NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome Family F081001

Metagenome Family F081001

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F081001
Family Type Metagenome
Number of Sequences 114
Average Sequence Length 49 residues
Representative Sequence AGRVAYEISSEKVKHRAERRAQNETFAPVPSFLQGHTSINTVSSGFLVA
Number of Associated Samples 78
Number of Associated Scaffolds 114

Quality Assessment
Transcriptomic Evidence No
Most common taxonomic group Bacteria
% of genes with valid RBS motifs 44.34 %
% of genes near scaffold ends (potentially truncated) 63.16 %
% of genes from short scaffolds (< 2000 bps) 81.58 %
Associated GOLD sequencing projects 76
AlphaFold2 3D model prediction Yes
3D model pTM-score0.20

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Bacteria (83.333 % of family members)
NCBI Taxonomy ID 2
Taxonomy All Organisms → cellular organisms → Bacteria

Most Common Ecosystem
GOLD Ecosystem Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment
(29.825 % of family members)
Environment Ontology (ENVO) Unclassified
(37.719 % of family members)
Earth Microbiome Project Ontology (EMPO) Free-living → Non-saline → Subsurface (non-saline)
(66.667 % of family members)


 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      

 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Globular Signal Peptide: No Secondary Structure distribution: α-helix: 31.17%    β-sheet: 0.00%    Coil/Unstructured: 68.83%
Feature Viewer
Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer
Per-residue confidence (pLDDT):
  0-50   51-70   71-90   91-100  		pTM-score: 0.20
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.

 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 114 Family Scaffolds
PF09084NMT1 7.89
PF00005ABC_tran 4.39
PF02515CoA_transf_3 3.51
PF14518Haem_oxygenas_2 2.63
PF03745DUF309 2.63
PF00106adh_short 1.75
PF13720Acetyltransf_11 1.75
PF00080Sod_Cu 1.75
PF02784Orn_Arg_deC_N 1.75
PF00296Bac_luciferase 1.75
PF00483NTP_transferase 1.75
PF13343SBP_bac_6 1.75
PF06240COXG 1.75
PF01070FMN_dh 0.88
PF00245Alk_phosphatase 0.88
PF10431ClpB_D2-small 0.88
PF13544Obsolete Pfam Family 0.88
PF05157T2SSE_N 0.88
PF01047MarR 0.88
PF03450CO_deh_flav_C 0.88
PF13419HAD_2 0.88
PF14520HHH_5 0.88
PF05402PqqD 0.88
PF00861Ribosomal_L18p 0.88
PF00364Biotin_lipoyl 0.88
PF11146DUF2905 0.88
PF00472RF-1 0.88
PF13432TPR_16 0.88
PF14698ASL_C2 0.88
PF04767Pox_F17 0.88
PF05683Fumerase_C 0.88
PF17167Glyco_hydro_36 0.88
PF05977MFS_3 0.88
PF13472Lipase_GDSL_2 0.88
PF00903Glyoxalase 0.88
PF01042Ribonuc_L-PSP 0.88
PF00892EamA 0.88
PF01636APH 0.88
PF05258DciA 0.88
PF02771Acyl-CoA_dh_N 0.88
PF00255GSHPx 0.88
PF00596Aldolase_II 0.88
PF16868NMT1_3 0.88
PF02397Bac_transf 0.88
PF00557Peptidase_M24 0.88
PF02954HTH_8 0.88
PF01909NTP_transf_2 0.88
PF01595CNNM 0.88
PF00355Rieske 0.88
PF01169UPF0016 0.88
PF00528BPD_transp_1 0.88
PF07332Phage_holin_3_6 0.88
PF01408GFO_IDH_MocA 0.88
PF13414TPR_11 0.88
PF06500FrsA-like 0.88
PF01479S4 0.88
PF02824TGS 0.88
PF06745ATPase 0.88
PF01632Ribosomal_L35p 0.88
PF13751DDE_Tnp_1_6 0.88
PF12911OppC_N 0.88
PF08802Obsolete Pfam Family 0.88
PF07883Cupin_2 0.88
PF07726AAA_3 0.88
PF01977UbiD 0.88

Neighboring Clusters of Orthologous Genes (COGs)

