


| Basic Information | |
|---|---|
| Family ID | F080621 |
| Family Type | Metagenome |
| Number of Sequences | 115 |
| Average Sequence Length | 45 residues |
| Representative Sequence | MQTITEIIADLSIDIACLLDEPSEVTEQDLIKMQDLITKLENQ |
| Number of Associated Samples | 81 |
| Number of Associated Scaffolds | 115 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | No |
| Most common taxonomic group | Unclassified |
| % of genes with valid RBS motifs | 14.78 % |
| % of genes near scaffold ends (potentially truncated) | 30.43 % |
| % of genes from short scaffolds (< 2000 bps) | 70.43 % |
| Associated GOLD sequencing projects | 67 |
| AlphaFold2 3D model prediction | No |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Unclassified (61.739 % of family members) |
| NCBI Taxonomy ID | N/A |
| Taxonomy | N/A |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Aquatic → Marine → Oceanic → Unclassified → Marine (40.000 % of family members) |
| Environment Ontology (ENVO) | Unclassified (86.087 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Saline → Water (saline) (93.043 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 72.09% β-sheet: 0.00% Coil/Unstructured: 27.91% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 115 Family Scaffolds |
|---|---|---|
| PF07486 | Hydrolase_2 | 11.30 |
| PF05496 | RuvB_N | 1.74 |
| PF03796 | DnaB_C | 0.87 |
| PF03237 | Terminase_6N | 0.87 |
| PF12705 | PDDEXK_1 | 0.87 |
| PF06067 | DUF932 | 0.87 |
| COG ID | Name | Functional Category | % Frequency in 115 Family Scaffolds |
|---|---|---|---|
| COG3773 | Cell wall hydrolase CwlJ, involved in spore germination | Cell cycle control, cell division, chromosome partitioning [D] | 11.30 |
| COG2255 | Holliday junction resolvasome RuvABC, ATP-dependent DNA helicase subunit RuvB | Replication, recombination and repair [L] | 1.74 |
| COG0305 | Replicative DNA helicase | Replication, recombination and repair [L] | 0.87 |
| COG1066 | DNA repair protein RadA/Sms, contains AAA+ ATPase domain | Replication, recombination and repair [L] | 0.87 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| Unclassified | root | N/A | 61.74 % |
| All Organisms | root | All Organisms | 38.26 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300000116|DelMOSpr2010_c10020286 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfuromonadales → Geobacteraceae → unclassified Geobacteraceae → Geobacteraceae bacterium | 3250 | Open in IMG/M |
| 3300000116|DelMOSpr2010_c10032270 | Not Available | 2436 | Open in IMG/M |
| 3300000116|DelMOSpr2010_c10058238 | All Organisms → Viruses → Predicted Viral | 1641 | Open in IMG/M |
| 3300000116|DelMOSpr2010_c10097013 | Not Available | 1121 | Open in IMG/M |
| 3300000149|LPaug09P1610mDRAFT_c1015535 | Not Available | 973 | Open in IMG/M |
| 3300001347|JGI20156J14371_10036990 | Not Available | 2268 | Open in IMG/M |
| 3300001450|JGI24006J15134_10090323 | Not Available | 1122 | Open in IMG/M |
| 3300001450|JGI24006J15134_10198242 | Not Available | 615 | Open in IMG/M |
| 3300001450|JGI24006J15134_10237692 | Not Available | 531 | Open in IMG/M |
| 3300001460|JGI24003J15210_10047604 | Not Available | 1447 | Open in IMG/M |
| 3300001460|JGI24003J15210_10069410 | Not Available | 1103 | Open in IMG/M |
| 3300001472|JGI24004J15324_10042114 | All Organisms → Viruses → Predicted Viral | 1406 | Open in IMG/M |
| 3300001472|JGI24004J15324_10100274 | Not Available | 745 | Open in IMG/M |
| 3300001472|JGI24004J15324_10131348 | Not Available | 601 | Open in IMG/M |
| 3300001589|JGI24005J15628_10077540 | Not Available | 1180 | Open in IMG/M |
| 3300001589|JGI24005J15628_10096855 | All Organisms → Viruses → Predicted Viral | 1000 | Open in IMG/M |
| 3300001589|JGI24005J15628_10168733 | Not Available | 644 | Open in IMG/M |
| 3300001589|JGI24005J15628_10204790 | Not Available | 551 | Open in IMG/M |
| 3300001589|JGI24005J15628_10208639 | Not Available | 542 | Open in IMG/M |
| 3300001718|JGI24523J20078_1003208 | Not Available | 2661 | Open in IMG/M |
| 3300002488|JGI25128J35275_1090365 | Not Available | 623 | Open in IMG/M |
| 3300004448|Ga0065861_1003331 | Not Available | 1504 | Open in IMG/M |
| 3300004448|Ga0065861_1003359 | Not Available | 887 | Open in IMG/M |
| 3300004461|Ga0066223_1001599 | Not Available | 564 | Open in IMG/M |
| 3300004461|Ga0066223_1005288 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Rhodospirillaceae → unclassified Rhodospirillaceae → Rhodospirillaceae bacterium | 1399 | Open in IMG/M |
| 3300005941|Ga0070743_10208642 | Not Available | 640 | Open in IMG/M |
