Basic Information | |
---|---|
Family ID | F080994 |
Family Type | Metagenome / Metatranscriptome |
Number of Sequences | 114 |
Average Sequence Length | 43 residues |
Representative Sequence | DVPTAILAIGAFLALSRFHGKMTVLYVVLGCGAIGALLQATVV |
Number of Associated Samples | 86 |
Number of Associated Scaffolds | 114 |
Quality Assessment | |
---|---|
Transcriptomic Evidence | Yes |
Most common taxonomic group | Bacteria |
% of genes with valid RBS motifs | 3.54 % |
% of genes near scaffold ends (potentially truncated) | 92.11 % |
% of genes from short scaffolds (< 2000 bps) | 90.35 % |
Associated GOLD sequencing projects | 84 |
AlphaFold2 3D model prediction | Yes |
3D model pTM-score | 0.65 |
Hidden Markov Model |
---|
Powered by Skylign |
Most Common Taxonomy | |
---|---|
Group | Bacteria (62.281 % of family members) |
NCBI Taxonomy ID | 2 |
Taxonomy | All Organisms → cellular organisms → Bacteria |
Most Common Ecosystem | |
---|---|
GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Serpentine Soil (20.175 % of family members) |
Environment Ontology (ENVO) | Unclassified (28.947 % of family members) |
Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (53.509 % of family members) |
⦗Top⦘ |
⦗Top⦘ |
Predicted Topology & Secondary Structure | |||||
---|---|---|---|---|---|
Classification: | Transmembrane (alpha-helical) | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 49.30% β-sheet: 0.00% Coil/Unstructured: 50.70% | Feature Viewer |
|
|||||
Powered by Feature Viewer |
Structure Viewer | |
---|---|
| |
Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.65 |
Powered by PDBe Molstar |
⦗Top⦘ |
Pfam ID | Name | % Frequency in 114 Family Scaffolds |
---|---|---|
PF08241 | Methyltransf_11 | 4.39 |
PF00903 | Glyoxalase | 3.51 |
PF02417 | Chromate_transp | 3.51 |
PF01925 | TauE | 1.75 |
PF01790 | LGT | 1.75 |
PF03364 | Polyketide_cyc | 1.75 |
PF00589 | Phage_integrase | 1.75 |
PF08448 | PAS_4 | 1.75 |
PF07883 | Cupin_2 | 1.75 |
PF01370 | Epimerase | 1.75 |
PF05995 | CDO_I | 0.88 |
PF00196 | GerE | 0.88 |
PF13847 | Methyltransf_31 | 0.88 |
PF03795 | YCII | 0.88 |
PF05222 | AlaDh_PNT_N | 0.88 |
PF12802 | MarR_2 | 0.88 |
PF00078 | RVT_1 | 0.88 |
PF12680 | SnoaL_2 | 0.88 |
PF00353 | HemolysinCabind | 0.88 |
PF09509 | Hypoth_Ymh | 0.88 |
PF01546 | Peptidase_M20 | 0.88 |
PF04542 | Sigma70_r2 | 0.88 |
PF01627 | Hpt | 0.88 |
PF02771 | Acyl-CoA_dh_N | 0.88 |
PF00027 | cNMP_binding | 0.88 |
PF00486 | Trans_reg_C | 0.88 |
PF01966 | HD | 0.88 |
PF16363 | GDP_Man_Dehyd | 0.88 |
PF02371 | Transposase_20 | 0.88 |
PF11017 | DUF2855 | 0.88 |
PF00005 | ABC_tran | 0.88 |
PF01565 | FAD_binding_4 | 0.88 |
PF00563 | EAL | 0.88 |
PF04945 | YHS | 0.88 |
PF01726 | LexA_DNA_bind | 0.88 |
PF13936 | HTH_38 | 0.88 |
PF01625 | PMSR | 0.88 |
PF13417 | GST_N_3 | 0.88 |
PF00881 | Nitroreductase | 0.88 |
PF00202 | Aminotran_3 | 0.88 |
PF07690 | MFS_1 | 0.88 |
PF13669 | Glyoxalase_4 | 0.88 |
PF00171 | Aldedh | 0.88 |
PF14018 | DUF4234 | 0.88 |
PF01545 | Cation_efflux | 0.88 |
PF04185 | Phosphoesterase | 0.88 |
PF07366 | SnoaL | 0.88 |
PF00950 | ABC-3 | 0.88 |
PF02559 | CarD_CdnL_TRCF | 0.88 |
PF01263 | Aldose_epim | 0.88 |
PF08282 | Hydrolase_3 | 0.88 |
PF00561 | Abhydrolase_1 | 0.88 |
COG ID | Name | Functional Category | % Frequency in 114 Family Scaffolds |
---|---|---|---|
COG2059 | Chromate transport protein ChrA | Inorganic ion transport and metabolism [P] | 3.51 |
COG0682 | Prolipoprotein diacylglyceryltransferase | Cell wall/membrane/envelope biogenesis [M] | 1.75 |
COG0730 | Sulfite exporter TauE/SafE/YfcA and related permeases, UPF0721 family | Inorganic ion transport and metabolism [P] | 1.75 |
COG0014 | Gamma-glutamyl phosphate reductase | Amino acid transport and metabolism [E] | 0.88 |
COG0053 | Divalent metal cation (Fe/Co/Zn/Cd) efflux pump | Inorganic ion transport and metabolism [P] | 0.88 |
COG0225 | Peptide methionine sulfoxide reductase MsrA | Posttranslational modification, protein turnover, chaperones [O] | 0.88 |
COG0560 | Phosphoserine phosphatase | Amino acid transport and metabolism [E] | 0.88 |
COG0561 | Hydroxymethylpyrimidine pyrophosphatase and other HAD family phosphatases | Coenzyme transport and metabolism [H] | 0.88 |
COG0568 | DNA-directed RNA polymerase, sigma subunit (sigma70/sigma32) | Transcription [K] | 0.88 |
COG0609 | ABC-type Fe3+-siderophore transport system, permease component | Inorganic ion transport and metabolism [P] | 0.88 |
COG0676 | D-hexose-6-phosphate mutarotase | Carbohydrate transport and metabolism [G] | 0.88 |
COG1012 | Acyl-CoA reductase or other NAD-dependent aldehyde dehydrogenase | Lipid transport and metabolism [I] | 0.88 |
COG1108 | ABC-type Mn2+/Zn2+ transport system, permease component | Inorganic ion transport and metabolism [P] | 0.88 |
COG1191 | DNA-directed RNA polymerase specialized sigma subunit | Transcription [K] | 0.88 |
COG1230 | Co/Zn/Cd efflux system component | Inorganic ion transport and metabolism [P] | 0.88 |
COG1595 | DNA-directed RNA polymerase specialized sigma subunit, sigma24 family | Transcription [K] | 0.88 |
COG1877 | Trehalose-6-phosphate phosphatase | Carbohydrate transport and metabolism [G] | 0.88 |
COG1960 | Acyl-CoA dehydrogenase related to the alkylation response protein AidB | Lipid transport and metabolism [I] | 0.88 |
COG2017 | Galactose mutarotase or related enzyme | Carbohydrate transport and metabolism [G] | 0.88 |
