Basic Information | |
---|---|
Family ID | F080609 |
Family Type | Metagenome / Metatranscriptome |
Number of Sequences | 115 |
Average Sequence Length | 50 residues |
Representative Sequence | KVYSISTNLLLSTFTNQVSFAFNGVKYDLYKYADGKFATVDGDVRLIKLE |
Number of Associated Samples | 93 |
Number of Associated Scaffolds | 115 |
Quality Assessment | |
---|---|
Transcriptomic Evidence | Yes |
Most common taxonomic group | Viruses |
% of genes with valid RBS motifs | 0.00 % |
% of genes near scaffold ends (potentially truncated) | 98.26 % |
% of genes from short scaffolds (< 2000 bps) | 83.48 % |
Associated GOLD sequencing projects | 88 |
AlphaFold2 3D model prediction | Yes |
3D model pTM-score | 0.31 |
Hidden Markov Model |
---|
Powered by Skylign |
Most Common Taxonomy | |
---|---|
Group | Duplodnaviria (85.217 % of family members) |
NCBI Taxonomy ID | 2731341 |
Taxonomy | All Organisms → Viruses → Duplodnaviria |
Most Common Ecosystem | |
---|---|
GOLD Ecosystem | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater (42.609 % of family members) |
Environment Ontology (ENVO) | Unclassified (67.826 % of family members) |
Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Water (non-saline) (62.609 % of family members) |
⦗Top⦘ |
⦗Top⦘ |
Predicted Topology & Secondary Structure | |||||
---|---|---|---|---|---|
Classification: | Globular | Signal Peptide: | Yes | Secondary Structure distribution: | α-helix: 0.00% β-sheet: 15.38% Coil/Unstructured: 84.62% | Feature Viewer |
|
|||||
Powered by Feature Viewer |
Structure Viewer | |
---|---|
| |
Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.31 |
Powered by PDBe Molstar |
⦗Top⦘ |
Pfam ID | Name | % Frequency in 115 Family Scaffolds |
---|---|---|
PF05105 | Phage_holin_4_1 | 70.43 |
PF01520 | Amidase_3 | 6.09 |
PF01391 | Collagen | 3.48 |
PF10108 | DNA_pol_B_exo2 | 1.74 |
PF01471 | PG_binding_1 | 1.74 |
PF00149 | Metallophos | 0.87 |
PF13884 | Peptidase_S74 | 0.87 |
PF01467 | CTP_transf_like | 0.87 |
PF01510 | Amidase_2 | 0.87 |
COG ID | Name | Functional Category | % Frequency in 115 Family Scaffolds |
---|---|---|---|
COG4824 | Phage-related holin (Lysis protein) | Mobilome: prophages, transposons [X] | 70.43 |
COG0860 | N-acetylmuramoyl-L-alanine amidase | Cell wall/membrane/envelope biogenesis [M] | 6.09 |
⦗Top⦘ |
Name | Rank | Taxonomy | Distribution |
All Organisms | root | All Organisms | 89.57 % |
Unclassified | root | N/A | 10.43 % |
Visualization |
---|
Powered by ApexCharts |
Scaffold | Taxonomy | Length | IMG/M Link |
---|---|---|---|
3300001533|MLSed_10363351 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 861 | Open in IMG/M |
3300002195|metazooDRAFT_1228581 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 926 | Open in IMG/M |
3300002202|metazooDRAFT_1254328 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 630 | Open in IMG/M |
3300002278|B570J29590_109055 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 569 | Open in IMG/M |
3300002835|B570J40625_101345609 | Not Available | 591 | Open in IMG/M |
3300005528|Ga0068872_10734739 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 517 | Open in IMG/M |
3300005581|Ga0049081_10119096 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 977 | Open in IMG/M |
3300005581|Ga0049081_10122379 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 962 | Open in IMG/M |
3300005581|Ga0049081_10268323 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 595 | Open in IMG/M |
3300005581|Ga0049081_10273450 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 587 | Open in IMG/M |
3300005613|Ga0074649_1126252 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 873 | Open in IMG/M |
3300007304|Ga0102689_1824000 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1616 | Open in IMG/M |
3300007541|Ga0099848_1055298 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1590 | Open in IMG/M |
3300007542|Ga0099846_1164556 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 794 | Open in IMG/M |
3300008265|Ga0114361_1027455 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1968 | Open in IMG/M |
3300008450|Ga0114880_1210967 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 641 | Open in IMG/M |
3300009081|Ga0105098_10685987 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 542 | Open in IMG/M |
3300009085|Ga0105103_10524395 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 667 | Open in IMG/M |