| 3300006026|Ga0075478_10007398 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 3805 | Open in IMG/M |
| 3300006810|Ga0070754_10022732 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfuromonadales → Geobacteraceae → unclassified Geobacteraceae → Geobacteraceae bacterium | 3621 | Open in IMG/M |
| 3300006810|Ga0070754_10024394 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfuromonadales → Geobacteraceae → unclassified Geobacteraceae → Geobacteraceae bacterium | 3472 | Open in IMG/M |
| 3300006810|Ga0070754_10062324 | All Organisms → cellular organisms → Bacteria | 1927 | Open in IMG/M |
| 3300006867|Ga0075476_10175237 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 791 | Open in IMG/M |
| 3300006868|Ga0075481_10020841 | All Organisms → cellular organisms → Bacteria | 2587 | Open in IMG/M |
| 3300006916|Ga0070750_10291223 | Not Available | 700 | Open in IMG/M |
| 3300007345|Ga0070752_1151253 | Not Available | 954 | Open in IMG/M |
| 3300007346|Ga0070753_1085874 | Not Available | 1243 | Open in IMG/M |
| 3300007540|Ga0099847_1220865 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 549 | Open in IMG/M |
| 3300007972|Ga0105745_1324560 | Not Available | 507 | Open in IMG/M |
| 3300009071|Ga0115566_10129873 | Not Available | 1591 | Open in IMG/M |
| 3300009074|Ga0115549_1067563 | Not Available | 1238 | Open in IMG/M |
| 3300009076|Ga0115550_1134437 | Not Available | 878 | Open in IMG/M |
| 3300009080|Ga0102815_10054064 | All Organisms → Viruses → Predicted Viral | 2196 | Open in IMG/M |
| 3300009193|Ga0115551_1295186 | Not Available | 709 | Open in IMG/M |
| 3300009422|Ga0114998_10174082 | Not Available | 1029 | Open in IMG/M |
| 3300009422|Ga0114998_10406814 | Not Available | 636 | Open in IMG/M |
| 3300009433|Ga0115545_1263991 | Not Available | 576 | Open in IMG/M |
| 3300009434|Ga0115562_1080644 | Not Available | 1338 | Open in IMG/M |
| 3300009436|Ga0115008_10040431 | All Organisms → cellular organisms → Bacteria | 3662 | Open in IMG/M |
| 3300009436|Ga0115008_10087427 | All Organisms → Viruses → Predicted Viral | 2334 | Open in IMG/M |
| 3300009438|Ga0115559_1020756 | All Organisms → Viruses → Predicted Viral | 3255 | Open in IMG/M |
| 3300009438|Ga0115559_1228281 | Not Available | 665 | Open in IMG/M |
| 3300009442|Ga0115563_1143233 | Not Available | 968 | Open in IMG/M |
| 3300009447|Ga0115560_1019751 | All Organisms → Viruses → Predicted Viral | 3329 | Open in IMG/M |
| 3300009449|Ga0115558_1028316 | Not Available | 2698 | Open in IMG/M |
| 3300009497|Ga0115569_10455718 | Not Available | 546 | Open in IMG/M |
| 3300009512|Ga0115003_10637104 | Not Available | 621 | Open in IMG/M |
| 3300009785|Ga0115001_10228168 | Not Available | 1197 | Open in IMG/M |
| 3300009785|Ga0115001_10566470 | Not Available | 696 | Open in IMG/M |
| 3300009785|Ga0115001_10949183 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 516 | Open in IMG/M |
| 3300014818|Ga0134300_1035087 | All Organisms → Viruses → Predicted Viral | 1015 | Open in IMG/M |
| 3300017697|Ga0180120_10168912 | Not Available | 919 | Open in IMG/M |
| 3300017710|Ga0181403_1009103 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Rhodospirillaceae → unclassified Rhodospirillaceae → Rhodospirillaceae bacterium | 2145 | Open in IMG/M |
| 3300017720|Ga0181383_1047863 | Not Available | 1147 | Open in IMG/M |
| 3300017720|Ga0181383_1128740 | Not Available | 679 | Open in IMG/M |
| 3300017728|Ga0181419_1006159 | Not Available | 3680 | Open in IMG/M |
| 3300017732|Ga0181415_1094947 | Not Available | 672 | Open in IMG/M |
| 3300017740|Ga0181418_1073399 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 838 | Open in IMG/M |
| 3300017741|Ga0181421_1071129 | Not Available | 914 | Open in IMG/M |
| 3300017751|Ga0187219_1186871 | Not Available | 579 | Open in IMG/M |
| 3300017759|Ga0181414_1034961 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1357 | Open in IMG/M |
| 3300017770|Ga0187217_1018167 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfuromonadales → Geobacteraceae → unclassified Geobacteraceae → Geobacteraceae bacterium | 2532 | Open in IMG/M |
| 3300017786|Ga0181424_10389068 | Not Available | 568 | Open in IMG/M |
| 3300020175|Ga0206124_10004455 | Not Available | 9504 | Open in IMG/M |
| 3300021335|Ga0213867_1002064 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 8960 | Open in IMG/M |
| 3300022069|Ga0212026_1037628 | Not Available | 720 | Open in IMG/M |
| 3300022074|Ga0224906_1000637 | Not Available | 18954 | Open in IMG/M |