COG2200 | EAL domain, c-di-GMP-specific phosphodiesterase class I (or its enzymatically inactive variant) | Signal transduction mechanisms [T] | 0.88 |
COG2217 | Cation-transporting P-type ATPase | Inorganic ion transport and metabolism [P] | 0.88 |
COG2350 | YciI superfamily enzyme, includes 5-CHQ dehydrochlorinase, contains active-site pHis | Secondary metabolites biosynthesis, transport and catabolism [Q] | 0.88 |
COG3434 | c-di-GMP phosphodiesterase YuxH/PdeH, contains EAL and HDOD domains | Signal transduction mechanisms [T] | 0.88 |
COG3511 | Phospholipase C | Cell wall/membrane/envelope biogenesis [M] | 0.88 |
COG3547 | Transposase | Mobilome: prophages, transposons [X] | 0.88 |
COG3769 | Mannosyl-3-phosphoglycerate phosphatase YedP/MpgP, HAD superfamily | Carbohydrate transport and metabolism [G] | 0.88 |
COG3965 | Predicted Co/Zn/Cd cation transporter, cation efflux family | Inorganic ion transport and metabolism [P] | 0.88 |
COG4230 | Delta 1-pyrroline-5-carboxylate dehydrogenase | Amino acid transport and metabolism [E] | 0.88 |
COG4606 | ABC-type enterochelin transport system, permease component | Inorganic ion transport and metabolism [P] | 0.88 |
COG4941 | Predicted RNA polymerase sigma factor, contains C-terminal TPR domain | Transcription [K] | 0.88 |
COG4943 | Redox-sensing c-di-GMP phosphodiesterase, contains CSS-motif and EAL domains | Signal transduction mechanisms [T] | 0.88 |
COG5001 | Cyclic di-GMP metabolism protein, combines GGDEF and EAL domains with a 6TM membrane domain | Signal transduction mechanisms [T] | 0.88 |
COG5553 | Predicted metal-dependent enzyme of the double-stranded beta helix superfamily | General function prediction only [R] | 0.88 |
⦗Top⦘ |
Name | Rank | Taxonomy | Distribution |
All Organisms | root | All Organisms | 63.16 % |
Unclassified | root | N/A | 36.84 % |
Visualization |
---|
Powered by ApexCharts |
Scaffold | Taxonomy | Length | IMG/M Link |
---|---|---|---|
3300004081|Ga0063454_101322503 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → unclassified Actinobacteria → Actinobacteria bacterium 13_1_20CM_3_68_9 | 605 | Open in IMG/M |
3300004153|Ga0063455_101279394 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 557 | Open in IMG/M |
3300005437|Ga0070710_11057560 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 594 | Open in IMG/M |
3300005440|Ga0070705_100503103 | All Organisms → cellular organisms → Bacteria | 920 | Open in IMG/M |
3300005535|Ga0070684_100419329 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales | 1235 | Open in IMG/M |
3300005548|Ga0070665_101050287 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 826 | Open in IMG/M |
3300005614|Ga0068856_100642274 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1082 | Open in IMG/M |
3300005718|Ga0068866_10194434 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales | 1208 | Open in IMG/M |
3300005718|Ga0068866_11328976 | All Organisms → cellular organisms → Bacteria | 523 | Open in IMG/M |
3300006033|Ga0075012_10096236 | All Organisms → cellular organisms → Bacteria | 2263 | Open in IMG/M |
3300006038|Ga0075365_10568794 | Not Available | 802 | Open in IMG/M |
3300006046|Ga0066652_100408837 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → environmental samples → uncultured Solirubrobacterales bacterium | 1239 | Open in IMG/M |
3300006046|Ga0066652_101330695 | Not Available | 676 | Open in IMG/M |
3300006852|Ga0075433_11838545 | All Organisms → cellular organisms → Bacteria | 520 | Open in IMG/M |
3300009012|Ga0066710_101533455 | Not Available | 1026 | Open in IMG/M |
3300009100|Ga0075418_10940299 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 935 | Open in IMG/M |
3300009137|Ga0066709_103542699 | All Organisms → cellular organisms → Bacteria | 566 | Open in IMG/M |
3300009137|Ga0066709_104406203 | Not Available | 514 | Open in IMG/M |
3300009148|Ga0105243_10629342 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1037 | Open in IMG/M |
3300009789|Ga0126307_10016255 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales | 5530 | Open in IMG/M |
3300009789|Ga0126307_10060813 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia | 2962 | Open in IMG/M |
3300009789|Ga0126307_10145095 | All Organisms → cellular organisms → Archaea → Candidatus Thermoplasmatota → Thermoplasmata → Thermoplasmatales → unclassified Thermoplasmatales → Thermoplasmatales archaeon SW_10_69_26 | 1898 | Open in IMG/M |
3300009815|Ga0105070_1005770 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1929 | Open in IMG/M |
3300009840|Ga0126313_10467951 | All Organisms → cellular organisms → Bacteria | 1006 | Open in IMG/M |
3300009840|Ga0126313_10872561 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 734 | Open in IMG/M |
3300009840|Ga0126313_10999071 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptomycetales → Streptomycetaceae → Streptomyces → unclassified Streptomyces → Streptomyces sp. Ru73 | 685 | Open in IMG/M |
3300009840|Ga0126313_11149662 | Not Available | 639 | Open in IMG/M |
3300010036|Ga0126305_10479224 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 828 | Open in IMG/M |
3300010037|Ga0126304_11064989 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 552 | Open in IMG/M |
3300010038|Ga0126315_10209346 | All Organisms → cellular organisms → Bacteria | 1178 | Open in IMG/M |
