Basic Information | |
---|---|
Family ID | F080972 |
Family Type | Metagenome / Metatranscriptome |
Number of Sequences | 114 |
Average Sequence Length | 40 residues |
Representative Sequence | MLPIFFATYGAVFVAEIVGDKLLYTTGVLATRYRTVP |
Number of Associated Samples | 105 |
Number of Associated Scaffolds | 114 |
Quality Assessment | |
---|---|
Transcriptomic Evidence | Yes |
Most common taxonomic group | Bacteria |
% of genes with valid RBS motifs | 61.40 % |
% of genes near scaffold ends (potentially truncated) | 98.25 % |
% of genes from short scaffolds (< 2000 bps) | 92.98 % |
Associated GOLD sequencing projects | 101 |
AlphaFold2 3D model prediction | Yes |
3D model pTM-score | 0.56 |
Hidden Markov Model |
---|
Powered by Skylign |
Most Common Taxonomy | |
---|---|
Group | Bacteria (90.351 % of family members) |
NCBI Taxonomy ID | 2 |
Taxonomy | All Organisms → cellular organisms → Bacteria |
Most Common Ecosystem | |
---|---|
GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil (7.895 % of family members) |
Environment Ontology (ENVO) | Unclassified (33.333 % of family members) |
Earth Microbiome Project Ontology (EMPO) | Host-associated → Plant → Plant rhizosphere (31.579 % of family members) |
⦗Top⦘ |
⦗Top⦘ |
Predicted Topology & Secondary Structure | |||||
---|---|---|---|---|---|
Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 47.69% β-sheet: 0.00% Coil/Unstructured: 52.31% | Feature Viewer |
|
|||||
Powered by Feature Viewer |
Structure Viewer | |
---|---|
| |
Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.56 |
Powered by PDBe Molstar |
⦗Top⦘ |
Pfam ID | Name | % Frequency in 114 Family Scaffolds |
---|---|---|
PF00578 | AhpC-TSA | 12.28 |
PF13620 | CarboxypepD_reg | 6.14 |
PF00988 | CPSase_sm_chain | 4.39 |
PF00005 | ABC_tran | 2.63 |
PF03544 | TonB_C | 1.75 |
PF01008 | IF-2B | 1.75 |
PF07969 | Amidohydro_3 | 1.75 |
PF13419 | HAD_2 | 1.75 |
PF00072 | Response_reg | 0.88 |
PF13432 | TPR_16 | 0.88 |
PF01641 | SelR | 0.88 |
PF13545 | HTH_Crp_2 | 0.88 |
PF00588 | SpoU_methylase | 0.88 |
PF01609 | DDE_Tnp_1 | 0.88 |
PF00115 | COX1 | 0.88 |
PF02872 | 5_nucleotid_C | 0.88 |
PF12724 | Flavodoxin_5 | 0.88 |
PF13398 | Peptidase_M50B | 0.88 |
PF00248 | Aldo_ket_red | 0.88 |
PF01032 | FecCD | 0.88 |
PF13709 | DUF4159 | 0.88 |
PF13683 | rve_3 | 0.88 |
PF00227 | Proteasome | 0.88 |
PF07662 | Nucleos_tra2_C | 0.88 |
PF00483 | NTP_transferase | 0.88 |
PF13577 | SnoaL_4 | 0.88 |
COG ID | Name | Functional Category | % Frequency in 114 Family Scaffolds |
---|---|---|---|
COG0505 | Carbamoylphosphate synthase small subunit | Amino acid transport and metabolism [E] | 8.77 |
COG0182 | 5-methylthioribose/5-deoxyribulose 1-phosphate isomerase (methionine salvage pathway), a paralog of eIF-2B alpha subunit | Amino acid transport and metabolism [E] | 1.75 |
COG0810 | Periplasmic protein TonB, links inner and outer membranes | Cell wall/membrane/envelope biogenesis [M] | 1.75 |
COG1184 | Translation initiation factor 2B subunit, eIF-2B alpha/beta/delta family | Translation, ribosomal structure and biogenesis [J] | 1.75 |
COG0219 | tRNA(Leu) C34 or U34 (ribose-2'-O)-methylase TrmL, contains SPOUT domain | Translation, ribosomal structure and biogenesis [J] | 0.88 |
COG0229 | Peptide methionine sulfoxide reductase MsrB | Posttranslational modification, protein turnover, chaperones [O] | 0.88 |
COG0565 | tRNA C32,U32 (ribose-2'-O)-methylase TrmJ or a related methyltransferase | Translation, ribosomal structure and biogenesis [J] | 0.88 |
COG0566 | tRNA G18 (ribose-2'-O)-methylase SpoU | Translation, ribosomal structure and biogenesis [J] | 0.88 |
COG0638 | 20S proteasome, alpha and beta subunits | Posttranslational modification, protein turnover, chaperones [O] | 0.88 |
COG0737 | 2',3'-cyclic-nucleotide 2'-phosphodiesterase/5'- or 3'-nucleotidase, 5'-nucleotidase family | Defense mechanisms [V] | 0.88 |
COG1972 | Nucleoside permease NupC | Nucleotide transport and metabolism [F] | 0.88 |
COG3039 | Transposase and inactivated derivatives, IS5 family | Mobilome: prophages, transposons [X] | 0.88 |
COG3293 | Transposase | Mobilome: prophages, transposons [X] | 0.88 |
COG3385 | IS4 transposase InsG | Mobilome: prophages, transposons [X] | 0.88 |
COG3484 | Predicted proteasome-type protease | Posttranslational modification, protein turnover, chaperones [O] | 0.88 |
COG5405 | ATP-dependent protease HslVU (ClpYQ), peptidase subunit | Posttranslational modification, protein turnover, chaperones [O] | 0.88 |
COG5421 | Transposase | Mobilome: prophages, transposons [X] | 0.88 |
COG5433 | Predicted transposase YbfD/YdcC associated with H repeats | Mobilome: prophages, transposons [X] | 0.88 |
COG5659 | SRSO17 transposase | Mobilome: prophages, transposons [X] | 0.88 |
⦗Top⦘ |
Name | Rank | Taxonomy | Distribution |
All Organisms | root | All Organisms | 90.35 % |
Unclassified | root | N/A | 9.65 % |
Visualization |
---|
Powered by ApexCharts |
Scaffold | Taxonomy | Length | IMG/M Link |
---|---|---|---|
3300000789|JGI1027J11758_11589682 | All Organisms → cellular organisms → Bacteria | 545 | Open in IMG/M |
3300000955|JGI1027J12803_104274697 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 561 | Open in IMG/M |
3300004778|Ga0062383_10423353 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 658 | Open in IMG/M |
3300005332|Ga0066388_105703932 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 630 | Open in IMG/M |