| 3300022178|Ga0196887_1004758 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 4957 | Open in IMG/M |
| 3300022187|Ga0196899_1139995 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Rhizobiaceae | 681 | Open in IMG/M |
| (restricted) 3300023210|Ga0233412_10092042 | All Organisms → Viruses → Predicted Viral | 1267 | Open in IMG/M |
| 3300024346|Ga0244775_10071616 | All Organisms → Viruses → unclassified viruses → unclassified DNA viruses → unclassified dsDNA viruses → Prokaryotic dsDNA virus sp. | 2970 | Open in IMG/M |
| 3300025048|Ga0207905_1007019 | All Organisms → Viruses → Predicted Viral | 2060 | Open in IMG/M |
| 3300025071|Ga0207896_1004144 | Not Available | 2682 | Open in IMG/M |
| 3300025079|Ga0207890_1000419 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 12807 | Open in IMG/M |
| 3300025120|Ga0209535_1013200 | All Organisms → cellular organisms → Bacteria | 4512 | Open in IMG/M |
| 3300025120|Ga0209535_1028192 | All Organisms → Viruses → Predicted Viral | 2696 | Open in IMG/M |
| 3300025120|Ga0209535_1117582 | Not Available | 912 | Open in IMG/M |
| 3300025120|Ga0209535_1154470 | Not Available | 717 | Open in IMG/M |
| 3300025132|Ga0209232_1033416 | Not Available | 1957 | Open in IMG/M |
| 3300025137|Ga0209336_10106748 | Not Available | 783 | Open in IMG/M |
| 3300025137|Ga0209336_10153353 | Not Available | 607 | Open in IMG/M |
| 3300025138|Ga0209634_1048247 | Not Available | 2120 | Open in IMG/M |
| 3300025138|Ga0209634_1050772 | Not Available | 2049 | Open in IMG/M |
| 3300025138|Ga0209634_1167324 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Acidiferrobacterales → Acidiferrobacteraceae → Acidiferrobacter → unclassified Acidiferrobacter → Acidiferrobacter sp. | 877 | Open in IMG/M |
| 3300025168|Ga0209337_1018809 | All Organisms → cellular organisms → Bacteria | 4079 | Open in IMG/M |
| 3300025168|Ga0209337_1137259 | Not Available | 1078 | Open in IMG/M |
| 3300025508|Ga0208148_1070837 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 808 | Open in IMG/M |
| 3300025620|Ga0209405_1160969 | Not Available | 568 | Open in IMG/M |
| 3300025654|Ga0209196_1008095 | Not Available | 5150 | Open in IMG/M |
| 3300025654|Ga0209196_1027325 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodobacterales → Rhodobacteraceae → Tabrizicola | 2142 | Open in IMG/M |
| 3300025671|Ga0208898_1089020 | Not Available | 970 | Open in IMG/M |
| 3300025769|Ga0208767_1136155 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 917 | Open in IMG/M |
| 3300025853|Ga0208645_1064059 | All Organisms → Viruses → Predicted Viral | 1678 | Open in IMG/M |
| 3300025853|Ga0208645_1178425 | Not Available | 775 | Open in IMG/M |
| 3300025860|Ga0209119_1185699 | Not Available | 821 | Open in IMG/M |
| 3300027687|Ga0209710_1255644 | Not Available | 564 | Open in IMG/M |
| 3300027687|Ga0209710_1279668 | Not Available | 526 | Open in IMG/M |
| 3300027753|Ga0208305_10234482 | Not Available | 654 | Open in IMG/M |
| 3300027788|Ga0209711_10295481 | Not Available | 702 | Open in IMG/M |
| 3300027791|Ga0209830_10033616 | All Organisms → cellular organisms → Bacteria | 2848 | Open in IMG/M |
| 3300031621|Ga0302114_10089142 | All Organisms → Viruses → Predicted Viral | 1437 | Open in IMG/M |
| 3300031621|Ga0302114_10191913 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfuromonadales → Geobacteraceae → unclassified Geobacteraceae → Geobacteraceae bacterium | 865 | Open in IMG/M |
| 3300031621|Ga0302114_10249913 | Not Available | 718 | Open in IMG/M |
| 3300031626|Ga0302121_10029793 | All Organisms → Viruses → Predicted Viral | 1791 | Open in IMG/M |
| 3300032254|Ga0316208_1081914 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → Flammeovirgaceae → unclassified Flammeovirgaceae → Flammeovirgaceae bacterium | 848 | Open in IMG/M |
| 3300032277|Ga0316202_10031570 | All Organisms → Viruses → unclassified viruses → unclassified DNA viruses → unclassified dsDNA viruses → Prokaryotic dsDNA virus sp. | 2545 | Open in IMG/M |
| 3300033742|Ga0314858_098096 | Not Available | 742 | Open in IMG/M |
Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Marine | Environmental → Aquatic → Marine → Oceanic → Unclassified → Marine | 40.00% |
| Aqueous | Environmental → Aquatic → Marine → Coastal → Unclassified → Aqueous | 15.65% |
| Pelagic Marine | Environmental → Aquatic → Marine → Pelagic → Unclassified → Pelagic Marine | 13.04% |
| Seawater | Environmental → Aquatic → Marine → Strait → Unclassified → Seawater | 10.43% |
| Marine | Environmental → Aquatic → Marine → Coastal → Unclassified → Marine | 4.35% |