3300010038|Ga0126315_10617407 | Not Available | 701 | Open in IMG/M |
3300010039|Ga0126309_10059171 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1861 | Open in IMG/M |
3300010040|Ga0126308_10820375 | Not Available | 645 | Open in IMG/M |
3300010040|Ga0126308_10919076 | Not Available | 610 | Open in IMG/M |
3300010041|Ga0126312_10199280 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 1399 | Open in IMG/M |
3300010041|Ga0126312_10454947 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 913 | Open in IMG/M |
3300010042|Ga0126314_10122242 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 1791 | Open in IMG/M |
3300010042|Ga0126314_10216465 | All Organisms → cellular organisms → Bacteria | 1353 | Open in IMG/M |
3300010042|Ga0126314_10418151 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 967 | Open in IMG/M |
3300010042|Ga0126314_10752217 | Not Available | 716 | Open in IMG/M |
3300010044|Ga0126310_10433773 | Not Available | 944 | Open in IMG/M |
3300010045|Ga0126311_11069341 | Not Available | 662 | Open in IMG/M |
3300010045|Ga0126311_11353024 | Not Available | 593 | Open in IMG/M |
3300012042|Ga0136627_1016367 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 2782 | Open in IMG/M |
3300012092|Ga0136621_1125092 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Thermoleophilales → Thermoleophilaceae → unclassified Thermoleophilaceae → Thermoleophilaceae bacterium | 1037 | Open in IMG/M |
3300012093|Ga0136632_10101057 | Not Available | 1334 | Open in IMG/M |
3300012183|Ga0136624_1093348 | Not Available | 1033 | Open in IMG/M |
3300012187|Ga0136622_10421183 | Not Available | 561 | Open in IMG/M |
3300012188|Ga0136618_10241636 | Not Available | 781 | Open in IMG/M |
3300012212|Ga0150985_108738906 | All Organisms → cellular organisms → Bacteria | 620 | Open in IMG/M |
3300012355|Ga0137369_10806989 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 639 | Open in IMG/M |
3300012679|Ga0136616_10058859 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Thermoleophilales → Thermoleophilaceae → unclassified Thermoleophilaceae → Thermoleophilaceae bacterium | 1841 | Open in IMG/M |
3300012679|Ga0136616_10385852 | Not Available | 636 | Open in IMG/M |
3300012680|Ga0136612_10075334 | All Organisms → cellular organisms → Bacteria | 1700 | Open in IMG/M |
3300012684|Ga0136614_10116561 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → Solirubrobacteraceae → Solirubrobacter | 2024 | Open in IMG/M |
3300012684|Ga0136614_10411553 | All Organisms → cellular organisms → Bacteria | 987 | Open in IMG/M |
3300012915|Ga0157302_10302512 | Not Available | 622 | Open in IMG/M |
3300012975|Ga0134110_10405293 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 606 | Open in IMG/M |
3300012977|Ga0134087_10779245 | Not Available | 515 | Open in IMG/M |
3300013297|Ga0157378_11818995 | All Organisms → cellular organisms → Bacteria | 657 | Open in IMG/M |
3300013306|Ga0163162_11178612 | Not Available | 869 | Open in IMG/M |
3300013308|Ga0157375_10965183 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 993 | Open in IMG/M |
3300013768|Ga0120155_1039850 | All Organisms → cellular organisms → Bacteria | 1440 | Open in IMG/M |
3300014264|Ga0075308_1129362 | Not Available | 565 | Open in IMG/M |
3300015373|Ga0132257_102222658 | Not Available | 710 | Open in IMG/M |
3300015373|Ga0132257_103450416 | Not Available | 575 | Open in IMG/M |
3300017789|Ga0136617_10053095 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales | 3575 | Open in IMG/M |
3300017789|Ga0136617_11188185 | Not Available | 574 | Open in IMG/M |
3300017789|Ga0136617_11371026 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → unclassified Actinobacteria → Actinobacteria bacterium 13_1_20CM_3_68_9 | 528 | Open in IMG/M |
3300018077|Ga0184633_10172214 | Not Available | 1121 | Open in IMG/M |
3300018432|Ga0190275_11161134 | Not Available | 847 | Open in IMG/M |
3300018432|Ga0190275_12509741 | Not Available | 593 | Open in IMG/M |
3300018466|Ga0190268_10231776 | All Organisms → cellular organisms → Bacteria | 1042 | Open in IMG/M |
3300018466|Ga0190268_10458301 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → Solirubrobacteraceae → environmental samples → uncultured Solirubrobacteraceae bacterium | 847 | Open in IMG/M |
3300018466|Ga0190268_11494491 | Not Available | 586 | Open in IMG/M |
3300018469|Ga0190270_10453151 | Not Available | 1207 | Open in IMG/M |
3300018469|Ga0190270_11154932 | Not Available | 810 | Open in IMG/M |
3300018469|Ga0190270_11439457 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 736 | Open in IMG/M |
3300018482|Ga0066669_11027508 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 744 | Open in IMG/M |
3300018910|Ga0193598_1012365 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micromonosporales → Micromonosporaceae → Asanoa → Asanoa ishikariensis | 2453 | Open in IMG/M |
3300021339|Ga0193706_1111411 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 745 | Open in IMG/M |
3300023077|Ga0247802_1009625 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Propionibacteriales → Nocardioidaceae | 1251 | Open in IMG/M |
3300024347|Ga0179591_1197646 | Not Available | 4209 | Open in IMG/M |
3300025935|Ga0207709_11853476 | All Organisms → cellular organisms → Bacteria | 502 | Open in IMG/M |
3300026075|Ga0207708_10311890 | All Organisms → cellular organisms → Bacteria | 1282 | Open in IMG/M |