3300009152|Ga0114980_10060944 | All Organisms → cellular organisms → Archaea → unclassified Archaea → archaeon | 2277 | Open in IMG/M |
3300009159|Ga0114978_10369006 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 865 | Open in IMG/M |
3300009160|Ga0114981_10730941 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 523 | Open in IMG/M |
3300009165|Ga0105102_10914086 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 507 | Open in IMG/M |
3300009170|Ga0105096_10627279 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 566 | Open in IMG/M |
3300009180|Ga0114979_10046859 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp. 197 | 2713 | Open in IMG/M |
3300009180|Ga0114979_10321798 | Not Available | 916 | Open in IMG/M |
3300009184|Ga0114976_10483996 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 639 | Open in IMG/M |
3300009451|Ga0127402_1120073 | Not Available | 539 | Open in IMG/M |
3300009466|Ga0126448_1050408 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 960 | Open in IMG/M |
3300009469|Ga0127401_1055102 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1112 | Open in IMG/M |
3300009469|Ga0127401_1098027 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 777 | Open in IMG/M |
3300010354|Ga0129333_11633568 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 525 | Open in IMG/M |
3300011010|Ga0139557_1042007 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 790 | Open in IMG/M |
3300012017|Ga0153801_1019668 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1202 | Open in IMG/M |
3300012667|Ga0157208_10002857 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 3214 | Open in IMG/M |
3300012667|Ga0157208_10008754 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1466 | Open in IMG/M |
3300012719|Ga0157600_1220002 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 668 | Open in IMG/M |
3300012731|Ga0157616_1084454 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1613 | Open in IMG/M |
3300012733|Ga0157606_1302836 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1165 | Open in IMG/M |
(restricted) 3300013126|Ga0172367_10663502 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 553 | Open in IMG/M |
(restricted) 3300013128|Ga0172366_10700555 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 594 | Open in IMG/M |
(restricted) 3300013130|Ga0172363_10881253 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 555 | Open in IMG/M |
(restricted) 3300013131|Ga0172373_10079153 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Patescibacteria group → Microgenomates group → Candidatus Gottesmanbacteria → Candidatus Gottesmanbacteria bacterium GW2011_GWA2_47_9 | 2598 | Open in IMG/M |
(restricted) 3300013131|Ga0172373_10128416 | Not Available | 1844 | Open in IMG/M |
(restricted) 3300013132|Ga0172372_10103393 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 2400 | Open in IMG/M |
3300017766|Ga0181343_1133166 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 696 | Open in IMG/M |
3300017774|Ga0181358_1109802 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 979 | Open in IMG/M |
3300018682|Ga0188851_1003238 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 2488 | Open in IMG/M |
3300020506|Ga0208091_1024721 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 687 | Open in IMG/M |
3300020506|Ga0208091_1040645 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 505 | Open in IMG/M |
3300020549|Ga0207942_1002207 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 3360 | Open in IMG/M |
3300020549|Ga0207942_1034842 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 629 | Open in IMG/M |
3300022190|Ga0181354_1054166 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1335 | Open in IMG/M |
3300022752|Ga0214917_10051232 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 2787 | Open in IMG/M |
3300022752|Ga0214917_10224131 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 901 | Open in IMG/M |
3300022752|Ga0214917_10375171 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 597 | Open in IMG/M |
3300023174|Ga0214921_10531235 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 548 | Open in IMG/M |
3300024343|Ga0244777_10733546 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 589 | Open in IMG/M |
3300024348|Ga0244776_10405079 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 904 | Open in IMG/M |
