0066660_114065972 | 3300006800 | Soil | VREPDAGNPPVRFEERGVETGHGRAREAPATERAGNG* |
Ga0075435_1014681241 | 3300007076 | Populus Rhizosphere | VREPDAGDPQVRFDEREVETEHGVASEAPADERAGNR* |
Ga0066710_1017029992 | 3300009012 | Grasslands Soil | PVAGPEAANQNVRFEGRDVETEQGGANEAPADERAGHG |
Ga0079224_1013702241 | 3300009095 | Agricultural Soil | MNLLREPDAGDPHVRFDEREVETEQDQAREAPTTERVGQQIGLI* |
Ga0116142_101067211 | 3300009685 | Anaerobic Digestor Sludge | VNLLREPDAGDPHVRFDERDVETEHGSAIEAPATERA |
Ga0116217_108337391 | 3300009700 | Peatlands Soil | MDENVSLFREPDAGKPPVRFDERDVETEHGLASEAPADERAGNR |
Ga0114931_104398522 | 3300009702 | Deep Subsurface | AQALKKNLVREPDAGNPHVRFDEREVETEHGGDTEAPTTERVGNR* |
Ga0116154_104783782 | 3300009776 | Anaerobic Digestor Sludge | SEREPDARNPHVRFEERDVETEQGGAIEAPADERAGNR* |
Ga0131077_101107675 | 3300009873 | Wastewater | PDAGKPHVRFDEREVETEHGQANETPVNERTGNS* |
Ga0126379_111171042 | 3300010366 | Tropical Forest Soil | TRNHVSLFREPDAVTPPVRFDERDVETEHGAASEAPAHERAGNR* |
Ga0126381_1000843033 | 3300010376 | Tropical Forest Soil | FLREPDAGNPHVRFDERDVETEYGQDNEAPADERAGNG* |
Ga0136449_1005346901 | 3300010379 | Peatlands Soil | MDENVSLFREPDAGKPPVRFDERDVETEHGLASEAP |
Ga0136449_1018834782 | 3300010379 | Peatlands Soil | REPDAGKPPVRFDERDVETEHGLASEAPADERAGNR* |
Ga0136449_1045171681 | 3300010379 | Peatlands Soil | NLVREPDAAAPHVRFDEREVETGHGKASEAPATERAGN* |
Ga0136851_105862691 | 3300010413 | Mangrove Sediment | DAGDPPVRFDERDVETEHGWTSEAPADERVGQQIGPF* |
Ga0118733_1085558882 | 3300010430 | Marine Sediment | MNLVREPDAGKPHVRFDERDVETEHGETSEAPTTERAGQ |
Ga0114922_108843291 | 3300011118 | Deep Subsurface | KAKGEPGAGNPHVRFDERDAVTEQGAAREAPADERAGNR* |
Ga0137393_113384572 | 3300011271 | Vadose Zone Soil | MSYLVREPDAGNLHVRFDEREVETEHGQASETPADERAG |
Ga0137423_10429492 | 3300011430 | Soil | VREPDAGNPLVRFDERGVETGHGEAIEAPAAERAGNR* |
Ga0137362_113568812 | 3300012205 | Vadose Zone Soil | REPDAGDPPVRFDERDVETEQGEPSEAPADERAGNR* |
Ga0137390_104027761 | 3300012363 | Vadose Zone Soil | VGDTVSLLREPDAVNPPVRFDERDVETEHGSASEAPADERA |
Ga0164308_104689061 | 3300012985 | Soil | EPCARNPHARFDEREVETKHGAASEAPADERAGHR* |
Ga0181521_106183721 | 3300014158 | Bog | PCAGNPHARFDKRGVETGHGAANETPADERAGNS* |
Ga0181526_105951681 | 3300014200 | Bog | VSLVREPDSLIGPVWFDERRVETGHGEAIEAPADERAGN |
Ga0075301_11261601 | 3300014262 | Natural And Restored Wetlands | MNLLREPDAGKLQVRFDERDVETEHGAAREAPATERAGKQIGLS* |
Ga0075302_11557581 | 3300014269 | Natural And Restored Wetlands | MNLLRDPDAGKLQVRFDERDVETEHGAASEAPATERAGKQIGLS* |
Ga0182018_100464093 | 3300014489 | Palsa | LREPDAGKPHVRFDERGVETEHDGDIEAPADERAGNG* |
Ga0182013_105390041 | 3300014492 | Bog | PDALIAHVRFDERDVETEYGPDNEAPADERVGHG* |
Ga0182016_1000432317 | 3300014493 | Bog | FLREPDALIAHVRFDERDVETEHGLDNETPVNESAGNR* |
Ga0182016_102686692 | 3300014493 | Bog | FLREPDALIAHVRFDERDVETEYGPDNEAPADERAGNG* |
Ga0182019_101329751 | 3300014498 | Fen | NVSFFREPDAGNPPVRFDERDVKTGHGLASEAPANERAGNR* |
Ga0182024_100206751 | 3300014501 | Permafrost | VQEPDALAAHVRFDERDVKTEHGPDNEAPADERAGHR* |