3300027647|Ga0214468_1046735 | Not Available | 1130 | Open in IMG/M |
3300027851|Ga0209066_10357841 | Not Available | 795 | Open in IMG/M |
3300027961|Ga0209853_1119315 | Not Available | 657 | Open in IMG/M |
3300028592|Ga0247822_11641118 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Thermoleophilales → Thermoleophilaceae → unclassified Thermoleophilaceae → Thermoleophilaceae bacterium | 546 | Open in IMG/M |
3300028744|Ga0307318_10058520 | Not Available | 1281 | Open in IMG/M |
3300028754|Ga0307297_10042018 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales | 1385 | Open in IMG/M |
3300028754|Ga0307297_10328053 | Not Available | 556 | Open in IMG/M |
3300028755|Ga0307316_10000713 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia | 10167 | Open in IMG/M |
3300028796|Ga0307287_10297755 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 610 | Open in IMG/M |
3300028811|Ga0307292_10436607 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 558 | Open in IMG/M |
3300028819|Ga0307296_10438936 | All Organisms → cellular organisms → Bacteria | 714 | Open in IMG/M |
3300028828|Ga0307312_10875159 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 595 | Open in IMG/M |
3300030510|Ga0268243_1079038 | All Organisms → cellular organisms → Bacteria | 744 | Open in IMG/M |
3300030990|Ga0308178_1040263 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 836 | Open in IMG/M |
3300031099|Ga0308181_1015980 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → Solirubrobacteraceae → environmental samples → uncultured Solirubrobacteraceae bacterium | 1156 | Open in IMG/M |
3300031184|Ga0307499_10286575 | Not Available | 538 | Open in IMG/M |
3300031424|Ga0308179_1063420 | Not Available | 501 | Open in IMG/M |
3300031450|Ga0272433_10223829 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Thermoleophilales → Thermoleophilaceae → unclassified Thermoleophilaceae → Thermoleophilaceae bacterium | 1004 | Open in IMG/M |
3300031548|Ga0307408_102261106 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 526 | Open in IMG/M |
3300031731|Ga0307405_10897309 | Not Available | 749 | Open in IMG/M |
3300031824|Ga0307413_10239340 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales | 1339 | Open in IMG/M |
3300031903|Ga0307407_11033809 | All Organisms → cellular organisms → Bacteria | 636 | Open in IMG/M |
3300031995|Ga0307409_100480795 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales | 1205 | Open in IMG/M |
3300031995|Ga0307409_100890571 | Not Available | 903 | Open in IMG/M |
3300031995|Ga0307409_102621329 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 532 | Open in IMG/M |
3300032896|Ga0335075_10927915 | Not Available | 793 | Open in IMG/M |
3300034377|Ga0334931_131493 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 596 | Open in IMG/M |
3300034384|Ga0372946_0022945 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 2738 | Open in IMG/M |
⦗Top⦘ |
Habitat | Taxonomy | Distribution |
Serpentine Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Serpentine Soil | 20.18% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 19.30% |
Polar Desert Sand | Environmental → Aquatic → Freshwater → Ice → Unclassified → Polar Desert Sand | 12.28% |
Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere | 6.14% |
Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 3.51% |
Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 2.63% |
Watersheds | Environmental → Aquatic → Freshwater → Groundwater → Unclassified → Watersheds | 1.75% |
Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 1.75% |
Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 1.75% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 1.75% |
Soil | Environmental → Terrestrial → Soil → Loam → Grasslands → Soil | 1.75% |
Groundwater Sand | Environmental → Terrestrial → Soil → Sand → Unclassified → Groundwater Sand | 1.75% |
Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere | 1.75% |
Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere | 1.75% |
Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 1.75% |
Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 1.75% |
Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 1.75% |
Groundwater Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment | 0.88% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 0.88% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil | 0.88% |
Permafrost | Environmental → Terrestrial → Soil → Unclassified → Permafrost → Permafrost | 0.88% |
Sub-Biocrust Soil | Environmental → Terrestrial → Soil → Unclassified → Desert → Sub-Biocrust Soil | 0.88% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 0.88% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural → Soil | 0.88% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Uranium Contaminated → Soil | 0.88% |
Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 0.88% |
Natural And Restored Wetlands | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Natural And Restored Wetlands | 0.88% |
Corn Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere | 0.88% |
Soil | Environmental → Terrestrial → Soil → Sand → Desert → Soil | 0.88% |
Rock | Environmental → Terrestrial → Rock-Dwelling (Endoliths) → Unclassified → Unclassified → Rock | 0.88% |
Avena Fatua Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Avena Fatua Rhizosphere | 0.88% |