3300005338|Ga0068868_102249243 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 520 | Open in IMG/M |
3300005364|Ga0070673_102075777 | All Organisms → cellular organisms → Bacteria | 540 | Open in IMG/M |
3300005561|Ga0066699_11031235 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA3 | 569 | Open in IMG/M |
3300005591|Ga0070761_10193243 | All Organisms → cellular organisms → Bacteria | 1204 | Open in IMG/M |
3300005616|Ga0068852_101334582 | Not Available | 739 | Open in IMG/M |
3300005764|Ga0066903_106101346 | All Organisms → cellular organisms → Bacteria | 631 | Open in IMG/M |
3300005836|Ga0074470_11211387 | All Organisms → cellular organisms → Bacteria | 10230 | Open in IMG/M |
3300005842|Ga0068858_100789843 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA3 | 926 | Open in IMG/M |
3300005843|Ga0068860_102061042 | All Organisms → cellular organisms → Bacteria | 592 | Open in IMG/M |
3300005844|Ga0068862_100962234 | Not Available | 842 | Open in IMG/M |
3300006881|Ga0068865_101662024 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 575 | Open in IMG/M |
3300006904|Ga0075424_101797841 | All Organisms → cellular organisms → Bacteria | 648 | Open in IMG/M |
3300009012|Ga0066710_101546692 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes | 1020 | Open in IMG/M |
3300009090|Ga0099827_10055672 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2994 | Open in IMG/M |
3300009094|Ga0111539_12757256 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 569 | Open in IMG/M |
3300009101|Ga0105247_11540804 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 543 | Open in IMG/M |
3300009143|Ga0099792_10911963 | All Organisms → cellular organisms → Bacteria | 582 | Open in IMG/M |
3300009143|Ga0099792_11024127 | All Organisms → cellular organisms → Bacteria | 553 | Open in IMG/M |
3300009156|Ga0111538_14049248 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 506 | Open in IMG/M |
3300009520|Ga0116214_1136718 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia | 909 | Open in IMG/M |
3300009665|Ga0116135_1455997 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 525 | Open in IMG/M |
3300009700|Ga0116217_10364831 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 920 | Open in IMG/M |
3300010046|Ga0126384_11218525 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 695 | Open in IMG/M |
3300010048|Ga0126373_11118139 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Bryobacteraceae → Bryobacter → Bryobacter aggregatus | 854 | Open in IMG/M |
3300010366|Ga0126379_11267466 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → unclassified Blastocatellia → Blastocatellia bacterium | 843 | Open in IMG/M |
3300010366|Ga0126379_11397956 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA3 | 806 | Open in IMG/M |
3300010375|Ga0105239_11479176 | All Organisms → cellular organisms → Bacteria | 785 | Open in IMG/M |
3300010376|Ga0126381_101556780 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 955 | Open in IMG/M |
3300010863|Ga0124850_1128634 | Not Available | 628 | Open in IMG/M |
3300011438|Ga0137451_1285399 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 519 | Open in IMG/M |
3300012199|Ga0137383_11252823 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 531 | Open in IMG/M |
3300012205|Ga0137362_10030235 | All Organisms → cellular organisms → Bacteria | 4282 | Open in IMG/M |
3300012210|Ga0137378_11216544 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia | 669 | Open in IMG/M |
3300012212|Ga0150985_119110573 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 637 | Open in IMG/M |
3300012925|Ga0137419_10857621 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA3 | 746 | Open in IMG/M |
3300012930|Ga0137407_10773934 | All Organisms → cellular organisms → Bacteria | 906 | Open in IMG/M |
3300013296|Ga0157374_11494994 | Not Available | 699 | Open in IMG/M |
3300013306|Ga0163162_10057239 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 3926 | Open in IMG/M |
3300013306|Ga0163162_10750439 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1095 | Open in IMG/M |
3300013306|Ga0163162_12738276 | Not Available | 568 | Open in IMG/M |
3300014161|Ga0181529_10606472 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia | 571 | Open in IMG/M |
3300014167|Ga0181528_10838958 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 518 | Open in IMG/M |
3300014326|Ga0157380_10085522 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2588 | Open in IMG/M |
3300014491|Ga0182014_10635089 | Not Available | 511 | Open in IMG/M |
3300014492|Ga0182013_10129613 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Solibacter → Candidatus Solibacter usitatus | 1631 | Open in IMG/M |
3300014493|Ga0182016_10853192 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA3 | 504 | Open in IMG/M |
3300014495|Ga0182015_10990036 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA4 | 522 | Open in IMG/M |
3300014501|Ga0182024_12543754 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA3 | 551 | Open in IMG/M |
3300014968|Ga0157379_10304565 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales | 1453 | Open in IMG/M |
3300015372|Ga0132256_101323514 | All Organisms → cellular organisms → Bacteria | 833 | Open in IMG/M |
3300015372|Ga0132256_102384320 | All Organisms → cellular organisms → Bacteria | 632 | Open in IMG/M |