3300027683|Ga0209392_1197633 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 613 | Open in IMG/M |
3300027683|Ga0209392_1205069 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 599 | Open in IMG/M |
(restricted) 3300027728|Ga0247836_1034850 | Not Available | 3225 | Open in IMG/M |
(restricted) 3300027728|Ga0247836_1335054 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 521 | Open in IMG/M |
3300027733|Ga0209297_1239164 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 701 | Open in IMG/M |
3300027734|Ga0209087_1014618 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 3941 | Open in IMG/M |
3300027763|Ga0209088_10069084 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp. 197 | 1674 | Open in IMG/M |
3300027798|Ga0209353_10418677 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 546 | Open in IMG/M |
3300027805|Ga0209229_10266444 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 760 | Open in IMG/M |
3300027816|Ga0209990_10016241 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 4336 | Open in IMG/M |
3300027956|Ga0209820_1164931 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 614 | Open in IMG/M |
3300027972|Ga0209079_10174337 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 736 | Open in IMG/M |
(restricted) 3300027977|Ga0247834_1054199 | Not Available | 2116 | Open in IMG/M |
(restricted) 3300027977|Ga0247834_1274232 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 594 | Open in IMG/M |
(restricted) 3300027977|Ga0247834_1324994 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 521 | Open in IMG/M |
(restricted) 3300027977|Ga0247834_1337004 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 507 | Open in IMG/M |
(restricted) 3300028044|Ga0247838_1273348 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 562 | Open in IMG/M |
(restricted) 3300028114|Ga0247835_1003483 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 14886 | Open in IMG/M |
(restricted) 3300028553|Ga0247839_1025925 | Not Available | 4095 | Open in IMG/M |
(restricted) 3300028553|Ga0247839_1268885 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 655 | Open in IMG/M |
(restricted) 3300028553|Ga0247839_1377933 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 507 | Open in IMG/M |
(restricted) 3300028559|Ga0247831_1005290 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 16319 | Open in IMG/M |
(restricted) 3300028559|Ga0247831_1211121 | Not Available | 709 | Open in IMG/M |
(restricted) 3300028571|Ga0247844_1245180 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 643 | Open in IMG/M |
(restricted) 3300028581|Ga0247840_10255709 | Not Available | 936 | Open in IMG/M |
(restricted) 3300029268|Ga0247842_10398841 | Not Available | 715 | Open in IMG/M |
(restricted) 3300029286|Ga0247841_10044326 | All Organisms → cellular organisms → Bacteria | 4300 | Open in IMG/M |
(restricted) 3300029286|Ga0247841_10265325 | Not Available | 1207 | Open in IMG/M |
(restricted) 3300029286|Ga0247841_10588287 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 691 | Open in IMG/M |
3300031565|Ga0307379_10769936 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 853 | Open in IMG/M |
3300031578|Ga0307376_10735552 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 615 | Open in IMG/M |
3300031758|Ga0315907_10023845 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 5616 | Open in IMG/M |
3300031857|Ga0315909_10048520 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 3950 | Open in IMG/M |
3300031857|Ga0315909_10589517 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 745 | Open in IMG/M |
3300031951|Ga0315904_10048403 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 4764 | Open in IMG/M |
3300032050|Ga0315906_11008286 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 625 | Open in IMG/M |
3300032093|Ga0315902_11027866 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 615 | Open in IMG/M |
3300032116|Ga0315903_10457864 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1021 | Open in IMG/M |
3300033979|Ga0334978_0311017 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 753 | Open in IMG/M |
3300033980|Ga0334981_0286945 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 734 | Open in IMG/M |
3300033992|Ga0334992_0410568 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 606 | Open in IMG/M |