COG IDNameFunctional Category % Frequency in 114 Family Scaffolds
COG0715ABC-type nitrate/sulfonate/bicarbonate transport system, periplasmic componentInorganic ion transport and metabolism [P] 7.89
COG4521ABC-type taurine transport system, periplasmic componentInorganic ion transport and metabolism [P] 7.89
COG1804Crotonobetainyl-CoA:carnitine CoA-transferase CaiB and related acyl-CoA transferasesLipid transport and metabolism [I] 3.51
COG1547Predicted metal-dependent hydrolaseFunction unknown [S] 2.63
COG0019Diaminopimelate decarboxylaseAmino acid transport and metabolism [E] 1.75
COG1166Arginine decarboxylase (spermidine biosynthesis)Amino acid transport and metabolism [E] 1.75
COG2032Cu/Zn superoxide dismutaseInorganic ion transport and metabolism [P] 1.75
COG2141Flavin-dependent oxidoreductase, luciferase family (includes alkanesulfonate monooxygenase SsuD and methylene tetrahydromethanopterin reductase)Coenzyme transport and metabolism [H] 1.75
COG3427Carbon monoxide dehydrogenase subunit CoxGEnergy production and conversion [C] 1.75
COG00433-polyprenyl-4-hydroxybenzoate decarboxylaseCoenzyme transport and metabolism [H] 0.88
COG0069Glutamate synthase domain 2Amino acid transport and metabolism [E] 0.88
COG0216Protein chain release factor RF1Translation, ribosomal structure and biogenesis [J] 0.88
COG0251Enamine deaminase RidA/Endoribonuclease Rid7C, YjgF/YER057c/UK114 familyDefense mechanisms [V] 0.88
COG0256Ribosomal protein L18Translation, ribosomal structure and biogenesis [J] 0.88
COG0291Ribosomal protein L35Translation, ribosomal structure and biogenesis [J] 0.88
COG0386Thioredoxin/glutathione peroxidase BtuE, reduces lipid peroxidesDefense mechanisms [V] 0.88
COG1186Protein chain release factor PrfBTranslation, ribosomal structure and biogenesis [J] 0.88
COG1304FMN-dependent dehydrogenase, includes L-lactate dehydrogenase and type II isopentenyl diphosphate isomeraseEnergy production and conversion [C] 0.88
COG1785Alkaline phosphataseInorganic ion transport and metabolism [P] 0.88
COG1838Tartrate dehydratase beta subunit/Fumarate hydratase class I, C-terminal domainEnergy production and conversion [C] 0.88
COG1960Acyl-CoA dehydrogenase related to the alkylation response protein AidBLipid transport and metabolism [I] 0.88
COG2119Putative Ca2+/H+ antiporter, TMEM165/GDT1 familyGeneral function prediction only [R] 0.88
COG2148Sugar transferase involved in LPS biosynthesis (colanic, teichoic acid)Cell wall/membrane/envelope biogenesis [M] 0.88
COG2814Predicted arabinose efflux permease AraJ, MFS familyCarbohydrate transport and metabolism [G] 0.88
COG5512Predicted nucleic acid-binding protein, contains Zn-ribbon domain (includes truncated derivatives)General function prediction only [R] 0.88