3300015373|Ga0132257_100848106 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1143 | Open in IMG/M |
3300018014|Ga0187860_1330879 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 583 | Open in IMG/M |
3300018026|Ga0187857_10467952 | Not Available | 566 | Open in IMG/M |
3300018033|Ga0187867_10748960 | All Organisms → cellular organisms → Bacteria | 531 | Open in IMG/M |
3300018034|Ga0187863_10407361 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia | 758 | Open in IMG/M |
3300018060|Ga0187765_11335243 | All Organisms → cellular organisms → Bacteria | 509 | Open in IMG/M |
3300018064|Ga0187773_10957398 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 558 | Open in IMG/M |
3300018433|Ga0066667_10572151 | All Organisms → cellular organisms → Bacteria | 940 | Open in IMG/M |
3300018482|Ga0066669_10971237 | All Organisms → cellular organisms → Bacteria | 765 | Open in IMG/M |
3300019260|Ga0181506_1131147 | Not Available | 921 | Open in IMG/M |
3300019877|Ga0193722_1130540 | All Organisms → cellular organisms → Bacteria | 569 | Open in IMG/M |
3300021181|Ga0210388_11197405 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 645 | Open in IMG/M |
3300021560|Ga0126371_13295489 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 546 | Open in IMG/M |
3300021861|Ga0213853_11264261 | All Organisms → cellular organisms → Bacteria | 610 | Open in IMG/M |
3300022499|Ga0242641_1051346 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA3 | 500 | Open in IMG/M |
3300022512|Ga0242676_1002931 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA3 | 1229 | Open in IMG/M |
3300022718|Ga0242675_1093157 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA3 | 570 | Open in IMG/M |
3300025930|Ga0207701_10459771 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → unclassified Blastocatellia → Blastocatellia bacterium | 1092 | Open in IMG/M |
3300025931|Ga0207644_11284748 | All Organisms → cellular organisms → Bacteria | 615 | Open in IMG/M |
3300025972|Ga0207668_11267960 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → Gemmatimonadaceae → Gemmatimonas → Gemmatimonas groenlandica | 663 | Open in IMG/M |
3300027729|Ga0209248_10257071 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 508 | Open in IMG/M |
3300027915|Ga0209069_10155365 | All Organisms → cellular organisms → Bacteria | 1141 | Open in IMG/M |
3300028380|Ga0268265_11322757 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → Gemmatimonadaceae → Gemmatimonas → Gemmatimonas groenlandica | 721 | Open in IMG/M |
3300028381|Ga0268264_12405772 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 533 | Open in IMG/M |
3300028536|Ga0137415_11032095 | All Organisms → cellular organisms → Bacteria | 634 | Open in IMG/M |
3300028813|Ga0302157_10594052 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia | 571 | Open in IMG/M |
3300029636|Ga0222749_10621383 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA3 | 591 | Open in IMG/M |
3300029894|Ga0247028_1109831 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA4 | 512 | Open in IMG/M |
3300029907|Ga0311329_11051177 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 502 | Open in IMG/M |
3300029922|Ga0311363_10546125 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 1159 | Open in IMG/M |
3300029953|Ga0311343_10393681 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Solibacter → Candidatus Solibacter usitatus | 1283 | Open in IMG/M |
3300029994|Ga0302283_1158887 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA4 | 874 | Open in IMG/M |
3300030007|Ga0311338_11915751 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA3 | 529 | Open in IMG/M |
3300030518|Ga0302275_10026041 | All Organisms → cellular organisms → Bacteria | 4801 | Open in IMG/M |
3300030618|Ga0311354_10586946 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia | 1085 | Open in IMG/M |
3300030673|Ga0302287_10224695 | All Organisms → cellular organisms → Bacteria | 549 | Open in IMG/M |
3300031234|Ga0302325_12845037 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA4 | 565 | Open in IMG/M |
3300031236|Ga0302324_103198158 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA4 | 539 | Open in IMG/M |
3300031524|Ga0302320_11782716 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA4 | 588 | Open in IMG/M |
3300031525|Ga0302326_10123673 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 4541 | Open in IMG/M |
3300031525|Ga0302326_11157424 | Not Available | 1069 | Open in IMG/M |
3300031525|Ga0302326_11458982 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA3 | 920 | Open in IMG/M |
3300031525|Ga0302326_12024844 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA3 | 743 | Open in IMG/M |
3300031708|Ga0310686_104388455 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA3 | 1336 | Open in IMG/M |
3300031715|Ga0307476_11099639 | All Organisms → cellular organisms → Bacteria | 584 | Open in IMG/M |
3300031716|Ga0310813_11790917 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 576 | Open in IMG/M |
3300031726|Ga0302321_102946777 | Not Available | 556 | Open in IMG/M |
3300031788|Ga0302319_10059820 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 5971 | Open in IMG/M |
3300031820|Ga0307473_11138410 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 577 | Open in IMG/M |