3300033993|Ga0334994_0258183 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 907 | Open in IMG/M |
3300033994|Ga0334996_0260475 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 886 | Open in IMG/M |
3300033996|Ga0334979_0397706 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 762 | Open in IMG/M |
3300034013|Ga0334991_0166661 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 988 | Open in IMG/M |
3300034019|Ga0334998_0241188 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1101 | Open in IMG/M |
3300034023|Ga0335021_0516250 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 605 | Open in IMG/M |
3300034062|Ga0334995_0789492 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 521 | Open in IMG/M |
3300034068|Ga0334990_0163599 | Not Available | 1215 | Open in IMG/M |
3300034071|Ga0335028_0405908 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 777 | Open in IMG/M |
3300034092|Ga0335010_0639794 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 533 | Open in IMG/M |
3300034095|Ga0335022_0604434 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 554 | Open in IMG/M |
3300034118|Ga0335053_0494300 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 723 | Open in IMG/M |
3300034119|Ga0335054_0748481 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 520 | Open in IMG/M |
3300034284|Ga0335013_0770544 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 541 | Open in IMG/M |
3300034356|Ga0335048_0394056 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 689 | Open in IMG/M |
3300034357|Ga0335064_0777340 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 587 | Open in IMG/M |
Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
⦗Top⦘ |
Habitat | Taxonomy | Distribution |
Freshwater | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater | 42.61% |
Freshwater Lake | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake | 7.83% |
Freshwater Sediment | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Freshwater Sediment | 6.96% |
Freshwater Lake | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lake | 6.96% |
Freshwater | Environmental → Aquatic → Freshwater → Unclassified → Unclassified → Freshwater | 6.09% |
Freshwater | Environmental → Aquatic → Freshwater → Lentic → Epilimnion → Freshwater | 5.22% |
Freshwater Lentic | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lentic | 3.48% |
Meromictic Pond | Environmental → Aquatic → Unclassified → Unclassified → Unclassified → Meromictic Pond | 3.48% |
Lake | Environmental → Aquatic → Freshwater → Lentic → Epilimnion → Lake | 1.74% |
Sediment | Environmental → Aquatic → Freshwater → Lake → Sediment → Sediment | 1.74% |
Freshwater | Environmental → Aquatic → Freshwater → Lotic → Unclassified → Freshwater | 1.74% |
Aqueous | Environmental → Aquatic → Marine → Coastal → Unclassified → Aqueous | 1.74% |
Estuarine | Environmental → Aquatic → Marine → Intertidal Zone → Estuary → Estuarine | 1.74% |
Soil | Environmental → Terrestrial → Soil → Clay → Unclassified → Soil | 1.74% |
Freshwater And Sediment | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater And Sediment | 0.87% |
Freshwater, Plankton | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater, Plankton | 0.87% |
Freshwater Lake | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake | 0.87% |
Freshwater | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater | 0.87% |
Benthic | Environmental → Aquatic → Freshwater → Unclassified → Unclassified → Benthic | 0.87% |
Freshwater | Environmental → Aquatic → Freshwater → Ice → Unclassified → Freshwater | 0.87% |
Freshwater To Marine Saline Gradient | Environmental → Aquatic → Marine → Coastal → Unclassified → Freshwater To Marine Saline Gradient | 0.87% |
Saline Water And Sediment | Environmental → Aquatic → Non-Marine Saline And Alkaline → Saline → Sediment → Saline Water And Sediment | 0.87% |
Visualization |
---|
Powered by ApexCharts |
Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
Taxon OID | Sample Name | Habitat Type | IMG/M Link |
---|---|---|---|
3300001533 | Benthic freshwater microbial communities from British Columbia, Canada | Environmental | Open in IMG/M |
3300002195 | Freshwater microbial communities from San Paulo Zoo lake, Brazil - AUG 2013 | Environmental | Open in IMG/M |
3300002202 | Freshwater microbial communities from San Paulo Zoo lake, Brazil - SEP 2012 | Environmental | Open in IMG/M |