| Marine | Environmental → Aquatic → Marine → Neritic Zone → Unclassified → Marine | 3.48% |
| Microbial Mat | Environmental → Aquatic → Marine → Coastal → Sediment → Microbial Mat | 1.74% |
| Estuarine | Environmental → Aquatic → Marine → Intertidal Zone → Estuary → Estuarine | 1.74% |
| Estuarine | Environmental → Aquatic → Marine → Unclassified → Unclassified → Estuarine | 1.74% |
| Pelagic Marine | Environmental → Aquatic → Marine → Neritic Zone → Unclassified → Pelagic Marine | 1.74% |
| Marine | Environmental → Aquatic → Marine → Oceanic → Photic Zone → Marine | 0.87% |
| Seawater | Environmental → Aquatic → Marine → Inlet → Unclassified → Seawater | 0.87% |
| Seawater | Environmental → Aquatic → Marine → Coastal → Unclassified → Seawater | 0.87% |
| Freshwater To Marine Saline Gradient | Environmental → Aquatic → Marine → Coastal → Unclassified → Freshwater To Marine Saline Gradient | 0.87% |
| Estuary Water | Environmental → Aquatic → Marine → Coastal → Unclassified → Estuary Water | 0.87% |
| Sea-Ice Brine | Environmental → Aquatic → Marine → Coastal → Unclassified → Sea-Ice Brine | 0.87% |
| Seawater | Environmental → Aquatic → Marine → Pelagic → Unclassified → Seawater | 0.87% |
| Visualization |
|---|
| Powered by ApexCharts |
Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300000116 | Marine microbial communities from Delaware Coast, sample from Delaware MO Spring March 2010 | Environmental | Open in IMG/M |
| 3300000149 | Marine microbial communities from expanding oxygen minimum zones in Line P, North Pacific Ocean - August 2009 P16 10m | Environmental | Open in IMG/M |
| 3300001347 | Pelagic Microbial community sample from North Sea - COGITO 998_met_06 | Environmental | Open in IMG/M |
| 3300001450 | Marine viral communities from the Pacific Ocean - LP-53 | Environmental | Open in IMG/M |
| 3300001460 | Marine viral communities from the Pacific Ocean - LP-28 | Environmental | Open in IMG/M |
| 3300001472 | Marine viral communities from the Pacific Ocean - LP-32 | Environmental | Open in IMG/M |
| 3300001589 | Marine viral communities from the Pacific Ocean - LP-40 | Environmental | Open in IMG/M |
| 3300001718 | Marine viral communities from the Pacific Ocean - LP-48 | Environmental | Open in IMG/M |
| 3300002488 | Marine viral communities from the Pacific Ocean - ETNP_2_60 | Environmental | Open in IMG/M |
| 3300004448 | Marine viral communities from Newfoundland, Canada BC-1 | Environmental | Open in IMG/M |
| 3300004461 | Marine viral communities from Newfoundland, Canada BC-2 | Environmental | Open in IMG/M |
| 3300005941 | Estuarine microbial communities from the Columbia River estuary, USA - metaG S.697 | Environmental | Open in IMG/M |
| 3300006026 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_29_D_<0.8_DNA | Environmental | Open in IMG/M |
| 3300006810 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Sep_01 | Environmental | Open in IMG/M |
| 3300006867 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_22_N_<0.8_DNA | Environmental | Open in IMG/M |
| 3300006868 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_29_N_>0.8_DNA | Environmental | Open in IMG/M |
| 3300006916 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_24 | Environmental | Open in IMG/M |
| 3300007345 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Aug_30 | Environmental | Open in IMG/M |
| 3300007346 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Aug_31 | Environmental | Open in IMG/M |
| 3300007540 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1504_2 Viral MetaG | Environmental | Open in IMG/M |
| 3300007972 | Coastal water column microbial communities from Columbia River Estuary, Oregon, USA - CMOP_DNA_1460ABC_3.0um | Environmental | Open in IMG/M |
| 3300009071 | Pelagic marine microbial communities from North Sea - COGITO_mtgs_120405 | Environmental | Open in IMG/M |
| 3300009074 | Pelagic marine microbial communities from North Sea - COGITO_mtgs_100430 | Environmental | Open in IMG/M |
| 3300009076 | Pelagic marine microbial communities from North Sea - COGITO_mtgs_100511 | Environmental | Open in IMG/M |
| 3300009080 | Estuarine microbial communities from the Columbia River estuary - Ebb tide ETM metaG S.759 | Environmental | Open in IMG/M |
| 3300009193 | Pelagic marine microbial communities from North Sea - COGITO_mtgs_110321 | Environmental | Open in IMG/M |
| 3300009422 | Marine microbial communities from western Arctic Ocean - ArcticOcean_MG_CB4_138 | Environmental | Open in IMG/M |
| 3300009433 | Pelagic marine microbial communities from North Sea - COGITO_mtgs_100330 | Environmental | Open in IMG/M |