3300031823|Ga0307478_11045242 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Deinococcus-Thermus → Deinococci | 682 | Open in IMG/M |
3300031823|Ga0307478_11250889 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 618 | Open in IMG/M |
3300032013|Ga0310906_11268507 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 537 | Open in IMG/M |
3300032783|Ga0335079_11041962 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA3 | 832 | Open in IMG/M |
3300032805|Ga0335078_11795383 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia | 667 | Open in IMG/M |
3300032828|Ga0335080_10520092 | All Organisms → cellular organisms → Bacteria | 1261 | Open in IMG/M |
3300033004|Ga0335084_11091862 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia | 801 | Open in IMG/M |
3300033134|Ga0335073_11815087 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA3 | 569 | Open in IMG/M |
3300033888|Ga0334792_095341 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia | 831 | Open in IMG/M |
3300034282|Ga0370492_0459287 | Not Available | 517 | Open in IMG/M |
⦗Top⦘ |
Habitat | Taxonomy | Distribution |
Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 7.89% |
Palsa | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Palsa | 7.02% |
Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 5.26% |
Bog | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Bog | 5.26% |
Peatland | Environmental → Aquatic → Freshwater → Wetlands → Bog → Peatland | 4.39% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 4.39% |
Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 4.39% |
Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 4.39% |
Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 3.51% |
Fen | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Fen | 3.51% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 2.63% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 2.63% |
Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 2.63% |
Bog | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Bog | 2.63% |
Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 2.63% |
Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 2.63% |
Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 2.63% |
Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere | 2.63% |
Bog | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog | 1.75% |
Peatlands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil | 1.75% |
Tropical Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland | 1.75% |
Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere | 1.75% |
Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 1.75% |
Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Arabidopsis Rhizosphere | 1.75% |
Watersheds | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Watersheds | 0.88% |
Bog Forest Soil | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog Forest Soil | 0.88% |
Peatland | Environmental → Aquatic → Freshwater → Wetlands → Unclassified → Peatland | 0.88% |
Wetland Sediment | Environmental → Aquatic → Freshwater → Wetlands → Unclassified → Wetland Sediment | 0.88% |
Cryconite | Environmental → Aquatic → Freshwater → Ice → Unclassified → Cryconite | 0.88% |
Soil | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Soil | 0.88% |
Sediment (Intertidal) | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Sediment (Intertidal) | 0.88% |
Watersheds | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds | 0.88% |
Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Corn, Switchgrass And Miscanthus Rhizosphere | 0.88% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural → Soil | 0.88% |
Untreated Peat Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Untreated Peat Soil | 0.88% |
Palsa | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Palsa | 0.88% |
Permafrost | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Permafrost | 0.88% |
Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Soil | 0.88% |
Soil | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Soil | 0.88% |
Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere | 0.88% |
Avena Fatua Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Avena Fatua Rhizosphere | 0.88% |
Corn Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere | 0.88% |
Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 0.88% |
Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 0.88% |
Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 0.88% |
Visualization |
---|
Powered by ApexCharts |
Taxon OID | Sample Name | Habitat Type | IMG/M Link |
---|---|---|---|
3300000789 | Soil microbial communities from Great Prairies - Iowa, Native Prairie soil | Environmental | Open in IMG/M |
3300000955 | Soil microbial communities from Great Prairies - Iowa, Native Prairie soil | Environmental | Open in IMG/M |
3300004778 | Wetland sediment microbial communities from St. Louis River estuary, USA, under dissolved organic matter induced mercury methylation - T4Bare3Fresh | Environmental | Open in IMG/M |
3300005332 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly) | Environmental | Open in IMG/M |
3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Host-Associated | Open in IMG/M |
3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Host-Associated | Open in IMG/M |
3300005561 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_148 | Environmental | Open in IMG/M |