3300002278 | Freshwater microbial communities from Lake Mendota, WI - 22OCT2012 deep hole epilimnion | Environmental | Open in IMG/M |
3300002835 | Freshwater microbial communities from Lake Mendota, WI - (Lake Mendota Combined Ray assembly, ASSEMBLY_DATE=20140605) | Environmental | Open in IMG/M |
3300005528 | Freshwater lake microbial communities from Lake Erie, under a cyanobacterial bloom - NOAA_Erie_Diel1S_2200h metaG | Environmental | Open in IMG/M |
3300005581 | Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG ER78MSRF | Environmental | Open in IMG/M |
3300005613 | Saline sediment microbial communities from Etoliko Lagoon, Greece - sediment | Environmental | Open in IMG/M |
3300007304 | Freshwater lake microbial communities from Lake Erie, under a cyanobacterial bloom - NOAA_Erie_Diel1S_2200h metaT (Metagenome Metatranscriptome) (version 2) | Environmental | Open in IMG/M |
3300007541 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1508_1S Viral MetaG | Environmental | Open in IMG/M |
3300007542 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1504_1 Viral MetaG | Environmental | Open in IMG/M |
3300008265 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE12, Sample HABS-E2014-0126-100-LTR | Environmental | Open in IMG/M |
3300008450 | Freshwater viral communities during cyanobacterial harmful algal blooms (CHABs) in Western Lake Erie, USA - Oct 27, 2014 all contigs | Environmental | Open in IMG/M |
3300009081 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (1) Depth 19-21cm May2015 | Environmental | Open in IMG/M |
3300009085 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (6) Depth 10-12cm September2015 | Environmental | Open in IMG/M |
3300009152 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_140806_EF_MetaG | Environmental | Open in IMG/M |
3300009159 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_140212_EF_MetaG | Environmental | Open in IMG/M |
3300009160 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_140806_MF_MetaG | Environmental | Open in IMG/M |
3300009165 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (6) Depth 1-3cm September2015 | Environmental | Open in IMG/M |
3300009170 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (1) Depth 1-3cm May2015 | Environmental | Open in IMG/M |
3300009180 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_140625_EF_MetaG | Environmental | Open in IMG/M |
3300009184 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130805_EF_MetaG | Environmental | Open in IMG/M |
3300009451 | Aquatic microbial communities from different depth of meromictic Siders Pond, Falmouth, Massachusetts; Cast 1, 8m depth; DNA IDBA-UD | Environmental | Open in IMG/M |
3300009466 | Aquatic microbial communities from different depth of meromictic Siders Pond, Falmouth, Massachusetts; Cast 1, 2m depth; DNA IDBA-UD | Environmental | Open in IMG/M |
3300009469 | Aquatic microbial communities from different depth of meromictic Siders Pond, Falmouth, Massachusetts; Cast 1, 6m depth; DNA IDBA-UD | Environmental | Open in IMG/M |
3300010354 | Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Sum_0.6_0.8_DNA | Environmental | Open in IMG/M |
3300011010 | Freshwater microbial communities from Western Basin Lake Erie, Ontario, Canada - Station 970 - Surface Ice | Environmental | Open in IMG/M |
3300012017 | Freshwater microbial communities from Central Basin Lake Erie, Ontario, Canada - Station 1208 - Top - Depth 1m | Environmental | Open in IMG/M |
3300012667 | Freshwater microbial communities from Maskinonge River, Ontario, Canada - S15 | Environmental | Open in IMG/M |
3300012719 | Eutrophic lake water microbial communities from Lake Mendota, Wisconsin, USA - GEODES123 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300012731 | Eutrophic lake water microbial communities from Lake Mendota, Wisconsin, USA - GEODES145 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300012733 | Eutrophic lake water microbial communities from Lake Mendota, Wisconsin, USA - GEODES131 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300013126 (restricted) | Freshwater microbial communities from Kabuno Bay, South-Kivu, Congo ? kab_022012_10m | Environmental | Open in IMG/M |
3300013128 (restricted) | Sediment microbial communities from Lake Kivu, Rwanda - Sediment site 69cm | Environmental | Open in IMG/M |