| 3300009434 | Pelagic marine microbial communities from North Sea - COGITO_mtgs_110516 | Environmental | Open in IMG/M |
| 3300009436 | Marine eukaryotic phytoplankton communities from Arctic Ocean - Fram Strait ARC3M Metagenome | Environmental | Open in IMG/M |
| 3300009438 | Pelagic marine microbial communities from North Sea - COGITO_mtgs_110506 | Environmental | Open in IMG/M |
| 3300009442 | Pelagic marine microbial communities from North Sea - COGITO_mtgs_110519 | Environmental | Open in IMG/M |
| 3300009447 | Pelagic marine microbial communities from North Sea - COGITO_mtgs_110509 | Environmental | Open in IMG/M |
| 3300009449 | Pelagic marine microbial communities from North Sea - COGITO_mtgs_110426 | Environmental | Open in IMG/M |
| 3300009497 | Pelagic marine microbial communities from North Sea - COGITO_mtgs_120503 | Environmental | Open in IMG/M |
| 3300009512 | Marine microbial communities from western Arctic Ocean - ArcticOcean_MG_CB11_88 | Environmental | Open in IMG/M |
| 3300009785 | Marine microbial communities from western Arctic Ocean - ArcticOcean_MG_CB8_130 | Environmental | Open in IMG/M |
| 3300014818 | Marine microbial communities to study oil droplet degradation from Trondheimsfjord, Norway - 0152 : 8 days incubation | Environmental | Open in IMG/M |
| 3300017697 | Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Spr_31_0.2_DNA (version 2) | Environmental | Open in IMG/M |
| 3300017710 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 26 SPOT_SRF_2011-09-28 | Environmental | Open in IMG/M |
| 3300017720 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 6 SPOT_SRF_2009-12-23 | Environmental | Open in IMG/M |
| 3300017728 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 42 SPOT_SRF_2013-04-24 | Environmental | Open in IMG/M |
| 3300017732 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 38 SPOT_SRF_2012-12-11 | Environmental | Open in IMG/M |
| 3300017740 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 41 SPOT_SRF_2013-03-13 | Environmental | Open in IMG/M |
| 3300017741 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 44 SPOT_SRF_2013-06-19 | Environmental | Open in IMG/M |
| 3300017751 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 13 SPOT_SRF_2010-07-21 (version 2) | Environmental | Open in IMG/M |
| 3300017759 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 37 SPOT_SRF_2012-11-28 | Environmental | Open in IMG/M |
| 3300017770 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 15 SPOT_SRF_2010-09-15 (version 2) | Environmental | Open in IMG/M |
| 3300017786 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 47 SPOT_SRF_2013-09-18 | Environmental | Open in IMG/M |
| 3300020175 | Pelagic subsurface seawater microbial communities from Kabeltonne, Helgoland, North Sea - Helgoland_Spring_Bloom_20160321_2 | Environmental | Open in IMG/M |
| 3300021335 | Coastal seawater microbial communities near Pivers Island, North Carolina, United States - PICO540 | Environmental | Open in IMG/M |
| 3300022069 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Aug_30 (v2) | Environmental | Open in IMG/M |
| 3300022074 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 56 SPOT_SRF_2014-09-10 (v2) | Environmental | Open in IMG/M |
| 3300022178 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Mar_31 (v3) | Environmental | Open in IMG/M |
| 3300022187 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Sep_01 (v3) | Environmental | Open in IMG/M |
| 3300023210 (restricted) | Seawater microbial communities from Saanich Inlet, British Columbia, Canada - Na_anoxic_4_MG | Environmental | Open in IMG/M |
| 3300024346 | Whole water sample coassembly | Environmental | Open in IMG/M |
| 3300025048 | Marine viral communities from the Subarctic Pacific Ocean - LP-49 (SPAdes) | Environmental | Open in IMG/M |
| 3300025071 | Marine viral communities from the Pacific Ocean - LP-36 (SPAdes) | Environmental | Open in IMG/M |
| 3300025079 | Marine viral communities from the Pacific Ocean - LP-48 (SPAdes) | Environmental | Open in IMG/M |
| 3300025120 | Marine viral communities from the Pacific Ocean - LP-28 (SPAdes) | Environmental | Open in IMG/M |
| 3300025132 | Marine viral communities from the Pacific Ocean - ETNP_2_60 (SPAdes) | Environmental | Open in IMG/M |
| 3300025137 | Marine viral communities from the Pacific Ocean - LP-32 (SPAdes) | Environmental | Open in IMG/M |
| 3300025138 | Marine viral communities from the Pacific Ocean - LP-40 (SPAdes) | Environmental | Open in IMG/M |