3300005591 | Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF1 | Environmental | Open in IMG/M |
3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Host-Associated | Open in IMG/M |
3300005764 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2) | Environmental | Open in IMG/M |
3300005836 | Microbial communities from Youngs Bay mouth sediment, Columbia River estuary, Oregon - S.42_YBB | Environmental | Open in IMG/M |
3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Host-Associated | Open in IMG/M |
3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Host-Associated | Open in IMG/M |
3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Host-Associated | Open in IMG/M |
3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Host-Associated | Open in IMG/M |
3300006904 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD3 | Host-Associated | Open in IMG/M |
3300009012 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_159 | Environmental | Open in IMG/M |
3300009090 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con1.8 metaG | Environmental | Open in IMG/M |
3300009094 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) | Host-Associated | Open in IMG/M |
3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Host-Associated | Open in IMG/M |
3300009143 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_2 | Environmental | Open in IMG/M |
3300009156 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD1 (version 2) | Host-Associated | Open in IMG/M |
3300009520 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_1_NS metaG | Environmental | Open in IMG/M |
3300009665 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_20_10 | Environmental | Open in IMG/M |
3300009700 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_4_PS metaG | Environmental | Open in IMG/M |
3300010046 | Tropical forest soil microbial communities from Panama - MetaG Plot_36 | Environmental | Open in IMG/M |
3300010048 | Tropical forest soil microbial communities from Panama - MetaG Plot_11 | Environmental | Open in IMG/M |
3300010366 | Tropical forest soil microbial communities from Panama - MetaG Plot_24 | Environmental | Open in IMG/M |
3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Host-Associated | Open in IMG/M |
3300010376 | Tropical forest soil microbial communities from Panama - MetaG Plot_28 | Environmental | Open in IMG/M |
3300010863 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (PacBio error correction) | Environmental | Open in IMG/M |
3300011438 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMGT500_2 | Environmental | Open in IMG/M |
3300012199 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_40_16 metaG | Environmental | Open in IMG/M |
3300012205 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_100_16 metaG | Environmental | Open in IMG/M |
3300012210 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_60_16 metaG | Environmental | Open in IMG/M |
3300012212 | Combined assembly of Hopland grassland soil | Host-Associated | Open in IMG/M |
3300012925 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_2_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
3300012930 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_2_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Host-Associated | Open in IMG/M |
3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Host-Associated | Open in IMG/M |
3300014161 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin10_30_metaG | Environmental | Open in IMG/M |
3300014167 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin10_10_metaG | Environmental | Open in IMG/M |
3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Host-Associated | Open in IMG/M |
3300014491 | Permafrost microbial communities from Stordalen Mire, Sweden - 612S2D metaG | Environmental | Open in IMG/M |
3300014492 | Permafrost microbial communities from Stordalen Mire, Sweden - 612S2M metaG | Environmental | Open in IMG/M |
3300014493 | Permafrost microbial communities from Stordalen Mire, Sweden - 712S2M metaG | Environmental | Open in IMG/M |
3300014495 | Permafrost microbial communities from Stordalen Mire, Sweden - 712P3M metaG | Environmental | Open in IMG/M |
3300014501 | Permafrost microbial communities from Stordalen Mire, Sweden - P3-2 metaG (Illumina Assembly) | Environmental | Open in IMG/M |
3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Host-Associated | Open in IMG/M |
3300015372 | Soil combined assembly | Host-Associated | Open in IMG/M |
3300015373 | Combined assembly of cpr5 rhizosphere | Host-Associated | Open in IMG/M |
3300018014 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_10_40 | Environmental | Open in IMG/M |
3300018026 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_8_100 | Environmental | Open in IMG/M |
3300018033 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_13_10 | Environmental | Open in IMG/M |
3300018034 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_11_10 | Environmental | Open in IMG/M |
3300018060 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_QUI02_MP05_10_MG | Environmental | Open in IMG/M |
3300018064 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_BV02_MP05_10_MG | Environmental | Open in IMG/M |
3300018433 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_116 | Environmental | Open in IMG/M |