Ga0137412_103958601 | 3300015242 | Vadose Zone Soil | SADRQLSVGDTVSLLREPDAGNPHVRFDERDVETEHGPASEAPADERAGNR* |
Ga0163144_103042761 | 3300015360 | Freshwater Microbial Mat | MALGKPDAGKPHVRFDEREVETEHGQASEAPADERAGNGYA* |
Ga0180009_103696232 | 3300015370 | Groundwater | REPDAGKPHVRFDERDVETEHGRAIEAPPDERGGNC* |
Ga0132257_1037274382 | 3300015373 | Arabidopsis Rhizosphere | MIPIEHILVREPDARKPPVRFDEREVETKHGWASEAL |
Ga0182040_118063901 | 3300016387 | Soil | REPDAGNPHVRFDEREVETEHGMASEAPVNERAGNG |
Ga0181505_103957622 | 3300016750 | Peatland | VREPDALVAHVRFDERDVETGHGLDNEAPADERAGHR |
Ga0187818_101720521 | 3300017823 | Freshwater Sediment | VGDNVSLLREPDAIVSPVRFDERDVETEHGSASEAPADERAGHG |
Ga0187781_100805221 | 3300017972 | Tropical Peatland | LVPKLDAGKPPVQFAERGVETEHGAASEAPAYERAGNR |
Ga0187810_101740091 | 3300018012 | Freshwater Sediment | EPDAVVPPVRFDERDVETEHGEASEALADERAGNG |
Ga0187890_106200402 | 3300018044 | Peatland | MEPIAFVVNDLGEPDAVNPPVRFDEREVETEHGDASEAPASESAGNR |
Ga0190275_133913961 | 3300018432 | Soil | KREGLIREPDAGNPPVRFDEREVETEHGEASEAPANERAGNR |
Ga0066662_113554431 | 3300018468 | Grasslands Soil | MINLVREPDAANPHVRFDEREVETEQGQASEAPADERAGNRWA |
Ga0194120_101429271 | 3300020198 | Freshwater Lake | MNDLVREPDAGKPHVRFDEGEVKTEHGEATGAPANERAGNRQRLAYPT |
Ga0194132_104248301 | 3300020214 | Freshwater Lake | VGERMNDLVREPDAGKPHVRFDEGEVKTEHGEATGAP |
Ga0194127_100638522 | 3300020221 | Freshwater Lake | MKGLLREPDAGKPPVRFDERDVEMEHGAAIEAPADERAGNR |
Ga0194056_102617591 | 3300021070 | Anoxic Zone Freshwater | EPDAVNPPVRFDEREVETEHGEASEALADERASNR |
Ga0194058_100072526 | 3300021071 | Anoxic Zone Freshwater | MNLVREPDAVNPPVRFDEREVETEHGEASEALADERASNR |
Ga0194058_100106311 | 3300021071 | Anoxic Zone Freshwater | TMNLVREPDAVNPPVRFDEREVETEHGEASEALADERASNR |
Ga0210393_105924561 | 3300021401 | Soil | VGERVSLLREPDAGDPPVRFDERDVETEQGEPSEAPADERAGNR |
Ga0210383_104487831 | 3300021407 | Soil | LSVGERVSLLREPDAGDPPVRFDERDVETEQGEPSEAPADERTGNR |
(restricted) Ga0224723_10438042 | 3300021517 | Freshwater Sediment | MNLLREPDAGNPHVRFDERDVETEQEQDTEAPATERAGNKLCLL |
Ga0126371_111101971 | 3300021560 | Tropical Forest Soil | LVREPDALNGPVRFDERGVETGHGGAIEAPATERAGNS |
Ga0242646_10129792 | 3300022502 | Soil | VGERVSLLREPDAGDPPVRFDERDVETEQGELSEAPADERAG |
Ga0242649_10022491 | 3300022509 | Soil | VGERVSLLREPDAGDPPVRFDERDVETEQGEPSEAPADERA |
Ga0242668_10335192 | 3300022529 | Soil | VGESVSLLREPDAGDPPVRFDERDVETEQGEPSEAPADE |
Ga0224557_12692572 | 3300023101 | Soil | MNLVREPDAVNPPVRFDEREVETEHGDASEAPASESAGH |
Ga0208562_11011852 | 3300025460 | Peatland | LREPDAGKPHVRFDERDVETEYGPDNEAPANERAGNG |
Ga0207699_100354854 | 3300025906 | Corn, Switchgrass And Miscanthus Rhizosphere | REPDALIAHVRFDERDVETEHGQASEAPATERAGNR |
Ga0209687_11126361 | 3300026322 | Soil | GESVSLLREPDAGDPPVRFDERDVETEQGEPSEAPADERAGNR |
Ga0209735_11269782 | 3300027562 | Forest Soil | VQPSVGDSMNHLVRKPDAGKPHVRFDEREVETEHGEASEAPADERAGNR |
Ga0209003_10654881 | 3300027576 | Forest Soil | REPDACNRPVRFDERDVETEHGPDSEAPAAERAGNR |