| 3300025168 | Marine viral communities from the Pacific Ocean - LP-53 (SPAdes) | Environmental | Open in IMG/M |
| 3300025508 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Spr_20_<0.8_DNA (SPAdes) | Environmental | Open in IMG/M |
| 3300025620 | Pelagic marine microbial communities from North Sea - COGITO_mtgs_110516 (SPAdes) | Environmental | Open in IMG/M |
| 3300025654 | Pelagic marine microbial communities from North Sea - COGITO_mtgs_110509 (SPAdes) | Environmental | Open in IMG/M |
| 3300025671 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Mar_4 (SPAdes) | Environmental | Open in IMG/M |
| 3300025769 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Mar_21 (SPAdes) | Environmental | Open in IMG/M |
| 3300025853 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Sep_01 (SPAdes) | Environmental | Open in IMG/M |
| 3300025860 | Pelagic Microbial community sample from North Sea - COGITO 998_met_03 (SPAdes) | Environmental | Open in IMG/M |
| 3300027687 | Marine microbial communities from western Arctic Ocean - ArcticOcean_MG_CB4_138 (SPAdes) | Environmental | Open in IMG/M |
| 3300027753 | Estuarine microbial communities from the Columbia River estuary - Flood tide ETM metaG S.741 (SPAdes) | Environmental | Open in IMG/M |
| 3300027788 | Marine microbial communities from western Arctic Ocean - ArcticOcean_MG_CB11_88 (SPAdes) | Environmental | Open in IMG/M |
| 3300027791 | Marine microbial communities from western Arctic Ocean - ArcticOcean_MG_CB8_130 (SPAdes) | Environmental | Open in IMG/M |
| 3300031621 | Marine microbial communities from Western Arctic Ocean, Canada - AG5_Surface | Environmental | Open in IMG/M |
| 3300031626 | Marine microbial communities from Western Arctic Ocean, Canada - CB21_surface | Environmental | Open in IMG/M |
| 3300032254 | Microbial mat bacterial communities from mineral coupon in-situ incubated in ocean water Damariscotta River, Maine, United States - 3-month chalcopyrite | Environmental | Open in IMG/M |
| 3300032277 | Microbial mat bacterial communities from mineral coupon in-situ incubated in ocean water Damariscotta River, Maine, United States - 3-month pyrrhotite | Environmental | Open in IMG/M |
| 3300033742 | Sea-ice brine viral communities from Beaufort Sea near Barrow, Alaska, United States - 2018 seawater | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
Note: Some of these sequences are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| DelMOSpr2010_1002028610 | 3300000116 | Marine | MENINETIATLSIDIACLLDEPSEVTKDDLLKIQDLVTKLENDTNTP* |
| DelMOSpr2010_100322702 | 3300000116 | Marine | MQTITEIIADLSIDIACLLDEPSELTEQDLIKMQDLITKLDNQ* |
| DelMOSpr2010_100582384 | 3300000116 | Marine | MKKTKEQIEIIDNLSIDIACLLDEPSEVTRQDLIKMQDLITK |
| DelMOSpr2010_100970132 | 3300000116 | Marine | MKKTKEQIEIIANLSIDIACLLDEPSEVTRQDLIKMQDLITKLENQ* |
| LPaug09P1610mDRAFT_10155353 | 3300000149 | Marine | MQTITEIIKDLSLDIDCLIDEPGEATERDLIKIMDRITNLDNQ* |
| JGI20156J14371_100369908 | 3300001347 | Pelagic Marine | MTTETIKDLSIEIACLLDEPSEVTEQDLIKLQDLITKLENSFNTTK* |
| JGI24006J15134_100903233 | 3300001450 | Marine | MQTITEIIKDLSLDIACLLDEPSEVTEQDLIKMQDLITKLDNQ* |
| JGI24006J15134_101982422 | 3300001450 | Marine | MSLFTINDTAQTITEIIDDLSIDVACLLDEPSEVTDRDLIKMQDLITKLENQ* |
| JGI24006J15134_102376922 | 3300001450 | Marine | MKNITEIIADLSINIACLLDEPSEVTKQDLIDLQDTITALENQH* |
| JGI24003J15210_100476042 | 3300001460 | Marine | VKDTVQTITEIIADLSIDIACLLDEPSEVTEQDLIKMQDLITKLDNQ* |
| JGI24003J15210_100694103 | 3300001460 | Marine | MQTITKIIADLSIDIACLLDEPSEVTEQDLIKMQDLITKLDNQ* |
| JGI24004J15324_100421144 | 3300001472 | Marine | MQTITDIIADLSIDIACLLDEPSEVTEQDLIKMQDLITKLDNQ* |
| JGI24004J15324_101002741 | 3300001472 | Marine | ININDTMQTITEIIADLSIDIACLLDEPSEVTEQDLIKMQDLITKLDNQ* |
| JGI24004J15324_101313483 | 3300001472 | Marine | MSLFTINDTAQTITEIIDDLSIDVACLLDEPSEVTERDLIKMQDLITKLENQ* |
| JGI24005J15628_100775402 | 3300001589 | Marine | MQTITEIIAELSIDIACLLDEPGEATERDLIKIMDRITELENQ* |
| JGI24005J15628_100968554 | 3300001589 | Marine | MKNISETIASLSIDIACLLDEPSEVTKDDLLKIQDLVTKLENDTNTP* |
| JGI24005J15628_101687332 | 3300001589 | Marine | MSLFTINDTAQTITEIIDDLSIDVACLLDEPSEVTXRDLIKMQDLITKLENQ* |
| JGI24005J15628_102047902 | 3300001589 | Marine | MQTITEIIADLSIDIACLLDEPSEVTSQDLIKMQDLITKLDNQ* |
| JGI24005J15628_102086391 | 3300001589 | Marine | QTITEIIADLSIDIACLLDEPSEVTEQDLIKIQDLITKLDNQ* |
| JGI24523J20078_10032085 | 3300001718 | Marine | MQTITEIIADLSIDIACLLDEPSEVTEQDLIKMQDLITNLDNQ* |
| JGI25128J35275_10903653 | 3300002488 | Marine | MKKTKEQIEIIANLSIDIACLLDEPSEVTRQDLIKMQDLI |