 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms83.33 %
UnclassifiedrootN/A16.67 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
3300002104|C687J26621_10152081Not Available707Open in IMG/M
3300004022|Ga0055432_10188260All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium589Open in IMG/M
3300004062|Ga0055500_10030588All Organisms → cellular organisms → Bacteria1006Open in IMG/M
3300005183|Ga0068993_10282018All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium596Open in IMG/M
3300005295|Ga0065707_10001087All Organisms → cellular organisms → Bacteria → Proteobacteria10668Open in IMG/M
3300005295|Ga0065707_10146360All Organisms → cellular organisms → Bacteria1709Open in IMG/M
3300005345|Ga0070692_11248519All Organisms → cellular organisms → Bacteria531Open in IMG/M
3300005353|Ga0070669_100858258All Organisms → cellular organisms → Bacteria774Open in IMG/M
3300005438|Ga0070701_11391313All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium504Open in IMG/M
3300005444|Ga0070694_100275038All Organisms → cellular organisms → Bacteria → Proteobacteria1282Open in IMG/M
3300005518|Ga0070699_101647369All Organisms → cellular organisms → Bacteria588Open in IMG/M
3300005543|Ga0070672_100929224All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium769Open in IMG/M
3300006847|Ga0075431_100940402All Organisms → cellular organisms → Bacteria833Open in IMG/M
3300006847|Ga0075431_101411726All Organisms → cellular organisms → Bacteria656Open in IMG/M
3300006852|Ga0075433_11785907All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium529Open in IMG/M
3300006876|Ga0079217_10013893All Organisms → cellular organisms → Bacteria2677Open in IMG/M
3300007004|Ga0079218_10179886All Organisms → cellular organisms → Bacteria1586Open in IMG/M
3300009100|Ga0075418_11437589All Organisms → cellular organisms → Bacteria → Nitrospirae → Nitrospira → Nitrospirales → Nitrospiraceae → Nitrospira → unclassified Nitrospira → Nitrospira sp.748Open in IMG/M
3300009609|Ga0105347_1176180All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium848Open in IMG/M
3300010391|Ga0136847_12758553All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria1112Open in IMG/M
3300010391|Ga0136847_13420459All Organisms → cellular organisms → Bacteria620Open in IMG/M
3300011410|Ga0137440_1093574All Organisms → cellular organisms → Bacteria608Open in IMG/M
3300011419|Ga0137446_1046646All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium960Open in IMG/M
3300011423|Ga0137436_1194797All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium534Open in IMG/M
3300011427|Ga0137448_1002465Not Available3236Open in IMG/M
3300011427|Ga0137448_1011042All Organisms → cellular organisms → Bacteria1918Open in IMG/M
3300011427|Ga0137448_1020103All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria1529Open in IMG/M
3300011427|Ga0137448_1091360All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium815Open in IMG/M
3300011427|Ga0137448_1239448All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium502Open in IMG/M
3300011436|Ga0137458_1143608All Organisms → cellular organisms → Bacteria710Open in IMG/M
3300012034|Ga0137453_1078325All Organisms → cellular organisms → Bacteria638Open in IMG/M
3300012035|Ga0137445_1123636All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium528Open in IMG/M
3300012040|Ga0137461_1000009All Organisms → cellular organisms → Bacteria35929Open in IMG/M
3300012040|Ga0137461_1000523All Organisms → cellular organisms → Bacteria → Proteobacteria8304Open in IMG/M
3300012040|Ga0137461_1000889All Organisms → cellular organisms → Bacteria → Proteobacteria6185Open in IMG/M
3300012040|Ga0137461_1173097All Organisms → cellular organisms → Bacteria637Open in IMG/M
3300012041|Ga0137430_1129142All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium723Open in IMG/M
3300012133|Ga0137329_1044703All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria574Open in IMG/M
3300012146|Ga0137322_1027946All Organisms → cellular organisms → Bacteria801Open in IMG/M
3300012172|Ga0137320_1016833All Organisms → cellular organisms → Bacteria1438Open in IMG/M
3300012179|Ga0137334_1082909Not Available711Open in IMG/M
3300012226|Ga0137447_1133673All Organisms → cellular organisms → Bacteria506Open in IMG/M
3300012228|Ga0137459_1104380All Organisms → cellular organisms → Bacteria824Open in IMG/M
3300012232|Ga0137435_1024226All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria1743Open in IMG/M
3300012350|Ga0137372_10031455All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia4859Open in IMG/M
3300013297|Ga0157378_11146089All Organisms → cellular organisms → Bacteria816Open in IMG/M
3300014873|Ga0180066_1055312All Organisms → cellular organisms → Bacteria789Open in IMG/M
3300014878|Ga0180065_1166657All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium507Open in IMG/M
3300015251|Ga0180070_1069007All Organisms → cellular organisms → Bacteria502Open in IMG/M
3300015371|Ga0132258_12440436All Organisms → cellular organisms → Bacteria1309Open in IMG/M
3300018028|Ga0184608_10532807All Organisms → cellular organisms → Bacteria501Open in IMG/M
3300018031|Ga0184634_10218912All Organisms → cellular organisms → Bacteria869Open in IMG/M