3300018482 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_118 | Environmental | Open in IMG/M |
3300019260 | Metatranscriptome of peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin06_10_metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300019877 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? H2m1 | Environmental | Open in IMG/M |
3300021181 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-19-O | Environmental | Open in IMG/M |
3300021560 | Tropical forest soil microbial communities from Panama - MetaG Plot_4 | Environmental | Open in IMG/M |
3300021861 | Metatranscriptome of freshwater sediment microbial communities from post-fracked creek in Pennsylvania, United States - ABR_2016 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300022499 | Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-C-14-O (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
3300022512 | Metatranscriptome of lab incubated forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-7-O (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
3300022718 | Metatranscriptome of lab incubated forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-O (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
3300025930 | Switchgrass rhizosphere bulk soil microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) | Environmental | Open in IMG/M |
3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300027729 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP04_OM1 (SPAdes) | Environmental | Open in IMG/M |
3300027915 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Straight Creek_MetaG_SC_2013 (SPAdes) | Environmental | Open in IMG/M |
3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) | Host-Associated | Open in IMG/M |
3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) | Host-Associated | Open in IMG/M |
3300028536 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_1_16fungal (Hybrid Assembly) | Environmental | Open in IMG/M |
3300028813 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Bog_N3_3 | Environmental | Open in IMG/M |
3300029636 | Metatranscriptome of lab incubated forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-M (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300029894 | Cryconite microbial communities from ice sheet in Tasiilaq, Greenland - TAS_L-A1b | Environmental | Open in IMG/M |
3300029907 | I_Bog_N1 coassembly | Environmental | Open in IMG/M |
3300029922 | III_Fen_E1 coassembly | Environmental | Open in IMG/M |
3300029953 | II_Bog_E3 coassembly | Environmental | Open in IMG/M |
3300029994 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - III_Fen_E1_4 | Environmental | Open in IMG/M |
3300030007 | I_Palsa_E1 coassembly | Environmental | Open in IMG/M |
3300030518 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - III_Bog_N2_2 | Environmental | Open in IMG/M |
3300030618 | II_Palsa_E3 coassembly | Environmental | Open in IMG/M |
3300030673 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - III_Fen_E2_4 | Environmental | Open in IMG/M |
3300031234 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Palsa_T0_2 | Environmental | Open in IMG/M |
3300031236 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Palsa_T0_1 | Environmental | Open in IMG/M |
3300031524 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Bog_T0_3 | Environmental | Open in IMG/M |
3300031525 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Palsa_T0_3 | Environmental | Open in IMG/M |
3300031708 | FICUS49499 Metagenome Czech Republic combined assembly | Environmental | Open in IMG/M |
3300031715 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM2C_05 | Environmental | Open in IMG/M |
3300031716 | Soil microbial communities from experimental microcosm in Duke University, North Carolina, United States - YN3 | Environmental | Open in IMG/M |
3300031726 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Fen_T0_1 | Environmental | Open in IMG/M |
3300031788 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Bog_T0_2 | Environmental | Open in IMG/M |
3300031820 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_515 | Environmental | Open in IMG/M |
3300031823 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM4C_05 | Environmental | Open in IMG/M |
3300032013 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C48D3 | Environmental | Open in IMG/M |
3300032783 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.3 | Environmental | Open in IMG/M |
3300032805 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.2 | Environmental | Open in IMG/M |
3300032828 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.4 | Environmental | Open in IMG/M |
3300033004 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.4 | Environmental | Open in IMG/M |
3300033134 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_2.2 | Environmental | Open in IMG/M |
3300033888 | Peat soil microbial communities from Stordalen Mire, Sweden - 713 P-3-X1 | Environmental | Open in IMG/M |
3300034282 | Peat soil microbial communities from wetlands in Alaska, United States - Eight_mile_03D_16 | Environmental | Open in IMG/M |
Geographical Distribution | |
---|---|
Zoom: | Powered by OpenStreetMap |
⦗Top⦘ |
Protein ID | Sample Taxon ID | Habitat | Sequence |