| Ga0065861_10033314 | 3300004448 | Marine | MQTITEIIADLSIDVACLLDEPSEVTEQDLIKMQDLITKLDNQ* |
| Ga0065861_10033594 | 3300004448 | Marine | MQTITEIIKDLSLDIDCLIDEPGEATERDLIKIMDRITELENQ* |
| Ga0066223_10015992 | 3300004461 | Marine | MKNINETIASLSIDIACLLDEPSEITKDDLLKIQYLITTLENETSHE* |
| Ga0066223_10052881 | 3300004461 | Marine | KNINDTMQTITEIIKDLSLDIDCLIDEPGEATERDLIKIMDRITELENQ* |
| Ga0070743_102086422 | 3300005941 | Estuarine | MKNINEIIADLSINIACLLDEPSEVTKQDLINLQDAITELENQH* |
| Ga0075478_100073988 | 3300006026 | Aqueous | MKNINETIASLSIDIACLLDEPSEVTKDDLLKIQDLVTKLENDTNTP* |
| Ga0070754_100227324 | 3300006810 | Aqueous | MKNINETIASLSIDIACLLDEPSEVTKDDLLKIQDLVTKLENDTQKP* |
| Ga0070754_100243947 | 3300006810 | Aqueous | MKNITEIIADLSINIACLLDEPSEVTKQDLIDLQDTITALENQHEL* |
| Ga0070754_100623243 | 3300006810 | Aqueous | MKNINETIASLSIDIACLLDEPSEVTKDDLLKIQDLVTKLENDTNTP*TN* |
| Ga0075476_101752373 | 3300006867 | Aqueous | MKNINETIASLSIDIACLLDEPSEVTKDDLLKIQDLVTKLE |
| Ga0075481_100208417 | 3300006868 | Aqueous | MQTITEIIKDLSLDIDCLIDEPGEATERDLVKIMDRITELENQ* |
| Ga0070750_102912234 | 3300006916 | Aqueous | QTITEIIADLSIDIACLLDEPSEVTEQDLIKMQDLITKLDNQ* |
| Ga0070752_11512531 | 3300007345 | Aqueous | QPFNHTHKHTMKNINETIASLSIDIACLLDEPSEVTKDDLLKIQDLVTKLENDTQKP* |
| Ga0070753_10858741 | 3300007346 | Aqueous | ETIASLSIDIACLLDEPSEVTKDDLLKIQDLVTKLENDTQKP* |
| Ga0099847_12208652 | 3300007540 | Aqueous | MKNINETIASLSIDIACLLDEPSEVTKDDLLKIQDLVTKLEND |
| Ga0105745_13245601 | 3300007972 | Estuary Water | MENINETIATLSIDIACLLDEPSEVTKDDLLKIQDLVTKLENDTNKP* |
| Ga0115566_101298734 | 3300009071 | Pelagic Marine | MTTETIKDLSIEIACLLDEPSEVTEQDLIKLQDLITKLENSFNPTK* |
| Ga0115549_10675635 | 3300009074 | Pelagic Marine | MNTMTTEIIKDLSIEIACLLDEPSEVTEQDLIKLQDLITKLENQQTPTNQ* |
| Ga0115550_11344373 | 3300009076 | Pelagic Marine | MNTMTTEIIKDLSIEIACLLDEPCEVTEQDLIKLQDLITKLENQQPPTQK* |
| Ga0102815_100540641 | 3300009080 | Estuarine | IIADLSINIACLLDEPSEVTKQDLINLQDAITELENQH* |
| Ga0115551_12951863 | 3300009193 | Pelagic Marine | HQINTMTTETIKDLSIEIACLLDEPSEVTEQDLIKLQDLITKLENSFNPTK* |
| Ga0114998_101740824 | 3300009422 | Marine | MQTITEIIDDLSIDIACLLDEPSEVTEQDLIKMQDLITKLDNQ* |
| Ga0114998_104068142 | 3300009422 | Marine | MQTITEIIADLSIDIACLLDEPSEVTEQDLIKMQDLITKLDNQ* |
| Ga0115545_12639913 | 3300009433 | Pelagic Marine | INTMTTETIKDLSIEIACLLDEPSEVTEQDLIKLQDLITKLENSFNPTK* |
| Ga0115562_10806443 | 3300009434 | Pelagic Marine | MTTEIIKDLSIEIACLLDEPSEVTEQDLIKLQDLITKLENSFNTTK* |
| Ga0115008_100404314 | 3300009436 | Marine | MQTITEIIADLSIDIACLLDEPGEVTEQDLIKMQDLITKLDNQ* |
| Ga0115008_100874271 | 3300009436 | Marine | MQTITEIIADLSIDIACLLDEPSEVTEQDLIKMQDLITK |
| Ga0115559_10207562 | 3300009438 | Pelagic Marine | MTTKIIKDLSIEIACLLDEPSEVTEQDLIKLQDLITKLENSFNPTK* |
| Ga0115559_12282811 | 3300009438 | Pelagic Marine | MTTETIKDLSIEIACLLDEPCEVTEQDLIKLQDLITKL |
| Ga0115563_11432333 | 3300009442 | Pelagic Marine | MNTMTTETIKDLSIEIACLLDEPCEVTEQDLIKLQDLITKLENSFNPTK* |
| Ga0115560_101975110 | 3300009447 | Pelagic Marine | MTTKIIKDLSIEIACLLDEPSEVTEQDLIKLQDLITKLENSFNTTK* |
| Ga0115558_10283162 | 3300009449 | Pelagic Marine | MTTEIIKDLSIEIACLLDEPSEVTEQDLIKLQDLITKLENSFNPTK* |
| Ga0115569_104557183 | 3300009497 | Pelagic Marine | DLSIEIACLLDEPCEVTEQDLIKLQDLITKLENSFNPTK* |
| Ga0115003_106371042 | 3300009512 | Marine | MSLVNINDTAQTITEIIADLSIDIACLLDESSEVTEQDLIKMQDLITKLDN |
| Ga0115001_102281681 | 3300009785 | Marine | TITEIIADLSIDIACLLDEPSEVTEQDLIKMQDLITKLDNQ* |
| Ga0115001_105664702 | 3300009785 | Marine | MSLVNINDTAQTITEIIADLSIDIACLLDESSEVTEQDLIKMQDLITKLDNQ* |
| Ga0115001_109491832 | 3300009785 | Marine | MKSITEIISDLSIDVACLLDEPEDVTKEDLIKMQDSI |
| Ga0134300_10350874 | 3300014818 | Marine | MKSITEIIADLSIDVACLLDEPEDVTKEDLIKMQDSI |
| Ga0180120_101689121 | 3300017697 | Freshwater To Marine Saline Gradient | NKKNINDTMQTITEIIADLSIDIACLLDEPSEVTEQDLIKMQDLITKLDNQ |
| Ga0181403_10091034 | 3300017710 | Seawater | MSLVNINDTAQTITEIIADLSIDIACLLDEPSEVTEQDLIKMQDLITKLDNQ |
| Ga0181383_10478633 | 3300017720 | Seawater | MQTITEIIDDLSIDIACLLDEPSEVTEQDLIKMQDLITKLENQ |
| Ga0181383_11287403 | 3300017720 | Seawater | MENINETISTLSIDIACLLDEPSEVTKDDLIKIQDLITKLENETETKNK |
| Ga0181419_10061599 | 3300017728 | Seawater | MQTITEIIADLSIDIACLLDEPSEVTDQDLIKMQDLITKLDNQ |
| Ga0181415_10949473 | 3300017732 | Seawater | MAASLSPPFNHTHKPPMKNINETIASLSIEIACLLDEPSEVTKDDLLTIQDLVTKLENDTNKP |
| Ga0181418_10733992 | 3300017740 | Seawater | MENINETIATLSIDIACLLDEPSEVTKDDLLKIQDLVTKLENDTNTP |
| Ga0181421_10711291 | 3300017741 | Seawater | EIIADLSIDIACLLDEPSEVTEQDLIKMQDLITKLDNQ |