Corn Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere | 0.88% |
Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 0.88% |
Populus Endosphere | Host-Associated → Plants → Roots → Bulk Soil → Unclassified → Populus Endosphere | 0.88% |
Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere | 0.88% |
Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Miscanthus Rhizosphere | 0.88% |
Visualization |
---|
Powered by ApexCharts |
Taxon OID | Sample Name | Habitat Type | IMG/M Link |
---|---|---|---|
3300004081 | Grasslands soil microbial communities from Hopland, California, USA - 2 (version 2) | Environmental | Open in IMG/M |
3300004153 | Grasslands soil microbial communities from Hopland, California, USA (version 2) | Environmental | Open in IMG/M |
3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Environmental | Open in IMG/M |
3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Environmental | Open in IMG/M |
3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Environmental | Open in IMG/M |
3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Host-Associated | Open in IMG/M |
3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Host-Associated | Open in IMG/M |
3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Host-Associated | Open in IMG/M |
3300006033 | Freshwater microbial communities in response to fracking from Pennsylvania, USA - Allegheny Zone_MetaG_DW_15 | Environmental | Open in IMG/M |
3300006038 | Populus root and rhizosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Host-Associated | Open in IMG/M |
3300006046 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_101 | Environmental | Open in IMG/M |
3300006852 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Host-Associated | Open in IMG/M |
3300009012 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_159 | Environmental | Open in IMG/M |
3300009100 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD2 | Host-Associated | Open in IMG/M |
3300009137 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_158 | Environmental | Open in IMG/M |
3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Host-Associated | Open in IMG/M |
3300009789 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot28 | Environmental | Open in IMG/M |
3300009815 | Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW S1_0_10 | Environmental | Open in IMG/M |
3300009840 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot105A | Environmental | Open in IMG/M |
3300010036 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot26 | Environmental | Open in IMG/M |
3300010037 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot25 | Environmental | Open in IMG/M |
3300010038 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot106 | Environmental | Open in IMG/M |
3300010039 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot56 | Environmental | Open in IMG/M |
3300010040 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot55 | Environmental | Open in IMG/M |
3300010041 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot104A | Environmental | Open in IMG/M |
3300010042 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot105B | Environmental | Open in IMG/M |
3300010044 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot60 | Environmental | Open in IMG/M |
3300010045 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot61 | Environmental | Open in IMG/M |
3300012042 | Polar desert sand microbial communities from Dry Valleys, Antarctica - metaG UQ489 (22.06) | Environmental | Open in IMG/M |
3300012092 | Polar desert sand microbial communities from Dry Valleys, Antarctica - metaG UQ445A (23.06) | Environmental | Open in IMG/M |
3300012093 | Polar desert sand microbial communities from Dry Valleys, Antarctica - metaG UQ611 (21.06) | Environmental | Open in IMG/M |
3300012183 | Polar desert sand microbial communities from Dry Valleys, Antarctica - metaG UQ469 (22.06) | Environmental | Open in IMG/M |
3300012187 | Polar desert sand microbial communities from Dry Valleys, Antarctica - metaG UQ448 (21.06) | Environmental | Open in IMG/M |
3300012188 | Polar desert sand microbial communities from Dry Valleys, Antarctica - metaG UQ330 (21.06) | Environmental | Open in IMG/M |
3300012212 | Combined assembly of Hopland grassland soil | Host-Associated | Open in IMG/M |
3300012355 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_113_16 metaG | Environmental | Open in IMG/M |
3300012679 | Polar desert sand microbial communities from Dry Valleys, Antarctica - metaG UQ299 (21.06) | Environmental | Open in IMG/M |
3300012680 | Polar desert sand microbial communities from Dry Valleys, Antarctica - metaG UQ224A (23.06) | Environmental | Open in IMG/M |
3300012684 | Polar desert sand microbial communities from Dry Valleys, Antarctica - metaG UQ279 (21.06) | Environmental | Open in IMG/M |
3300012915 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S103-311B-2 | Environmental | Open in IMG/M |
3300012975 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_5_11112015 | Environmental | Open in IMG/M |
3300012977 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Glu_20cm_5_24_1 metaG | Environmental | Open in IMG/M |
3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Host-Associated | Open in IMG/M |