Ga0209528_10009938 | 3300027610 | Forest Soil | TFLREPEAGNPHIRFDERDVETEHGEAIETPADERAGNR |
Ga0209328_101675391 | 3300027727 | Forest Soil | VGDTVSLLREPDAVTPPVRFDERDVETEHGPASEAPADERAGTDRPHLNHR |
Ga0209536_1001478074 | 3300027917 | Marine Sediment | VQALRKNLVREPDAGNPHVRFDEREVETEHGWDNEAPTTERVGNR |
Ga0268265_100456024 | 3300028380 | Switchgrass Rhizosphere | MKRGKPDAGNLHVRFDERDVETGHGQDTEAPAIERVGNG |
Ga0302219_102218331 | 3300028747 | Palsa | VKSIGKPDAGNLHVRFDERDVETEQGDASEAPANERAGNR |
Ga0302218_102819652 | 3300028863 | Palsa | FLREPDALNAPVRFDERDVETEHGAAVEAPADERAGNR |
Ga0311361_108873371 | 3300029911 | Bog | VGESVSLLREPDAGDPPVRFDERDVETEQGEPSEA |
Ga0311338_117913641 | 3300030007 | Palsa | QLSVGESVSLLREPDAGNPPVRFDERDVETEQGELSEAPADERAGNR |
Ga0311353_110050142 | 3300030399 | Palsa | VGESVSLLREPDAGDPPVRFDERDVKTEHGLDNEA |
Ga0316363_102745211 | 3300030659 | Peatlands Soil | MMRLVREPDAAIPHVRFDEREVETASWDDTRAPATDRAGNMQGV |
Ga0170824_1202476642 | 3300031231 | Forest Soil | SVGESVSLLREPDAGDPPVRFDERDVETGQGELSEAPADERAGYR |
Ga0170824_1230566511 | 3300031231 | Forest Soil | FSADRQPSVGDTVSLLREPDAGNPPVRFDERDVETEHGWASEAPADQRAGNR |
Ga0265316_100743313 | 3300031344 | Rhizosphere | MNLLREPDAGDLHVRFDEREVETEHGQAREAPANERAGQRIGLT |
Ga0307374_100413777 | 3300031670 | Soil | MTLVREPDAGNPPVRFDEREVETEHGVANEAPADERAGAR |
Ga0307372_100682645 | 3300031671 | Soil | MTLVREPDAGNPPVRFDEREVETEHGVADEAPADERAGDR |
Ga0310917_107580301 | 3300031833 | Soil | VGDNVRLLREPDALVAPVRFDERDVETEQGPASEAP |
Ga0302315_107654482 | 3300031837 | Palsa | VSLLREPDAGDPPVRFDERDVETEQGEPSEAPADER |
Ga0318544_101267521 | 3300031880 | Soil | VGDSVSLLREPDAGNPPVRFDERDVETEHGEASEAPADKRAGNR |
Ga0306925_105313352 | 3300031890 | Soil | VREPDALNGPVRFDEREVETGQGRACLAPADERAGQRKGLA |
Ga0318551_102608112 | 3300031896 | Soil | RLVREPDAANLHVRFDERGVENGSYGRPSEAPPDERGGSR |
Ga0306921_120546512 | 3300031912 | Soil | EPDAGNPPVRFDERDVETEHGAASEAPANESAGNG |
Ga0306924_118713841 | 3300032076 | Soil | VGDNVRLLREPDALVAPVRFDERDVETEQGPASEAPAD |
Ga0306924_120174123 | 3300032076 | Soil | VDDTVSLLREPDAVVPPVRFDERDVETEHGPASEAPADERAGND |
Ga0315277_113980051 | 3300032118 | Sediment | VNIRNPGVGKPHVRFDERAVETGHGEAIETPTDERVGKQI |
Ga0311301_102919054 | 3300032160 | Peatlands Soil | MNTPGGDFDCQPSMDENVSLFREPDAGKPPVRFDERDVETEHGLASEAPADERAGNR |
Ga0315276_125283581 | 3300032177 | Sediment | SLVREPDAGNPPVRFDERDVETEHDRDIEAPATERVGNR |
Ga0306920_1021299181 | 3300032261 | Soil | SLLREPDAGNPPVRFDERDVETEQGEASEAPADKRAGNR |
Ga0335397_104602281 | 3300032420 | Freshwater | LLRVPVAGEPPVRFDERDVETEHGEAIEAPADERAGNR |
Ga0316230_11965161 | 3300032668 | Freshwater | MNLRREPDARDPHARFDARDVATEQGLAIEAPATE |
Ga0316630_105015871 | 3300033487 | Soil | REPDAGNPHVRFEERDVETEQGGAIEAPADERAGNR |
Ga0316628_1015229331 | 3300033513 | Soil | EGEPDAGNPHVRFEERDVETEQGGAIEAPADERAGNR |
Ga0334854_095032_4_126 | 3300033829 | Soil | MKSIGKPDAGNLHVRFDERDVETEQGDASEAPANERAGNR |
Ga0334790_032851_54_173 | 3300033887 | Soil | MSGGKPDAGNLHVRFDERDVETGYELDTEAPATERVGNG |
⦗Top⦘ |