JGI1027J11758_115896822 | 3300000789 | Soil | VLVVFFATFGAVFLAEIVGDKLLYTTGVLAARYRTAPIMIGMAAA |
JGI1027J12803_1042746971 | 3300000955 | Soil | VLIFFTTFGTVFVAEIVGDKLLYTTGVLAARYRTLPIT |
Ga0062383_104233531 | 3300004778 | Wetland Sediment | VIQLVLATYGAVFVAEIVGDKLLYTTGVLAARYRSAAVVLG |
Ga0066388_1057039322 | 3300005332 | Tropical Forest Soil | MLAIFFATYAAVFIAEIVGDKLLYTTGVLATRYRWGAVVIG |
Ga0068868_1022492431 | 3300005338 | Miscanthus Rhizosphere | MSYLLMVLGTAYLAVFIAEIVGDKLLYTSGVLATRYRWSAV |
Ga0070673_1020757771 | 3300005364 | Switchgrass Rhizosphere | MLAVFFATYAAVFIAEIAGDKLLYTTGILATRYRSAPIVIGMAAAFMVKMGA |
Ga0066699_110312351 | 3300005561 | Soil | VLAIFLATYGAVFVAEIVGDKLLYTTGVLATRYRWASIVC |
Ga0070761_101932432 | 3300005591 | Soil | MIAIFLATYEAVFVAEIVGDKLLYTTGVLATRYRTMPIM |
Ga0068852_1013345822 | 3300005616 | Corn Rhizosphere | MISVFIATYAAVFIAEIVGDKLLYTTGILATRYRSLPVM |
Ga0066903_1061013462 | 3300005764 | Tropical Forest Soil | MLPVFFATYGAVFAAEIVGDKLLYTTGVLATRYRTLP |
Ga0074470_112113878 | 3300005836 | Sediment (Intertidal) | MLALFFATYGAVFVAEIVGDKLLYTTGVLATRYRCCRCSKR* |
Ga0068858_1007898431 | 3300005842 | Switchgrass Rhizosphere | MFEIFLATYGGVFIAEIVGDKLLYTSGVLATRYSW |
Ga0068860_1020610421 | 3300005843 | Switchgrass Rhizosphere | MLSIFLATYGAVFIAEIVGDKLLYTTGVLATRYRSASIMLGMAL |
Ga0068862_1009622341 | 3300005844 | Switchgrass Rhizosphere | MITALVATYVAVFIAEIVGDKLLYTTGVLAVRYRP |
Ga0068865_1016620241 | 3300006881 | Miscanthus Rhizosphere | MLPIFFATYGAVFIAEIVGDKLLYTTGVLATRYRTIPILMGM |
Ga0075424_1017978411 | 3300006904 | Populus Rhizosphere | MLVIFFATFGAVFIAEIVGDKLLYTTGVLAARYRTAP |
Ga0066710_1015466922 | 3300009012 | Grasslands Soil | VFVVFFATFGAVFLAEIVGDKLLYTTGVLAARYRTTPIMIG |
Ga0099827_100556722 | 3300009090 | Vadose Zone Soil | VILIFFTAFGTVFVAEIVGDKLLYTTGVLAARYRTLPI |
Ga0111539_127572561 | 3300009094 | Populus Rhizosphere | MLEVVLATYVAVFVAEIVGDKLLYTSGVLATRFRWGAV |
Ga0105247_115408043 | 3300009101 | Switchgrass Rhizosphere | MLTIFAATYAAVFVAEIVGDKLLYTTGVLAANYRSLSIVVGMAFAFMC |
Ga0099792_109119631 | 3300009143 | Vadose Zone Soil | MIQAFWTTYASVLAAEVLGDKLLYTTGFLATRYRTTPMM |
Ga0099792_110241272 | 3300009143 | Vadose Zone Soil | MSMLAIFAATYAAVFIAEIVGDKLLYTTGVLATRYRSLPIILGM |
Ga0111538_140492481 | 3300009156 | Populus Rhizosphere | MFEIFLTTYGGVFVAEIVGDKLLYTSGVLATRYSWSSVL |
Ga0116214_11367181 | 3300009520 | Peatlands Soil | MLPIFFATYGTVFVAEIVGDKLLYTTGVLATRYRTLP |
Ga0116135_14559971 | 3300009665 | Peatland | MLPILFATYVAVFVAEIVGDKLLYTTGVLATRYRTPPIL |
Ga0116217_103648311 | 3300009700 | Peatlands Soil | MLPIFFATYGTVFVAEIVGDKLLYTTGVLATRYRTLPIMCG |
Ga0126384_112185252 | 3300010046 | Tropical Forest Soil | MLPILFATYGSVFMAEIVGDKLLYTTGVLATRFRTVPILCGMAMAFMGK |
Ga0126373_111181393 | 3300010048 | Tropical Forest Soil | MLPVLFATYGAVFVAEIVGDKLLYTTGVLANRYRAVPIMFGM |
Ga0126379_112674661 | 3300010366 | Tropical Forest Soil | VTLIFFTAFGAVFIAEIVGDKLLYTTSVLAARYRTLPIMF |
Ga0126379_113979561 | 3300010366 | Tropical Forest Soil | MLAIFLATYGAVFVAEIVGDKLLYTTGVLATRYRTV |
Ga0105239_114791762 | 3300010375 | Corn Rhizosphere | VLVIFFATFGAVFLAEIVGDKLLYTTGVLAARYRTAP |
Ga0126381_1015567801 | 3300010376 | Tropical Forest Soil | MIPILLTSYGAVFVAEIVGDKLLYTTGVLSARYRTAPVLFG |
Ga0124850_11286341 | 3300010863 | Tropical Forest Soil | MLPIFFATYGAVFVAEIVGDKLLYTTGVLATRYRTA |
Ga0137451_12853991 | 3300011438 | Soil | LLELVLTTYGAVFVAEIVGDKLLYTTGVLAARYRSAAVV |
Ga0137383_112528231 | 3300012199 | Vadose Zone Soil | MLPILFATYGAVFVAEIAGDKLLYTTGVLANRYRAAPIMFGMALAF |
Ga0137362_100302351 | 3300012205 | Vadose Zone Soil | MILILLTAFGAVFVAEIVGDKLLYTTGILAARYRTMPIM |
Ga0137378_112165441 | 3300012210 | Vadose Zone Soil | MLPIFLATFGTVIVAEIVGDKLLYTTGVLATRYRTLPILCGM |
Ga0150985_1191105731 | 3300012212 | Avena Fatua Rhizosphere | VLAVFLATYGAVFIAEIVGDKLLYTTGVLATRYRPAAIIAGLAAA |
Ga0137419_108576213 | 3300012925 | Vadose Zone Soil | VILILLTTFGAIFVAEIVGDKLLYTTGVLAARYRTMPI |
Ga0137407_107739341 | 3300012930 | Vadose Zone Soil | MLAIFLATYGAVFVAEIVGDKLLYTTGVLAARYKT |
Ga0157374_114949941 | 3300013296 | Miscanthus Rhizosphere | MLTIFAATYAAVFIAEIVGDKLLYTTGILATRYRSLPVI |
Ga0163162_100572393 | 3300013306 | Switchgrass Rhizosphere | MVLIFFTTFGTVFVAEIVGDKLLYTTSVLAARYRALPIT |
Ga0163162_107504392 | 3300013306 | Switchgrass Rhizosphere | MVLIFFTTFGTVFVAEIVGDKLLYTTGVLATRFRTLPIM |
Ga0163162_127382761 | 3300013306 | Switchgrass Rhizosphere | MISVFIATYAAVFIAEIVGDKLLYTTGILATRYRSLPVMLG |
Ga0181529_106064721 | 3300014161 | Bog | MLAILFATYGTVFVAEIVGDKLLYTTGVLATRFRWAPILCGMAMAFLL |
Ga0181528_108389582 | 3300014167 | Bog | MLPIFLQTYGTVFGAEIVGDKLLYTTGVLSARYKTA |
Ga0157380_100855221 | 3300014326 | Switchgrass Rhizosphere | LLQLVLTTYGAVFVAEIVGDKLLYTTGVLAARYRSAAVVLGMA |
Ga0182014_106350892 | 3300014491 | Bog | MLPILFATYGAVFLAEIAGDKLLYTTGVLAARRA* |
Ga0182013_101296131 | 3300014492 | Bog | MLPILLATYGTVFVAEIVGDKLLYTTGVLATRYRWGPIL |
Ga0182016_108531921 | 3300014493 | Bog | MIAILFATYGAVFVAEIVGDKLLYTTGVLATRYRTVS |
Ga0182015_109900362 | 3300014495 | Palsa | MIAIFIATYGAVFVAEIVGDKLLYTTGVLATRYRTTAVMIGMLIAF |
Ga0182024_125437541 | 3300014501 | Permafrost | MIAILIATYGAVFVAEIVGDKLLYTTGVLATRYRTVPIMIG |
Ga0157379_103045651 | 3300014968 | Switchgrass Rhizosphere | LLVIFFATFGAVFLAEIVGDKLLYTTGVLSARYRTAPILIGMA |
Ga0132256_1013235141 | 3300015372 | Arabidopsis Rhizosphere | LLVIFFATFGAVFLAEIVGDKLLYTTGVLSARYRTVPILI |
Ga0132256_1023843202 | 3300015372 | Arabidopsis Rhizosphere | MLPILFATYGAVFVAEIVGDKLLYTTGVLATRYRTAPIMFGMAISFMAKM |