3300018031|Ga0184634_10279985All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfuromonadales765Open in IMG/M
3300018053|Ga0184626_10002260All Organisms → cellular organisms → Bacteria → Proteobacteria6998Open in IMG/M
3300018053|Ga0184626_10013642All Organisms → cellular organisms → Bacteria3216Open in IMG/M
3300018053|Ga0184626_10021533All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium2620Open in IMG/M
3300018053|Ga0184626_10126092Not Available1088Open in IMG/M
3300018053|Ga0184626_10133800All Organisms → cellular organisms → Bacteria1054Open in IMG/M
3300018056|Ga0184623_10085906All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium1450Open in IMG/M
3300018056|Ga0184623_10142352All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium1108Open in IMG/M
3300018056|Ga0184623_10161619All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium1034Open in IMG/M
3300018056|Ga0184623_10184626All Organisms → cellular organisms → Bacteria961Open in IMG/M
3300018056|Ga0184623_10267202All Organisms → cellular organisms → Bacteria778Open in IMG/M
3300018063|Ga0184637_10019552All Organisms → cellular organisms → Bacteria4077Open in IMG/M
3300018063|Ga0184637_10038759All Organisms → cellular organisms → Bacteria → Proteobacteria2893Open in IMG/M
3300018063|Ga0184637_10300425All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium972Open in IMG/M
3300018063|Ga0184637_10582581All Organisms → cellular organisms → Bacteria637Open in IMG/M
3300018063|Ga0184637_10794444All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria505Open in IMG/M
3300018071|Ga0184618_10133887All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium1001Open in IMG/M
3300018074|Ga0184640_10548212All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium505Open in IMG/M
3300018076|Ga0184609_10550460All Organisms → cellular organisms → Bacteria521Open in IMG/M
3300018077|Ga0184633_10365088All Organisms → cellular organisms → Bacteria726Open in IMG/M
3300018078|Ga0184612_10193443All Organisms → cellular organisms → Bacteria1058Open in IMG/M
3300018078|Ga0184612_10405495All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium684Open in IMG/M
3300018078|Ga0184612_10483045All Organisms → cellular organisms → Bacteria609Open in IMG/M
3300018079|Ga0184627_10300494All Organisms → cellular organisms → Bacteria842Open in IMG/M
3300018082|Ga0184639_10068064All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria1856Open in IMG/M
3300018082|Ga0184639_10134446All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria1312Open in IMG/M
3300018084|Ga0184629_10113145All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1342Open in IMG/M
3300018084|Ga0184629_10209083All Organisms → cellular organisms → Bacteria1010Open in IMG/M
3300018084|Ga0184629_10315775All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria822Open in IMG/M
3300018084|Ga0184629_10559617All Organisms → cellular organisms → Bacteria588Open in IMG/M
3300020003|Ga0193739_1150954All Organisms → cellular organisms → Bacteria556Open in IMG/M
3300021051|Ga0206224_1011191All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium995Open in IMG/M
3300021051|Ga0206224_1066051All Organisms → cellular organisms → Bacteria505Open in IMG/M
3300021063|Ga0206227_1108236All Organisms → cellular organisms → Bacteria → Nitrospinae/Tectomicrobia group → Nitrospinae → unclassified Nitrospinota → Nitrospinae bacterium SCGC AAA008-D05552Open in IMG/M
3300021081|Ga0210379_10145727Not Available1005Open in IMG/M
3300025160|Ga0209109_10036487All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria2642Open in IMG/M
3300025289|Ga0209002_10093254All Organisms → cellular organisms → Bacteria → Proteobacteria1994Open in IMG/M
3300025313|Ga0209431_10327055All Organisms → cellular organisms → Bacteria1195Open in IMG/M
3300025314|Ga0209323_10481162Not Available729Open in IMG/M
3300025322|Ga0209641_10127783All Organisms → cellular organisms → Bacteria1937Open in IMG/M
3300025322|Ga0209641_10379270Not Available1024Open in IMG/M
3300025322|Ga0209641_10392144All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium1003Open in IMG/M
3300025535|Ga0207423_1067131All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium642Open in IMG/M
3300025580|Ga0210138_1037354All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium1088Open in IMG/M
3300027815|Ga0209726_10299606Not Available786Open in IMG/M
3300027909|Ga0209382_11626446Not Available637Open in IMG/M
3300028803|Ga0307281_10064040All Organisms → cellular organisms → Bacteria1181Open in IMG/M
3300030006|Ga0299907_10207750All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium1615Open in IMG/M
3300031943|Ga0310885_10874392All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium514Open in IMG/M
3300031965|Ga0326597_10566919All Organisms → cellular organisms → Bacteria1222Open in IMG/M
3300032180|Ga0307471_102497788All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Pseudomonadales → Pseudomonadaceae → Pseudomonas → Pseudomonas syringae group654Open in IMG/M
3300034165|Ga0364942_0203887Not Available646Open in IMG/M
3300034178|Ga0364934_0305064All Organisms → cellular organisms → Bacteria603Open in IMG/M
3300034178|Ga0364934_0417498Not Available508Open in IMG/M