3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Host-Associated | Open in IMG/M |
3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Host-Associated | Open in IMG/M |
3300013768 | Permafrost microbial communities from Nunavut, Canada - A35_65cm_0M | Environmental | Open in IMG/M |
3300014264 | Natural and restored wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - Joice_ThreeSqA_D2_rd | Environmental | Open in IMG/M |
3300015373 | Combined assembly of cpr5 rhizosphere | Host-Associated | Open in IMG/M |
3300017789 | Polar desert sand microbial communities from Dry Valleys, Antarctica - metaG UQ322 (21.06) | Environmental | Open in IMG/M |
3300018077 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3-1_170_b1 | Environmental | Open in IMG/M |
3300018432 | Populus adjacent soil microbial communities from riparian zone of Yellowstone River, Montana, USA - 550 T | Environmental | Open in IMG/M |
3300018466 | Populus adjacent soil microbial communities from riparian zone of Blue River, Arizona, USA - 249 T | Environmental | Open in IMG/M |
3300018469 | Populus adjacent soil microbial communities from riparian zone of Weber River, Utah, USA - 320 T | Environmental | Open in IMG/M |
3300018482 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_118 | Environmental | Open in IMG/M |
3300018910 | Soil crust microbial communities from Colorado Plateau, Utah, USA - earlymid stage, 18 hrs after wetting v1 | Environmental | Open in IMG/M |
3300021339 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U3c1 | Environmental | Open in IMG/M |
3300023077 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, United States - UWRJ-S076-202R-6 | Environmental | Open in IMG/M |
3300024347 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_08_16fungal (PacBio error correction) | Environmental | Open in IMG/M |
3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) | Environmental | Open in IMG/M |
3300027647 | Soil microbial communities from uranium-contaminated site in the Upper Colorado River Basin, Wyoming, United States - RVT155D38 HiSeq | Environmental | Open in IMG/M |
3300027851 | Freshwater microbial communities in response to fracking from Pennsylvania, USA - Allegheny Zone_MetaG_DW_15 (SPAdes) | Environmental | Open in IMG/M |
3300027961 | Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW S1_30_40 (SPAdes) | Environmental | Open in IMG/M |
3300028592 | Soil microbial communities from agricultural site in Penn Yan, New York, United States - 13C_Cellulose_Day30 | Environmental | Open in IMG/M |
3300028744 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_367 | Environmental | Open in IMG/M |
3300028754 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_157 | Environmental | Open in IMG/M |
3300028755 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_356 | Environmental | Open in IMG/M |
3300028796 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_141 | Environmental | Open in IMG/M |
3300028811 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_149 | Environmental | Open in IMG/M |
3300028819 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_153 | Environmental | Open in IMG/M |
3300028828 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_202 | Environmental | Open in IMG/M |
3300030510 | Bulk soil microbial communities from Mexico - Magueyal (Ma) metaG (v2) | Environmental | Open in IMG/M |
3300030990 | Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_149 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300031099 | Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_152 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300031184 | Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 13_S | Environmental | Open in IMG/M |
3300031424 | Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_150 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300031450 | Rock endolithic microbial communities from Victoria Land, Antarctica - University Valley sud | Environmental | Open in IMG/M |
3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Host-Associated | Open in IMG/M |
3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Host-Associated | Open in IMG/M |
3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Host-Associated | Open in IMG/M |
3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Host-Associated | Open in IMG/M |
3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Host-Associated | Open in IMG/M |
3300032896 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_2.4 | Environmental | Open in IMG/M |
3300034377 | Sub-biocrust soil microbial communities from Mojave Desert, California, United States - 27HNS | Environmental | Open in IMG/M |
3300034384 | Forest soil microbial communities from Eldorado National Forest, California, USA - SNFC_MG_KNG_2.2 | Environmental | Open in IMG/M |
Geographical Distribution | |
---|---|
Zoom: | Powered by OpenStreetMap |
⦗Top⦘ |
Protein ID | Sample Taxon ID | Habitat | Sequence |
Ga0063454_1013225032 | 3300004081 | Soil | KTSVVDVYTALLAIGAFLALNRWHSKLTVLYVVLGCGAIGALLQATIV* |
Ga0063455_1012793941 | 3300004153 | Soil | TGLLAVGAFLVLLRFHGKLTVLYVVLGCGAIGGLLQLTVV* |
Ga0070710_110575602 | 3300005437 | Corn, Switchgrass And Miscanthus Rhizosphere | VDVYTALIAIAAFAILVRFHSKLTVLYVVLGGGAIGAVLQATVV* |
Ga0070705_1005031032 | 3300005440 | Corn, Switchgrass And Miscanthus Rhizosphere | VDVWTAILAIGAFLVLNRWHGKLTVLYVVLGCGLIGAGLQLSGIA* |