Ga0132257_1008481061 | 3300015373 | Arabidopsis Rhizosphere | MAEFFGIFFTTYGAVFIAEIVGDKLLYTTGVLATRYRSVSIMIGMA |
Ga0187860_13308791 | 3300018014 | Peatland | MLPIILATYGTVFVAEIVGDKLLYTTGVLATRYRWV |
Ga0187857_104679521 | 3300018026 | Peatland | MLPILFATYGAVFIAEIAGDKLLYTTGVLAARYRAAPILCGMA |
Ga0187867_107489601 | 3300018033 | Peatland | MFAIFLATYGAVFVAEIVGDKLLYTTGVLAARYKTLPIMIGMG |
Ga0187863_104073612 | 3300018034 | Peatland | MLPIFIATYAAVFMAEIVGDKLLYTTGLLATRYKTFPILCGM |
Ga0187765_113352432 | 3300018060 | Tropical Peatland | MLPILLATYGAVFIAEIVGDKLLYTTGVLATRYRT |
Ga0187773_109573982 | 3300018064 | Tropical Peatland | MVAILLTTYVAVFLAEIVGDKLTYTTGILATRYRPAPIM |
Ga0066667_105721511 | 3300018433 | Grasslands Soil | MPVIFFATFGAVFIAEIVGDKLLYTTGVLAARYRTAPMM |
Ga0066669_109712371 | 3300018482 | Grasslands Soil | LLVIFFATFGAVFLAEIVGDKLLYTTGVLAARYRTA |
Ga0181506_11311471 | 3300019260 | Peatland | MTAVLFATFGAVFVAEIVGDKLLYTTGVLTTRYRTAPVI |
Ga0193722_11305402 | 3300019877 | Soil | MIAIFLATYGAVFLAEIAGDKLLYTTGVLTTRFRTVPVMIGVSLA |
Ga0210388_111974052 | 3300021181 | Soil | MLTIFFATYGVVFAAEIVGDKLLYTTGVLAARYSP |
Ga0126371_132954892 | 3300021560 | Tropical Forest Soil | MLPVLFATYGAVFVAEIVGDKLLYTTGVLANRYRAVPIMFGMALAFI |
Ga0213853_112642612 | 3300021861 | Watersheds | MLALFFATYGAVFLAEIVGDKLLYTTGVLATRYRTVPIMVGMGIAFM |
Ga0242641_10513461 | 3300022499 | Soil | MFAILLATYGAVFVAEIVGDKLLYTTGVLATRYKTVPILMG |
Ga0242676_10029311 | 3300022512 | Soil | MLPIFLATYGAVFVAEIVGDKLLYTTGVLAARYRTVP |
Ga0242675_10931572 | 3300022718 | Soil | MLPIFLATYGAVFVAEIVGDKLLYTTGVLAARYRTV |
Ga0207701_104597711 | 3300025930 | Corn, Switchgrass And Miscanthus Rhizosphere | LLIFFTTFGTVFVAEIVGDKLLYTTGVLAARYRTLPITL |
Ga0207644_112847482 | 3300025931 | Switchgrass Rhizosphere | MLVVFFATFGAVFLAEIVGDKLLYTTGVLASRYRTAPIMI |
Ga0207668_112679601 | 3300025972 | Switchgrass Rhizosphere | MLAALLATYAAVFLAEIVGDKLLYTTGILATRYRPLPIMI |
Ga0209248_102570712 | 3300027729 | Bog Forest Soil | MIAILFATYGAVFVAEIVGDKLLYTTGVLAARFRIGTVVVGVLL |
Ga0209069_101553653 | 3300027915 | Watersheds | MLAIILATFAAVFIAEIVGDKLLYTTGVLAARYSTLPI |
Ga0268265_113227572 | 3300028380 | Switchgrass Rhizosphere | MLAALLATYAAVFLAEIVGDKLLYTTGILATRYRPLPIMIRITAAFM |
Ga0268264_124057721 | 3300028381 | Switchgrass Rhizosphere | MLSIFLATYGAVFIAEIVGDKLLYTTGVLATRYRSASIMLGMALAFC |
Ga0137415_110320952 | 3300028536 | Vadose Zone Soil | MRSLLLAAYVTVFAAEIVGDKLLYTTGVLAAQYPRAPLLFGMALAFMVKMG |
Ga0302157_105940522 | 3300028813 | Bog | MLPILLATYGTVFVAEIVGDKLLYTTGVLATRYRWGPILCGM |
Ga0222749_106213831 | 3300029636 | Soil | MLAVFLATYGAVFVAEIVGDKLLYTTGVLATRYRLVS |
Ga0247028_11098312 | 3300029894 | Cryconite | MIPILLATYGAVFVAEIVGDKLLYTTGVLATRYRT |
Ga0311329_110511772 | 3300029907 | Bog | MLSIFFATYAAVFLAEIVGDKLLYTTGVLATRYRTTSV |
Ga0311363_105461251 | 3300029922 | Fen | MIPILLATYTAVFVAEIVGDKLLYTTGVLATRYRTA |
Ga0311343_103936811 | 3300029953 | Bog | MLPILLATYGTVFVAEIVGDKLLYTTGVLATRYRWGPI |
Ga0302283_11588871 | 3300029994 | Fen | MIPILFATYGAVFVAEIVGDKLLYTTGVLATRYRTV |
Ga0311338_119157511 | 3300030007 | Palsa | MLPIFFATYSAVFIAEIVGDKLLYTTGVLAARYRTIPIM |
Ga0302275_100260414 | 3300030518 | Bog | MWAILLATYGAVFVAEIVGDKLLYTTGVLATRNRTVP |
Ga0311354_105869463 | 3300030618 | Palsa | MLPIFFATYAAVFMAEIVGDKLLYTTGLLATRYKTFPILLGMA |
Ga0302287_102246951 | 3300030673 | Fen | MLAIFLAAYAAVFIAEIVGDKLLYTSGILATRFRWGAV |
Ga0302325_128450372 | 3300031234 | Palsa | MLAVLLATYGAVFVAEIVCDKHLYKNGVLASREPTVPIILGMLIALM |
Ga0302324_1031981582 | 3300031236 | Palsa | MIAILFATYGAVFVAEIVGDKLLYTTGVLATRYRTLPIML |
Ga0302320_117827161 | 3300031524 | Bog | MIAIFIATYGAVFVAEIVGDKLLYTTGVLATRYRTMPIMIGMLI |
Ga0302326_101236735 | 3300031525 | Palsa | MLAIFIGTYVAVFVAEIVGDKLLYTTGVLATRYKT |
Ga0302326_111574242 | 3300031525 | Palsa | MFPILFETYGVVFVAEIVGDKLLYTTGVLATRYRTAPILFG |
Ga0302326_114589821 | 3300031525 | Palsa | MFPIFLATYGAVFVAEIVGDKLLYTTGVLAARYRTVPI |
Ga0302326_120248442 | 3300031525 | Palsa | MLPIFLATYGAVFVAEIVGDKLLYTTGVLATKYKTIPIMFGMA |
Ga0310686_1043884551 | 3300031708 | Soil | MFPILFATYVAVFVAEIVGDKLLYTTGVLATRYRTTPILFGM |
Ga0307476_110996392 | 3300031715 | Hardwood Forest Soil | MIPLFLLTYGAVFVAEIVGDKLLYTTGVLATRYRTAPIVI |
Ga0310813_117909172 | 3300031716 | Soil | MWTIFFATYGAVFLAEIVGDKLLYTTGVLATRYRWG |
Ga0302321_1029467772 | 3300031726 | Fen | MLPILLAAYGAVFVAEITGDKLLYTTSVLATRYRAAPILCGM |
Ga0302319_100598201 | 3300031788 | Bog | VLSIFFATYAAVFIAEIVGDKLLYTTGVLATRYRTASVMV |
Ga0307473_111384102 | 3300031820 | Hardwood Forest Soil | MLIIFFTTFGTVFVAEIVGDKLLYTTSVLAARYRTIPI |
Ga0307478_110452421 | 3300031823 | Hardwood Forest Soil | MLTIFFATYGAVFVAEIVGDKLLYTTGVLATRYRTVPIMIGMA |
Ga0307478_112508892 | 3300031823 | Hardwood Forest Soil | MLPIFLATYGAVFVAEIVGDKLLYTTGVLAARYRTVPIMLGMA |
Ga0310906_112685071 | 3300032013 | Soil | MAAIFFGTYGAVFVAEVVGDKLLYTTGVLATRYRSLSIVVGM |
Ga0335079_110419622 | 3300032783 | Soil | MLPIFLATYSAVFIAEIVGDKLLYTTGVLAARYRTLPI |
Ga0335078_117953831 | 3300032805 | Soil | MLPIFLATYGTVFVAEIVGDKLLYTTGVLATRYRTLPVMCGM |
Ga0335080_105200923 | 3300032828 | Soil | MIPILLATYGAVFIAEIVGDKLLYTTGVLATRYRTTPILI |
Ga0335084_110918621 | 3300033004 | Soil | MLPIFFATYGAVFVAEIVGDKLLYTTGVLATRYRTVP |
Ga0335073_118150872 | 3300033134 | Soil | MLPIFFATYGTVFMAEIVGDKLLYTTGVLATRYKTV |
Ga0334792_095341_2_106 | 3300033888 | Soil | MFAILLATYVAVFAAEIVGDKLLYTTGVLATRYRT |
Ga0370492_0459287_1_117 | 3300034282 | Untreated Peat Soil | MLPILFATYGAVFIAEIAGDKLLYTTGVLAARYRTAPIL |
⦗Top⦘ |