| Ga0187219_11868712 | 3300017751 | Seawater | MQTITEIIADLSIDIACLLAEPCEVTDQDIIKMQD |
| Ga0181414_10349614 | 3300017759 | Seawater | MKNINETIASLSIEIACLLDEPSEVTKDDLLTIQDLVTKLENDTNKP |
| Ga0187217_10181677 | 3300017770 | Seawater | MKNINETIASLSIDIACLLDEPSEVTKDDLLKIQDLVTKLENDTNKP |
| Ga0181424_103890681 | 3300017786 | Seawater | KKRGSQVKDTVQTITEIIADLSIDIACLLDEPSEVTEQDLIKMQDLITKLDNQ |
| Ga0206124_100044557 | 3300020175 | Seawater | MTTETIKDLSIEIACLLDEPSEVTEQDLIKLQDLITKLENSFNPTK |
| Ga0213867_100206412 | 3300021335 | Seawater | MENINETIATLSIDIACLLDEPSEVTKDDLLKIQDLVTKLENDTNTPXTN |
| Ga0212026_10376282 | 3300022069 | Aqueous | MQTITEIIKDLSLDIDCLIDEPGEATERDLVKIMDRITELENQ |
| Ga0224906_100063722 | 3300022074 | Seawater | MQTITDIIADLSIDIACLLDEPSEVTEQDLIKMQDLITKLDNQ |
| Ga0196887_10047588 | 3300022178 | Aqueous | MKNINETIASLSIDIACLLDEPSEVTKDDLLKIQDLVTKLENDTNTP |
| Ga0196899_11399952 | 3300022187 | Aqueous | MKNINETIASLSIDIACLLDEPSEVTKDDLLKIQDLVTKLENDTQKP |
| (restricted) Ga0233412_100920423 | 3300023210 | Seawater | MKNINEIIADLSINIACLLDEPSEVTKQDLIDLQDAITALENHL |
| Ga0244775_100716167 | 3300024346 | Estuarine | MKNINEIIADLSINIACLLDEPSEVTKQDLINLQDAITELENQH |
| Ga0207905_10070193 | 3300025048 | Marine | MQTITEIIADLSIDIACLLDEPSEVTEQDLIKMQDLITNLDNQ |
| Ga0207896_10041443 | 3300025071 | Marine | MKNISETIASLSIDIACLLDEPSEVTKDDLLKIQDLVTKLENDTNTP |
| Ga0207890_10004193 | 3300025079 | Marine | VKDTVQTITEIIADLSIDIACLLDEPSEVTEQDLIKMQDLITKLDNQ |
| Ga0209535_10132005 | 3300025120 | Marine | MQTITEIIKDLSLDIDCLIDEPGEATERDLIKIMDRITNLDNQ |
| Ga0209535_10281927 | 3300025120 | Marine | MQTITEIIADLSIDIACLLDEPSEVTEQDLIKIQDLITKLDNQ |
| Ga0209535_11175824 | 3300025120 | Marine | NINETIASLSIDIACLLDEPSEVTKDDLLKIQDLVTKLENDTQKP |
| Ga0209535_11544701 | 3300025120 | Marine | MQTITEIIADLSIDIACLLDEPSEVTEQDLIKMQDLITKLD |
| Ga0209232_10334163 | 3300025132 | Marine | MKKTKEQIEIIANLSIDIACLLDEPSEVTRQDLIKMQDLITKLENQ |
| Ga0209336_101067481 | 3300025137 | Marine | TEIIADLSIDIACLLDEPSEVTEQDLIKMQDLITKLDNQ |
| Ga0209336_101533533 | 3300025137 | Marine | MSLFTINDTAQTITEIIDDLSIDVACLLDEPSEVTERDLIKMQDLITKLENQ |
| Ga0209634_10482476 | 3300025138 | Marine | MQTITEIIADLSIDIACLLDEPSEVTSQDLIKMQDLITKLDNQ |
| Ga0209634_10507726 | 3300025138 | Marine | MKNISETIASLSIDIACLLDEPSEVTKDDLLKIQDLVT |
| Ga0209634_11673244 | 3300025138 | Marine | MSLFTINDTAQTITEIIDDLSIDVACLLDEPSEVTDRDLIKMQDLITKLDNQ |
| Ga0209337_10188098 | 3300025168 | Marine | MQTITEIIKDLSLDIACLLDEPSEVTEQDLIKMQDLITKLDNQ |
| Ga0209337_11372592 | 3300025168 | Marine | MKNITEIIADLSINIACLLDEPSEVTKQDLIDLQDTITALENQH |
| Ga0208148_10708372 | 3300025508 | Aqueous | MKNINETIASLSIDIACLLDEPSEVTKDDLLKIQDLVTKLENDT |
| Ga0209405_11609691 | 3300025620 | Pelagic Marine | MTTETIKDLSIEIACLLDEPSEVTEQDLIKLQDLITKLENSFNTTK |
| Ga0209196_10080959 | 3300025654 | Pelagic Marine | MTTKIIKDLSIEIACLLDEPSEVTEQDLIKLQDLITKLENSFNTTK |
| Ga0209196_10273255 | 3300025654 | Pelagic Marine | MNTMTTEIIKDLSIEIACLLDEPCEVTEQDLIKLQDLITKLENQQPPTQK |
| Ga0208898_10890201 | 3300025671 | Aqueous | MKSIKSITEIISDLSIDVACLLDEPEDVTKEDLIKMQDSITE |
| Ga0208767_11361552 | 3300025769 | Aqueous | MKNINETIASLSIDIACLLDEPSEVTKDDLLKIQDLVTKLENDTNTPXTN |
| Ga0208645_10640594 | 3300025853 | Aqueous | MKNITEIIADLSINIACLLDEPSEVTKQDLIDLQDTITALENQHEL |
| Ga0208645_11784252 | 3300025853 | Aqueous | MQTMKNINETIASLSIDIACLLDEPSEVTKDDLLKIQDLVTKLENDTQKP |
| Ga0209119_11856991 | 3300025860 | Pelagic Marine | MTTEIIKDLSIEIACLLDEPSEVTEQDLIKLQDLITKLENSFNTTK |
| Ga0209710_12556442 | 3300027687 | Marine | MQTITEIIDDLSIDIACLLDEPSEVTEQDLIKMQDLITKLDNQ |
| Ga0209710_12796682 | 3300027687 | Marine | MQTITEIIADLSIDIACLLDEPSEVTEQDLIKMQDLITKLNNQ |
| Ga0208305_102344822 | 3300027753 | Estuarine | MKNINEIIADLSINIACLLDEPSEVTKQDLINLQDAITELENQ |
| Ga0209711_102954812 | 3300027788 | Marine | MSLVNINDTAQTITEIIADLSIDIACLLDESSEVTEQDLIKMQDLITKLDNQ |
| Ga0209830_100336163 | 3300027791 | Marine | MQTITEIIKDLSLDIDCLIDEPGEATERDLIKIMDRITELENQ |
| Ga0302114_100891421 | 3300031621 | Marine | MQTITEIIADLSIDIACLLDEPSEVTEQDLIKMQDLI |
| Ga0302114_101919132 | 3300031621 | Marine | MKNMNETIATLSIEIACLLDEPSEITKDDLLKIQDLITTLENETSHE |
| Ga0302114_102499132 | 3300031621 | Marine | NINDTMQTITEIIADLSIDIACLLDEPSEVTEQDLIKMQDLITKLDNQ |
| Ga0302121_100297934 | 3300031626 | Marine | MQTITEIIADLSIDIACLLDEPSEVTEQDLIKMQDLITKLENQ |
| Ga0316208_10819143 | 3300032254 | Microbial Mat | MKNITEMIADLSINIACLLDEPSEVTKQDLIDLQDTITALENQ |
| Ga0316202_100315701 | 3300032277 | Microbial Mat | MIADLSINIACLLDEPSEVTKQDLIDLQDTITALENQ |
| Ga0314858_098096_480_611 | 3300033742 | Sea-Ice Brine | MQTITEIIADLSIDIACLLDEPGEVTEQDLIKMQDLITKLDNQ |
| ⦗Top⦘ |