 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
Groundwater SedimentEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment29.82%
SoilEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Soil24.56%
Populus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere5.26%
Natural And Restored WetlandsEnvironmental → Aquatic → Marine → Wetlands → Unclassified → Natural And Restored Wetlands4.39%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil3.51%
Corn, Switchgrass And Miscanthus RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere3.51%
SoilEnvironmental → Terrestrial → Soil → Loam → Unclassified → Soil3.51%
SedimentEnvironmental → Terrestrial → Floodplain → Sediment → Unclassified → Sediment3.51%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil2.63%
Switchgrass RhizosphereEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Switchgrass Rhizosphere2.63%
Deep Subsurface SedimentEnvironmental → Terrestrial → Deep Subsurface → Unclassified → Unclassified → Deep Subsurface Sediment2.63%
Freshwater SedimentEnvironmental → Aquatic → Freshwater → Lake → Sediment → Freshwater Sediment1.75%
Agricultural SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil1.75%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural → Soil1.75%
Groundwater SedimentEnvironmental → Aquatic → Freshwater → Sediment → Unclassified → Groundwater Sediment0.88%
GroundwaterEnvironmental → Aquatic → Freshwater → Groundwater → Unclassified → Groundwater0.88%
GroundwaterEnvironmental → Aquatic → Freshwater → Groundwater → Contaminated → Groundwater0.88%
Vadose Zone SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil0.88%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Soil0.88%
Hardwood Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil0.88%
Arabidopsis RhizosphereHost-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere0.88%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere0.88%
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere0.88%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Miscanthus Rhizosphere0.88%

Visualization
Powered by ApexCharts



Associated Samples

Taxon OIDSample NameHabitat TypeIMG/M Link
3300000956Soil microbial communities from Great Prairies - Kansas, Native Prairie soilEnvironmentalOpen in IMG/M
3300002104Groundwater microbial communities from Rifle, Colorado - Rifle CSP2_plank lowO2_0.2EnvironmentalOpen in IMG/M
3300004022Wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - Browns_ThreeSqA_D1EnvironmentalOpen in IMG/M
3300004062Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - Sandmound_ThreeSqA_D2EnvironmentalOpen in IMG/M
3300005183Wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - Browns_ThreeSqC_D1EnvironmentalOpen in IMG/M
3300005294Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 Bulk SoilEnvironmentalOpen in IMG/M
3300005295Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3EnvironmentalOpen in IMG/M
3300005345Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaGEnvironmentalOpen in IMG/M
3300005353Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaGHost-AssociatedOpen in IMG/M
3300005438Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaGEnvironmentalOpen in IMG/M
3300005444Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaGEnvironmentalOpen in IMG/M
3300005518Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaGEnvironmentalOpen in IMG/M
3300005543Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaGHost-AssociatedOpen in IMG/M
3300006847Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5Host-AssociatedOpen in IMG/M
3300006852Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2Host-AssociatedOpen in IMG/M
3300006876Agricultural soil microbial communities from Utah to study Nitrogen management - NC AS200EnvironmentalOpen in IMG/M
3300007004Agricultural soil microbial communities from Utah to study Nitrogen management - NC CompostEnvironmentalOpen in IMG/M
3300009100Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD2Host-AssociatedOpen in IMG/M
3300009162Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD2Host-AssociatedOpen in IMG/M
3300009609Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMLT890EnvironmentalOpen in IMG/M
3300010391Freshwater sediment microbial communities from Lake Superior, USA - Station SU-17. Combined Assembly of Gp0155404, Gp0155335, Gp0155336, Gp0155336, Gp0155403, Gp0155406EnvironmentalOpen in IMG/M
3300011410Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMGT222_2EnvironmentalOpen in IMG/M
3300011419Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMGT357_2EnvironmentalOpen in IMG/M
3300011423Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMGT119_2EnvironmentalOpen in IMG/M
3300011427Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMGT418_2EnvironmentalOpen in IMG/M
3300011436Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMGT642_2EnvironmentalOpen in IMG/M
3300012034Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMGT526_2EnvironmentalOpen in IMG/M
3300012035Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMGT338_2EnvironmentalOpen in IMG/M
3300012040Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMGT746_2EnvironmentalOpen in IMG/M
3300012041Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMZT754_2EnvironmentalOpen in IMG/M
3300012133Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMLT121_2EnvironmentalOpen in IMG/M
3300012134Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMLT142_2EnvironmentalOpen in IMG/M
3300012146Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMZT400_2EnvironmentalOpen in IMG/M
3300012172Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMZT366_2EnvironmentalOpen in IMG/M
3300012179Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMLT262_2EnvironmentalOpen in IMG/M
3300012226Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMGT400_2EnvironmentalOpen in IMG/M
3300012228Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMGT700_2EnvironmentalOpen in IMG/M
3300012232Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMGT100_2EnvironmentalOpen in IMG/M
3300012350Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_60_16 metaGEnvironmentalOpen in IMG/M
3300013297Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaGHost-AssociatedOpen in IMG/M
3300014873Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River metaG ERMLT200B_16_10DEnvironmentalOpen in IMG/M
3300014878Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River metaG ERMLT200A_16_10DEnvironmentalOpen in IMG/M
3300015251Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River metaG ERMLT293_16_10DEnvironmentalOpen in IMG/M
3300015371Combined assembly of cpr5 and col0 rhizosphere and soilHost-AssociatedOpen in IMG/M
3300018028Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_30_coexEnvironmentalOpen in IMG/M
3300018031Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3-1_200_b1EnvironmentalOpen in IMG/M
3300018053Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3_60_b1EnvironmentalOpen in IMG/M
3300018056Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_100_b1EnvironmentalOpen in IMG/M
3300018063Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3_127_b2EnvironmentalOpen in IMG/M
3300018071Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM0_30_b1EnvironmentalOpen in IMG/M
3300018074Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3-1_200_b2EnvironmentalOpen in IMG/M
3300018076Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_60_coexEnvironmentalOpen in IMG/M
3300018077Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3-1_170_b1EnvironmentalOpen in IMG/M
3300018078Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3_60_coexEnvironmentalOpen in IMG/M
3300018079Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3_127_b1EnvironmentalOpen in IMG/M
3300018082Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3-1_170_b2EnvironmentalOpen in IMG/M
3300018084Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM4_32_b1EnvironmentalOpen in IMG/M
3300020003Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? L2a2EnvironmentalOpen in IMG/M
3300021051Subsurface sediment microbial communities from Mancos shale, Colorado, United States - Mancos A1EnvironmentalOpen in IMG/M
3300021063Subsurface sediment microbial communities from Mancos shale, Colorado, United States - Mancos D4EnvironmentalOpen in IMG/M
3300021081Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM4_32_coex redoEnvironmentalOpen in IMG/M
3300025160Soil microbial communities from Rifle, Colorado, USA - sediment 10ft 2EnvironmentalOpen in IMG/M
3300025289Soil microbial communities from Rifle, Colorado, USA - sediment 16ft 2EnvironmentalOpen in IMG/M
3300025313Soil microbial communities from Rifle, Colorado - Rifle CSP2_sed 13_3 (SPAdes)EnvironmentalOpen in IMG/M
3300025314Soil microbial communities from Rifle, Colorado, USA - sediment 19ft 2EnvironmentalOpen in IMG/M
3300025322Soil microbial communities from Rifle, Colorado - Rifle CSP2_sed 16_1 (SPAdes)EnvironmentalOpen in IMG/M
3300025535Wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - Browns_ThreeSqA_D1 (SPAdes)EnvironmentalOpen in IMG/M
3300025580Wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - Browns_ThreeSqC_D1 (SPAdes)EnvironmentalOpen in IMG/M
3300027815Subsurface groundwater microbial communities from S. Glens Falls, New York, USA - GMW46 contaminated, 5.4 m (SPAdes)EnvironmentalOpen in IMG/M
3300027909Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD5 (SPAdes)Host-AssociatedOpen in IMG/M
3300028803Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_120EnvironmentalOpen in IMG/M
3300030006Soil microbial communities from uranium-contaminated site in the Upper Colorado River Basin, Wyoming, United States - RVT152D67EnvironmentalOpen in IMG/M
3300031847Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C48D4EnvironmentalOpen in IMG/M
3300031943Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T60D2EnvironmentalOpen in IMG/M
3300031965Soil microbial communities from uranium-contaminated site in the Upper Colorado River Basin, Wyoming, United States - RVT100D185EnvironmentalOpen in IMG/M
3300032180Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_515EnvironmentalOpen in IMG/M
3300034165Sediment microbial communities from East River floodplain, Colorado, United States - 19_s17EnvironmentalOpen in IMG/M
3300034178Sediment microbial communities from East River floodplain, Colorado, United States - 27_j17EnvironmentalOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap


 ⦗Top⦘

Family Sequences

Protein ID Sample Taxon ID Habitat Sequence
JGI10216J12902_10760208923300000956SoilTLPERRQSSCALKMPAGQVACENSSEKVKHRAEPRAQNETFALVPSLLQGHTAIDRVSSGSVVACYE*
C687J26621_1015208113300002104GroundwaterAYEISSEKVKHRAERRAQNETFAPMPSFLQGHTSINKVSSGFLVA*
Ga0055432_1018826023300004022Natural And Restored WetlandsMQAGLIAYEISSEKVKHRAERQAQNETFAPVPSFLQGHTSI
Ga0055500_1003058813300004062Natural And Restored WetlandsAEQVGYAISSEKFEHRAERQAQNEIFASMPSYLQGHTPIDGVSSGFHVT*
Ga0068993_1028201823300005183Natural And Restored WetlandsMQAGLIAYEISSEKVKHRAERQAQNETFAPVPSFLQGHTSIDALS*
Ga0065705_1011131323300005294Switchgrass RhizosphereMAKQRCVEDASGRVAHEGSSEKVKHRAGRRDPFEIFAPVPSFLQGHDPINRLLSDFLVAVA*
Ga0065707_1000108793300005295Switchgrass RhizosphereMQAGQSAREVRSEKVRQRAERREQNKTFAPVPSFLQGHTSIDRVPSSFLVA*
Ga0065707_1014636023300005295Switchgrass RhizosphereMPAGRVAHEISSEKVAHRAERRAQKETFALVPSFLQSYTSMAALK*
Ga0070692_1124851923300005345Corn, Switchgrass And Miscanthus RhizosphereEAASAAAAYESSSGKVKHRAKRRAQNQIFALVPSFLQGHTPID*
Ga0070669_10085825813300005353Switchgrass RhizosphereTYNPSGTKGSEMVKHRAECRAQNEKLALVPWFLPDHTSITRVSPDFLVA*
Ga0070701_1139131323300005438Corn, Switchgrass And Miscanthus RhizosphereELFKVRSEKVKHRVERREQNETFAPVPSFLQGHTSIDTLS*
Ga0070694_10027503813300005444Corn, Switchgrass And Miscanthus RhizosphereLCLEDASGQAAYEISSEKVKHRAKRRAQNKTFALVPLFLQDHTSINRVSSGFL
Ga0070699_10164736923300005518Corn, Switchgrass And Miscanthus RhizosphereKTPAGQVASEISSAKVKHRAERRAQNETSALVPSSLQGHAAIDALY*
Ga0070672_10092922423300005543Miscanthus RhizosphereVDRVAYEGTSEKFQHRAERRIQNETLAPVPSFLQGHTSINAV*
Ga0075431_10094040223300006847Populus RhizosphereMPAERVAYEIGSEKVKHRPEHRKQNETFAPVPSFLQSYTSINKVSSGFLLA*
Ga0075431_10141172613300006847Populus RhizosphereLKTPAGQVDYEISTEKINHLAERRAQNETFAPVPSFLQGH
Ga0075433_1178590723300006852Populus RhizosphereLKVHAQNLSTEISSEKVKHRTECSAQNEIFAPVPSFLQGRTSIYKVLSGFLVA*
Ga0079217_1001389313300006876Agricultural SoilMMPGEELLEMSSEKVKHRAEHRAYDETFAPMPSFLQDHTSIDRMLSFFLVA*
Ga0079218_1017988623300007004Agricultural SoilMPARREAYEISSEKIKDGAERRAQNEIFAPLPSFLQGHTSIDTAS*
Ga0075418_1143758923300009100Populus RhizosphereMPARQIACEIGSEKVKHRAERRAQNETFALVPSFLQGHTAIGALY*
Ga0075423_1248546813300009162Populus RhizosphereISFENVKQPTERRAQNEIFAPLPSFLQGHSSVDTELSGFFVA*
Ga0105347_117618023300009609SoilMYARRVAHEISSAKVKHRAELGAQNETFAPLPSFLQDHTSINTD*
Ga0136847_1275855323300010391Freshwater SedimentISSEKVKHRAERRAQNETLAPVPSFDVLVLWGHTSINKVSSGFLAP*
Ga0136847_1342045923300010391Freshwater SedimentEISSEKVKHRAQRRTQNKTFALVPSFDVLVLCGRTSIESVSSGFLVA*
Ga0137440_109357413300011410SoilLPERRQSSCAFKLQARRVAYEISCEKVKHRAERRAQNQTFAPVPSFLQGHTSIWRVYQFSSAHE*
Ga0137446_104664613300011419SoilRRQSSCALKMQAGRVGYEISGKKVNHRAERRAQTETFAPVPSFLQGHTSIDTVSSGFLVA
Ga0137436_119479713300011423SoilAAGRVAYATTSEEFKRRAECRAQHETFALVPSFLQGHASIDTLSFVFLVA*
Ga0137448_100246543300011427SoilMKAGRVGYEISSEKVKHRAECRAQNETFAPVPSFLQGHTSINTVSSGFLVAMNN
Ga0137448_101104233300011427SoilMHAGRVAYEISSEKVKHRAERRAQNETIAPVPSFLQGHTSINILSSGFLVA*
Ga0137448_102010313300011427SoilMQAERVGYEISGEKVKHRAERRAQNETFALVPSLLQGHTSIDRVSRVFLEA*
Ga0137448_109136023300011427SoilYEISSEKVKHRAERRAQNETFAPVPSFLQGHTSINTASSGFS*
Ga0137448_123944813300011427SoilMQAGRVGYEVSSEKVKHRAEHRAQNQTFALVPSFLRGRASIDSVSSGFL
Ga0137458_114360813300011436SoilMQAGRVAYEISREKVKHRAERGDQYESLAPVPSFDGLVLLGHTSINRVSSGFL
Ga0137453_107832523300012034SoilQSSCALKMQAEQVSYEITGETVKHRAERRAQNETFALVPSLLQGHTSINRAW*
Ga0137445_112363623300012035SoilMHAGRVAYEISSEKVKHRAERRAQNETIAPVPSFLQGHTSINTLSSGF
Ga0137461_1000009203300012040SoilMQSSCALKMQARRVAYEISSEKVKHRAERRAQNETFAPVPSFLQGHTSINTVSSGFLVA*
Ga0137461_100052333300012040SoilMHAGRVAYEISSEKVKHRAERRAQNETIAPVPSFLQGHTSINTLSSGFLVA*