Ga0070684_1004193293 | 3300005535 | Corn Rhizosphere | SIVDVYTAILAVAAFLALNRWHGKLTVLYVVLGCGVAGVLLQATIV* |
Ga0070665_1010502873 | 3300005548 | Switchgrass Rhizosphere | TSVVDVYTAVLAVAAFLALNRWHGKLTVLYVVLGCGVAGVLLQATAV* |
Ga0068856_1006422743 | 3300005614 | Corn Rhizosphere | AIAAFAILVRFHSKLTVLYVVLGGGAIGAVLQATVV* |
Ga0068866_101944341 | 3300005718 | Miscanthus Rhizosphere | DVWTAILAIGAFLVLNRWHGKLTVLYVVLGCGLIGAGLQLSGIA* |
Ga0068866_113289762 | 3300005718 | Miscanthus Rhizosphere | LAIGAFLVLNRYHAKLTVLYVVLGCGLIGLLLQLTVV* |
Ga0075012_100962363 | 3300006033 | Watersheds | DVPTAVLAVAAFYVLYRFHSKLTVVAVILGCGLLGALWQFV* |
Ga0075365_105687941 | 3300006038 | Populus Endosphere | SAILAIAAFAALYRWQAKLTVLFVVLGCGLLGAALQLTVL* |
Ga0066652_1004088372 | 3300006046 | Soil | LAVGAFLALNRWHGKLTVVYVVLASGLIGAALQLSGVV* |
Ga0066652_1013306953 | 3300006046 | Soil | AIGAFAALTRWHSKVTVLWVVLGCGAIGVLLQATVV* |
Ga0075433_118385452 | 3300006852 | Populus Rhizosphere | ALLALGAFAALMSFHGKLTVLYVVLGCGLVGVVLQLTVV* |
Ga0066710_1015334551 | 3300009012 | Grasslands Soil | KTSVVDVYTALLAIGAFLVLNRWHSKLTVLWVVLGCGAIGALLQATIV |
Ga0075418_109402991 | 3300009100 | Populus Rhizosphere | VGAFVVLNRWHGKLTVLYVVLACGAVGALVQLAGLV* |
Ga0066709_1035426991 | 3300009137 | Grasslands Soil | DVPTAILAIGAFLALSRFHGKMTVLYVVLGCGAIGALLQATVV* |
Ga0066709_1044062031 | 3300009137 | Grasslands Soil | IGAFLTLSRFHGKLTVLYVVLGCGAIGTLLQLTVI* |
Ga0105243_106293421 | 3300009148 | Miscanthus Rhizosphere | VYTALIAIAAFAILVRFHSKLTVLYVVLGGGAIGAVLQATVV* |
Ga0126307_100162556 | 3300009789 | Serpentine Soil | WTAALAALSFAALIRWHGKLTVLFVVLGAGFAGAMLELAGVA* |
Ga0126307_100608131 | 3300009789 | Serpentine Soil | DVSTALLAVAAFLALNRWHGKLTIVAVVISCGLIGLALQATGAV* |
Ga0126307_101450951 | 3300009789 | Serpentine Soil | AIAAFAVLMRYHDKLTVLYVVLGCGAVGAALQLTVL* |
Ga0105070_10057702 | 3300009815 | Groundwater Sand | VVDVPTALLALGAFAALMRFHGKLTVLYVVLGCGLIGVGLQLTVV* |
Ga0126313_104679512 | 3300009840 | Serpentine Soil | VGAFLVLTRFHGKLTVLYVVLGCGGLGALLQLTVL* |
Ga0126313_108725611 | 3300009840 | Serpentine Soil | ILDASIVDVPTAILAVAAFLALNRWHGKLTVVAVVLGCGVVGAILQMTGAV* |
Ga0126313_109990713 | 3300009840 | Serpentine Soil | DVPTALLAAGAFLVLNRYHGKLSVLYVVLGCGAIGAALQATVI* |
Ga0126313_111496621 | 3300009840 | Serpentine Soil | AYTAVLAVGAFAALQRWHGKLTVLYAVLGCGLIGALLQLTIL* |
Ga0126305_104792241 | 3300010036 | Serpentine Soil | ILAVAAFLALNRWHGKLTVVAVVLGCGVVGAILQMTGAV* |
Ga0126304_110649892 | 3300010037 | Serpentine Soil | VPTAVLAVTAFLVLNRWHGKLTVLYVVLGCGATGALLRVAGLM* |
Ga0126315_102093462 | 3300010038 | Serpentine Soil | VPTAILAVAAFLALNRWHGKLTVVAVVLGCGVVGAILQMTGAV* |
Ga0126315_106174072 | 3300010038 | Serpentine Soil | DASIVDVPTAILAVAAFAALNRWHGKLTVVAVVLGCGAAGVILQATSAV* |
Ga0126309_100591711 | 3300010039 | Serpentine Soil | VLAIGAFLVLNRFHSKLTVLYVVLGCGAIGALLQATIV* |
Ga0126308_108203752 | 3300010040 | Serpentine Soil | AIAAFAALTRWHAKTTVLWVVLACGAVGTLLQATVV* |
Ga0126308_109190763 | 3300010040 | Serpentine Soil | MAAFVALSRWHGKVTVVAVVLGCGIVGAVLQTTGAV* |
Ga0126312_101992803 | 3300010041 | Serpentine Soil | VDTGVVDLPTALLALGAFAALMRFHGKLTVLYVVLGCGLIGLVLRLTIV* |
Ga0126312_104549472 | 3300010041 | Serpentine Soil | VDVPTALLALGAFAALMRFHGKLTVLYVVLGCGLVGVALQATVI* |
Ga0126314_101222422 | 3300010042 | Serpentine Soil | VPTAVLAVAAFAVLYRFHTKLTVLYVVLGCGAIGALLQLSGTA* |
Ga0126314_102164651 | 3300010042 | Serpentine Soil | SVVDVPTALLAVGAFLVLTRFHGKLTVLYVVLGCGGLGALLQLTVL* |
Ga0126314_104181511 | 3300010042 | Serpentine Soil | SVVDAYTAVLAVGAFAALQRWHGKLTVLYVVLGCGLIGTLLQLTIV* |
Ga0126314_107522171 | 3300010042 | Serpentine Soil | TAVLAVTAFLVLNRWHGKLTVLYVMLGCGATGALLQGTGLV* |
Ga0126310_104337732 | 3300010044 | Serpentine Soil | DILDTSIVDVPTALLAVSAFLALNRWHGKLTIVAVVLSCGLAGVALQATGAV* |
Ga0126311_110693411 | 3300010045 | Serpentine Soil | ILDASIVDVPTAILAVAAFAALNRWHGKLTVVAVVLGCGVAGVLLQATGAV* |
Ga0126311_113530241 | 3300010045 | Serpentine Soil | ILDASIVDVPTAILAVAAFAALNRWHGKLTVVAVVLGCGAAGVILQATSAV* |
Ga0136627_10163673 | 3300012042 | Polar Desert Sand | GLIAVGAFAALMRFHSKLTVLWVVLGCGTIGAALQLTVL* |
Ga0136621_11250921 | 3300012092 | Polar Desert Sand | GAFLALYRFQAKLTVLFVVLGCGLIGAALQFSVL* |
Ga0136632_101010574 | 3300012093 | Polar Desert Sand | VVDVPTALLAVGAFLVLNRWHGKLTVLYVVLGCGAIGALLQVADLV* |
Ga0136624_10933482 | 3300012183 | Polar Desert Sand | GAFAALMRFHSKLTVLWVVLGCGTIGAALQLTVL* |
Ga0136622_104211831 | 3300012187 | Polar Desert Sand | IAVGAFAALMRFHSKLTVLWVVLGCGTIGAALQLTVL* |
Ga0136618_102416361 | 3300012188 | Polar Desert Sand | TALLAVGAFLVLNRWHGKLTVLYVVLGCGAIGALLQVADLV* |
Ga0150985_1087389062 | 3300012212 | Avena Fatua Rhizosphere | GWPAALAIGAFAVLQLWHGKLTVVYVVLGCGLIGALLQATVV* |
Ga0137369_108069891 | 3300012355 | Vadose Zone Soil | TALLAVAAFGALMRFHGKLTVLYVVMGCGLVGGLLQITVA* |
Ga0136616_100588594 | 3300012679 | Polar Desert Sand | GGFLVLNRYHGKLTVLYVVLGCGLIGAALQLTVV* |
Ga0136616_103858523 | 3300012679 | Polar Desert Sand | AVGAFLVLNRYHSKLTVLYVVLGCGLIGAMLQLMVL* |
Ga0136612_100753342 | 3300012680 | Polar Desert Sand | LAVGAFLVLNRWHGKLTVLYVVLGCGAIGALLQVCRACR* |
Ga0136614_101165613 | 3300012684 | Polar Desert Sand | APTAVLAMAAFLALNRWHGKLTVVAVVLGCGIAGAVLQTTGTV* |
Ga0136614_104115531 | 3300012684 | Polar Desert Sand | PTAVLAVGAFLILSRFHEKTTVLYVVLGCGAIGATLQLTVL* |
Ga0157302_103025121 | 3300012915 | Soil | SVVDLPTALIAIGAFLALNRWHGKLTVVYVVLGCGLIGAALQLSGLV* |
Ga0134110_104052931 | 3300012975 | Grasslands Soil | AVGAFLALNRWHSKLTVLYVVLGCGAVGALLQATVV* |