Ga0137461_100088963300012040SoilMQAERVGYEISGEKVKHRAERRAQNETFALVPSLLQGHTSINTVSSGFLVAMNNPGQNSIAGRSID*
Ga0137461_117309713300012040SoilTTCEKIKHRAERRAGNETFALVPSLLQGHTSIDRVSRVFLVA*
Ga0137430_112914223300012041SoilAGQVAYEISSEKVKRRAECRAQNETFAPVPSFLQGHTSIDRVSSGFLLA*
Ga0137329_104470323300012133SoilGRVAYEISSEKVKHRAEHRAQNQTFALVPSFLQGHTSIDSASSGFLVA*
Ga0137330_105042023300012134SoilVAHEISSEKVKHRTDCQAQYETFALVPSFLQGNTPIDTLP*
Ga0137322_102794613300012146SoilMQAQQVSYEITGETVKHRAERRAQNETFALVPSLLQGHTSINRAW*
Ga0137320_101683313300012172SoilMQAGQVADEISSEKVKPRAEWRAQNETFEPVPSSLQGHTS
Ga0137334_108290923300012179SoilPKRRQSRCALKMHAGRIAYEISSEKVKPCTERRAQNETFAPLPSFLQGHTSIDTLSSVLLVA*
Ga0137447_113367313300012226SoilISSEKVKHRAERRARNETFVLVPSFLQGHTSINTVSSGFLVA*
Ga0137459_110438023300012228SoilGQVAYEISSKKVDHRAERRAQNETFALVPSFLQGHTSINRVSSGFLRA*
Ga0137435_102422653300012232SoilCFEITSEKVKRRAGCQAQNETFAPVPSFDVFVLWGHTSIDRVSSGFLVA*
Ga0137372_1003145543300012350Vadose Zone SoilMPARRVVYEISSEKVKDCAERRTQNETFAPLPSFLQGHTSIDRAS*
Ga0157378_1114608923300013297Miscanthus RhizosphereRTQSCFALKLQAGQVACEISGEKFKHRAECWTQNETFAPVPSFHQGRTSINTVS*
Ga0180066_105531213300014873SoilMPAGQVAYEISSEKIKHRGECRAQNEIFAPVPSFLQGHTSIDSVISSPRS
Ga0180065_116665713300014878SoilMQAGRVAYEISSEKVKHRAERRAQNETFASVPSFFQGHASIKRVSSGILVASIVQAY
Ga0180070_106900723300015251SoilYEISSEKVKHRAERRAQNEIFAPVPSFLQGRTSINRVSSGFLVA*
Ga0132258_1244043613300015371Arabidopsis RhizosphereMPAGQVACAISSEKVKHRAERRAQNETFAPVPSFLQGDAAIDRMSSGFVAP*
Ga0184608_1027125913300018028Groundwater SedimentISCEKVKHRAERPAQNETFAPLPSFLQGHASIDTVLSGFLVA
Ga0184608_1053280713300018028Groundwater SedimentMQARRVADEISSEKVKHRAERRAQNETFAPVPSFLQGYTSINRVSSG
Ga0184634_1021891213300018031Groundwater SedimentSSCALKMPAGQVAYEISSEKVKHRAERRAQNETFAPMPSFLQGHTSIDRASSGFLVA
Ga0184634_1027998533300018031Groundwater SedimentMQARRVAYDNSSEKVKHRAERRAQNETFAPVPSFLQGCTSINRVSPGFLAAMNNPG
Ga0184634_1037478823300018031Groundwater SedimentSEKVKHRAERRAQNETFAPLPSFLQGHTSIDRASSGFFVHE
Ga0184626_1000226063300018053Groundwater SedimentMQAKQVSYEITGEKVKHRAERRAQNETFAPVPSFLQGHTSINTLSSVLLVV
Ga0184626_1001364233300018053Groundwater SedimentMQAGQVSYEITGEKVKHRAEGRAQYETFELVPSLLQGHTSIDRVSRVFLEA
Ga0184626_1002153323300018053Groundwater SedimentMHAGRVANEIGSEKIKHRAERRAQNETFTPVPSFDVLVLWGHTSINRVSSGFLVA
Ga0184626_1012609223300018053Groundwater SedimentALKMHVGRVAYEISSEKVKHRAERRAPNETFAPVPSFLQGHTSINKVSSGFLVA
Ga0184626_1013380013300018053Groundwater SedimentMHARRVAYEISSEKVKHRAERRAQNETFAPVPSFLQGRTSINSVSSVFLVA
Ga0184623_1008590623300018056Groundwater SedimentMHAGRVANEIGSEKTKHRAERRAQNETFTPVPSFDVLVLWGHTSIN
Ga0184623_1014235213300018056Groundwater SedimentAGRVAYEISSEKVKHRAERRAQNETFAPVPSFLQGHTSINTVSSGFLVA
Ga0184623_1016161913300018056Groundwater SedimentLKVQARRVAYEISSEKVKHRAARRAQNETFAPVPSFGALVLWGRTSINR
Ga0184623_1018462623300018056Groundwater SedimentHAARVANGISSEKVKHRAKRRAQNETVAPVPSFDVLVLWGHTSINSVSSGFLVA
Ga0184623_1026720223300018056Groundwater SedimentMQARRVADEISSEKVKHRAERRAQNETFAPVPSFFQAHTSITKVSSGFLVA
Ga0184637_1001955263300018063Groundwater SedimentMQAGQISYEITGEKVIHRAERRAQNETFALVPSLLQGNTSIDRVS
Ga0184637_1003875943300018063Groundwater SedimentGRVAYEISSEKVKHRAERRAQNETFAPVPSFLQGHTSINRVSSGFLVA
Ga0184637_1030042513300018063Groundwater SedimentMHAARVANGISSEKVKHRAKRRAQNETVAPVPSFDVLVLWGHTSINRVSSGF
Ga0184637_1058258113300018063Groundwater SedimentMHAGRVAYEISSEKVKHRAERRAQNETFAPVPSFLQGHTSINRV
Ga0184637_1079444413300018063Groundwater SedimentVAYEISSEKVKHRAERRAQNETFAPVPSFDVFVLWGRTSINRVSSGFLVA
Ga0184618_1013388723300018071Groundwater SedimentMPAGQVAYEISSEKFKHRAERRAQNEIFAPVPSFLQGYTSIVSVRFPHSMNNPG
Ga0184640_1054821213300018074Groundwater SedimentGQVAYEISSEKVKHRAERRAQNETFAPVPSFLQGHTSIDRVSSSFLVA
Ga0184609_1055046023300018076Groundwater SedimentMRAGQVVYEISSEKVKHRAERRTQNETSPPMPSFLQSHTSIVSVLSG
Ga0184633_1036508823300018077Groundwater SedimentERRQNSCALKMQAEQVYYEIIGEKVKHRAERRAQNEPFALVPSFLQGHTSINRVSSGFLV
Ga0184612_1019344323300018078Groundwater SedimentMQAKQVSYEITGEKVKHRAERRAQNETFAPVPSFLQGHTSINRAW
Ga0184612_1040549523300018078Groundwater SedimentLKVHVGRVANEISSEKVKHRAERRAQNETFAPVPSFLQGHTSINSVSSGFLVA
Ga0184612_1048304523300018078Groundwater SedimentMQARRVADEISSEKVKHRAERRAQNETFAPVPSFLQGHTSI
Ga0184627_1030049413300018079Groundwater SedimentMRARRVAYEISSEKVKHCAERRAQNETFAPLPSFLQGRTSI
Ga0184639_1006806413300018082Groundwater SedimentSCALKLQAGRVAYEISSEKVKHRTECRAQNETFAPVPSFLQGHTSIDRVP
Ga0184639_1013444633300018082Groundwater SedimentRQSSCALKLPAGRVAYEISSAKVKHRAERQAQNATFALVPSFLQGHTSIDRVSSVSS
Ga0184629_1011314513300018084Groundwater SedimentLKTQPGQFAFEISSEKVKHRAERPAQNETFAPVPSFLQGRTSIDRVRQVF
Ga0184629_1020908313300018084Groundwater SedimentSEKVKHRAERRAQNETFAPVPSFLQGYTSINTVSSGFLVA
Ga0184629_1031577523300018084Groundwater SedimentLKLQAGRVAYEISSEKVKHRAEHRAQNQTFALVPSFLQGHTSIDSASSGFLVA
Ga0184629_1055961723300018084Groundwater SedimentMQAGQVSYEITGEKVKHRAEGRAQYETFELVPSLLQGHTSIDR
Ga0193739_115095413300020003SoilSGTKAKRCALKMQAGRVGYEISSEKVKHRAERRAQNETFAPMPSFDVLVH
Ga0206224_101119123300021051Deep Subsurface SedimentQAGRSAYEISSEKVKQRAERRTQNETFALVPSFLQGHTAIDTLSSVLLVV
Ga0206224_106605123300021051Deep Subsurface SedimentYEISSEKVKHRAERRAQDETFAPVPSFGALVLWGHTSINRVSSGFRVA
Ga0206227_110823623300021063Deep Subsurface SedimentMQAQQVSYEITGETVKHRAERRAQNETFALVPSFLQAHTSID
Ga0210379_1014572713300021081Groundwater SedimentLKMHARRVAYEISSEKVKHRAERRAQNETFAPMPSYLQGYTSIDKVSSGFLVE
Ga0209109_1003648753300025160SoilMPAGRVAYEISREKVKHRAERRAQNETFALVPSFLQGYASTD
Ga0209002_1009325413300025289SoilSSEKVKHRAERRAQNETFALVPSFLQGYTSIDRVSSGSLVA
Ga0209431_1032705543300025313SoilMPAGRVVYEISSEKVKHRAERRAQNETFAPVPSFLQGHTSIDRVSSGSLV
Ga0209323_1048116223300025314SoilVAYEISSEKVKHRAERRAQNETFAPMPSFLQGHTSIDKVSSGFLVA
Ga0209641_1012778313300025322SoilLCLEDACGRVAYEISSEKVKHRAERRAQNETFAPMPSFLQGHTSINKVSSGFLVA
Ga0209641_1037927023300025322SoilVVYEISSEKVKHRAERRAQNETFAPVPSFLQGHTSIDRVSSGSLVA
Ga0209641_1039214423300025322SoilMPAGRVAYEISSEKVKHRAERRAQNETFAPMPSFLQGHTSINKVS
Ga0207423_106713113300025535Natural And Restored WetlandsMQAGLIAYEISSEKVKHRAERQAQNETFAPVPSFLQGHTSIDALS
Ga0210138_103735433300025580Natural And Restored WetlandsMQAGLIAYEISSEKVEHRAERQAQNETFAPVPSFLQGHTPIDTLRCVVPIGKIGRIKL
Ga0209726_1029960613300027815GroundwaterLKPQARRVAYAISSEKVKHRAERRAQYETFAPLPSFLQGHTSINTVTSGFLV
Ga0209382_1162644623300027909Populus RhizosphereRWCLEDAQWRVAFKISSEKVKYQANRWAENETFAPLPSFLPDHTSINRVASGFLEA
Ga0307281_1006404013300028803SoilIPAGRVVNEASSEKVIHCAECHAHNETVAPVPSFLQGHTSIGRVAPGRLVV
Ga0299907_1020775023300030006SoilEIASEKVKQRAELQSETETFALLPSLLQVHTSIYRVSRVFLEA
Ga0310907_1058165913300031847SoilIAMRAALPERRQSCFALKLQAGQVACEISGEKFKHRAECWTQNETFAPVPSFHQGRTSINTVS
Ga0310885_1087439223300031943SoilKDASGGVAYEISSEKVKHRAERRAQNEIFAPVPTFLQGRTSINRVSSAFLVA
Ga0326597_1056691933300031965SoilMPAGQVTYEITSEKVEHRAERRAQDETFALVPSLLPDYTTIDKVS
Ga0307471_10249778813300032180Hardwood Forest SoilMRAGRVAYEISSEKVNHRAERRAQNEIFAPLPSFLQGHTSINTVSSGFL
Ga0364942_0203887_360_5153300034165SedimentMHAGRVGYEISSEKVKHRAERRDQNETFAPVPSFLQGHTSINGVSSGFLVT
Ga0364934_0106698_755_9373300034178SedimentVAEKGLCPEDVSGRVAYEISSEKFKHRAERRAQNETFAPLPSFLQDYTSIDTLSSVLLVA
Ga0364934_0305064_36_1913300034178SedimentMHAGRVAYEISSEKVKHRAERRDQNETFAPVPSFLQGHTSINGVSSGFLVT
Ga0364934_0417498_3_1553300034178SedimentFCALKVQARRVAYEISSEKVKHRAERRAQNETFAPVPSFLQGFTSIDVVS

 ⦗Top⦘


Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.