Ga0134087_107792451 | 3300012977 | Grasslands Soil | AGIVDIYTAALALGAFLALNRWHGKLTVLYVVAGCGEIGAALQLTIV* |
Ga0157378_118189951 | 3300013297 | Miscanthus Rhizosphere | MNMRKMMSLAAFAVLMRFHGKLTVLYVVLGCGAVGALLQLTVV* |
Ga0163162_111786121 | 3300013306 | Switchgrass Rhizosphere | IVKTSVVDVYTAVLAIGAFLALNRWHGKLTVLYVVLGCGVLGVLLQATVV* |
Ga0157375_109651833 | 3300013308 | Miscanthus Rhizosphere | IAAFAILVRFHSKLTVLYVVLGGGAIGAVLQATVV* |
Ga0120155_10398503 | 3300013768 | Permafrost | VVDVPTAVLAIGAFAVLCRFHSKLTVLYVVLGCGAIGALLQATVV* |
Ga0075308_11293621 | 3300014264 | Natural And Restored Wetlands | DTGIVDGWTAALAILAFAALNRWHGKLTVLYVVVGCGLAGALLQLLVV* |
Ga0132257_1022226581 | 3300015373 | Arabidopsis Rhizosphere | LAIGAFAALNRWHGKLTVVYVVLGCGLIGAALQVSGVV* |
Ga0132257_1034504162 | 3300015373 | Arabidopsis Rhizosphere | YTALIAIAAFAILVRFHSKLTVLYVVLGGGAIGAVLQATVVEV* |
Ga0136617_100530954 | 3300017789 | Polar Desert Sand | PTALLAIASFAALYRFQSKLTVLYVVVGAGLAGALLQATVV |
Ga0136617_111881851 | 3300017789 | Polar Desert Sand | LAVGAFAALQRWHGKLTVLWVVLACGAIGGVLQLTVV |
Ga0136617_113710262 | 3300017789 | Polar Desert Sand | TAVLAIGAFLALNRWHGKLTVLFVVAACGATGAALQLSGVV |
Ga0184633_101722143 | 3300018077 | Groundwater Sediment | LIEIAAFLALYRFHSKLTVLYVMIGCGAIGALLQLTVL |
Ga0190275_111611341 | 3300018432 | Soil | EILDTSIVDAPTAVLAMAAFVALNRWHGKLTVVAVVLGCGIVGAVLQTTGAV |
Ga0190275_125097412 | 3300018432 | Soil | AALAFLALYRFEGKLTVLWVVLGCGAVGALLQLTVL |
Ga0190268_102317762 | 3300018466 | Soil | VGAFAVLYRFQGKLTILFVVLGCGALGALLQLTVV |
Ga0190268_104583012 | 3300018466 | Soil | ALAVGAFAVLYRAGSKLAVLWVVLGCGVLGALLQLTIL |
Ga0190268_114944911 | 3300018466 | Soil | ILAVAAFAVLMRWHARLTVLYVVVGCGLIGGALQATGVV |
Ga0190270_104531511 | 3300018469 | Soil | PTAILAVGAFLVLMRAHGKLSILYVVLGCGAIGAVLQATGVV |
Ga0190270_111549322 | 3300018469 | Soil | DVPTAIIAVAAFLALNRWHGKLTVLFVVAGAGIAGAALQLSGLV |
Ga0190270_114394572 | 3300018469 | Soil | ASVPDWPSALLALGAFAALYRWSGKLTVLWVVLGCGAIGALLQLTVL |
Ga0066669_110275082 | 3300018482 | Grasslands Soil | LLAIGAFLVLLRFHAKLTVLYVVLGCGAIGALLQLTIV |
Ga0193598_10123651 | 3300018910 | Soil | TVDVLEASVVDLPTAILAVAAFAALTRWHGKLVVVGAVLGCGIIGALLQATAVV |
Ga0193706_11114111 | 3300021339 | Soil | VVDVYTGVLAVAAFLALNRWHGKLTVLYVVLGCGLVGALLQQTVV |
Ga0247802_10096251 | 3300023077 | Soil | LDASVVDAYTAALAVGAFLALNRWHGKLTVLYVVLSCGAIGAVLQLTFV |
Ga0179591_11976461 | 3300024347 | Vadose Zone Soil | GRASSDVYTALIAIAAFLALNHWHGKLTVLYVMLGCGLVGVLLQATVV |
Ga0207709_118534762 | 3300025935 | Miscanthus Rhizosphere | DVYTAILAVASFLVLNRFHGKLTVLYVVLGCGVIGAVLQATVV |
Ga0207669_116436431 | 3300025937 | Miscanthus Rhizosphere | VMLDILDTSIVDLPTALLAIGAFLALSRWHSKLTVVYVMAACGAIGALLQAI |
Ga0207708_103118901 | 3300026075 | Corn, Switchgrass And Miscanthus Rhizosphere | ALIAIAAFAILVRFHSKLTVLYVVLGGGAIGAVLQATVV |
Ga0214468_10467353 | 3300027647 | Soil | TSVVDAPTAILALLAFLALNRWHGKLTVLYVVLGCGIAGAGLQLSGIV |
Ga0209066_103578412 | 3300027851 | Watersheds | TAVLAVAAFYVLYRFHSKLTVVAVILGCGLLGALWQFV |
Ga0209853_11193152 | 3300027961 | Groundwater Sand | ALGAFAALMRFHGKLTVLYVVLGCGLIGVGLQLTVV |
Ga0247822_116411181 | 3300028592 | Soil | DVPTATLAIGAFLVLSRWHGKLTVLYVVLGCGAIGAAIQLSGVV |
Ga0307318_100585201 | 3300028744 | Soil | IADTSIVDVPSALIAIAAFLALSRWHGSLTVLWVMLGSGLVGVALQLTVL |
Ga0307297_100420184 | 3300028754 | Soil | ASVVDVYTAALALGAFLALNRWHSKLTVLYVVAACGALGAALQLTIV |
Ga0307297_103280531 | 3300028754 | Soil | DLLETTVVDVPTAILAVAAFLVLNRFHDKLTVLYVVLGCGAAGALLQATGHA |
Ga0307316_1000071313 | 3300028755 | Soil | YTAVLALGAFLALNKWHSKLTVLYVVATCGAIGAALQLTVV |
Ga0307287_102977552 | 3300028796 | Soil | ALLAVAAFVVLSRYHGKMTVLYVVFGCGAIGALLQLTVV |
Ga0307292_104366072 | 3300028811 | Soil | VKTSVVDVYTALLAIGAFLALNRWHAKLTVLWVVLGCGAIGALLQATVV |
Ga0307296_104389361 | 3300028819 | Soil | ASVVDVPTAILAIAGFLALNRWHGKLTVLYVVLGCGAIGAALQFSGLV |
Ga0307312_108751592 | 3300028828 | Soil | KTSVVDVYTAVLAIGAFLALNRWHSKLTVVYVVLSCGAIGALLQATIV |
Ga0268243_10790381 | 3300030510 | Soil | IVDAGVVDAYTAALALGAFLALNRWHGKLTVLYVVLSCGAIGAILQLTVA |
Ga0308178_10402631 | 3300030990 | Soil | PTAILAVAAFAALTRWHSKLTVLYVVLGCGLVGAALQLTVL |
Ga0308181_10159803 | 3300031099 | Soil | PTALLAIGAFLALNRWHGKLTVVYVVLGCGLIGAALQVSGLV |
Ga0307499_102865751 | 3300031184 | Soil | VETSVVDFWTALLAIGAFLVLNRFHGKLTVLYVVLGCGVIGALLQATVV |
Ga0308179_10634202 | 3300031424 | Soil | VDLPTALLAIGAFLALNRWHGKLTVVYVVLGCGLIGAALQVSGLV |
Ga0272433_102238291 | 3300031450 | Rock | PSALLAIGAFLALYRFQAKLTVLFVVLGCGLIGAALQYSAL |
Ga0307408_1022611061 | 3300031548 | Rhizosphere | DLLDASVPDAPSALLALGAFAVLYRWPGKLIVVWVVLGCGAIGALLQLTVL |
Ga0307405_108973093 | 3300031731 | Rhizosphere | DVPTALLAVAAFLALNRWHGKLTVVAVVLGCGVAGATLQVSGAV |
Ga0307413_102393403 | 3300031824 | Rhizosphere | IGAFAALQRWHGKLTVLWVVLACGALGAVLQATVV |
Ga0307407_110338093 | 3300031903 | Rhizosphere | PTAVLAIAAFVALNRWHGKLVVVGAVLGCGVIGVLLQTTNVV |
Ga0307409_1004807954 | 3300031995 | Rhizosphere | IVKETVVDLPTALLAIAAFAVLMRFHGKLTVPYVVLGCGIVGAALQLTVL |
Ga0307409_1008905711 | 3300031995 | Rhizosphere | DVPTAILAVAAFGALNRWHGKLTVVAVVLGCGAAGVILQATGAV |
Ga0307409_1026213291 | 3300031995 | Rhizosphere | AVLALGAFAVLYLRPGKLTVLWVILGCGAIGALLQLTVL |
Ga0335075_109279151 | 3300032896 | Soil | DVWTGLLAIAAFLALLRWHGKLTVLYVVLGCGLAGALLQATVV |
Ga0334931_131493_1_129 | 3300034377 | Sub-Biocrust Soil | VYTGALALAAFLALNRWHSKLTVLYVVLGCGAIGAALQLTIV |
Ga0372946_0022945_384_512 | 3300034384 | Soil | VPSAILAAGAFAALYRFPGKLTVLYVVLGCGAIGAVLQLTVL |
⦗Top⦘ |