3300013130 (restricted) | Sediment microbial communities from Lake Kivu, Rwanda - Sediment s2_kivu2a2 | Environmental | Open in IMG/M |
3300013131 (restricted) | Freshwater microbial communities from Kabuno Bay, South-Kivu, Congo ? kab_092012_10m | Environmental | Open in IMG/M |
3300013132 (restricted) | Freshwater microbial communities from Kabuno Bay, South-Kivu, Congo ? kab_092012_9.5m | Environmental | Open in IMG/M |
3300017766 | Freshwater viral communities from Lake Michigan, USA - Su13.VD.MLB.S.D | Environmental | Open in IMG/M |
3300017774 | Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM110.S.D | Environmental | Open in IMG/M |
3300018682 | Metatranscriptome of marine microbial communities from Baltic Sea - GS680_0p1 | Environmental | Open in IMG/M |
3300020506 | Freshwater microbial communities from Lake Mendota, WI - 26OCT2012 deep hole epilimnion (SPAdes) | Environmental | Open in IMG/M |
3300020549 | Freshwater microbial communities from Lake Mendota, WI - 12OCT2012 deep hole epilimnion (SPAdes) | Environmental | Open in IMG/M |
3300022190 | Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM15.S.N | Environmental | Open in IMG/M |
3300022752 | Freshwater microbial communities from Lake Lanier, Atlanta, Georgia, United States - LL_1208_BB | Environmental | Open in IMG/M |
3300023174 | Freshwater microbial communities from Lake Lanier, Atlanta, Georgia, United States - LL-1505 | Environmental | Open in IMG/M |
3300024343 | Combined assembly of estuarine microbial communities from Columbia River, Washington, USA >3um size fraction | Environmental | Open in IMG/M |
3300024348 | 0.2um to 3um size fraction coassembly | Environmental | Open in IMG/M |
3300027683 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (1) Depth 1-3cm May2015 (SPAdes) | Environmental | Open in IMG/M |
3300027728 (restricted) | Freshwater microbial communities from meromictic Lake La Cruz, Castile-La Mancha, Spain - LaCruzMarch2015_14m | Environmental | Open in IMG/M |
3300027733 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130805_MF_MetaG (SPAdes) | Environmental | Open in IMG/M |
3300027734 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130805_EF_MetaG (SPAdes) | Environmental | Open in IMG/M |
3300027763 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_140625_EF_MetaG (SPAdes) | Environmental | Open in IMG/M |
3300027798 | Freshwater lake microbial communities from Lake Michigan, USA - Sp13.BD.MM15.SD (SPAdes) | Environmental | Open in IMG/M |
3300027805 | Freshwater and sediment microbial communities from dead zone in Sandusky Bay, Ohio, USA (SPAdes) | Environmental | Open in IMG/M |
3300027816 | Freshwater lake microbial communities from Lake Erie, under a cyanobacterial bloom - NOAA_Erie_Diel5S_2200h metaG (SPAdes) | Environmental | Open in IMG/M |
3300027956 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (1) Depth 19-21cm May2015 (SPAdes) | Environmental | Open in IMG/M |
3300027972 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (6) Depth 10-12cm September2015 (SPAdes) | Environmental | Open in IMG/M |
3300027977 (restricted) | Freshwater microbial communities from meromictic Lake La Cruz, Castile-La Mancha, Spain - LaCruzMarch2015_12m | Environmental | Open in IMG/M |
3300028044 (restricted) | Freshwater microbial communities from meromictic Lake La Cruz, Castile-La Mancha, Spain - LaCruzMarch2015_15m | Environmental | Open in IMG/M |
3300028114 (restricted) | Freshwater microbial communities from meromictic Lake La Cruz, Castile-La Mancha, Spain - LaCruzMarch2015_13.5m | Environmental | Open in IMG/M |
3300028553 (restricted) | Freshwater microbial communities from meromictic Lake La Cruz, Castile-La Mancha, Spain - LaCruzMarch2015_16m | Environmental | Open in IMG/M |
3300028559 (restricted) | Freshwater microbial communities from meromictic Lake La Cruz, Castile-La Mancha, Spain - LaCruzMarch2015_1m | Environmental | Open in IMG/M |
3300028571 (restricted) | Freshwater microbial communities from meromictic Lake La Cruz, Castile-La Mancha, Spain - LaCruzMarch201714.5m_1 | Environmental | Open in IMG/M |
3300028581 (restricted) | Freshwater microbial communities from meromictic Lake La Cruz, Castile-La Mancha, Spain - LaCruzMarch2015_17m | Environmental | Open in IMG/M |
3300029268 (restricted) | Freshwater microbial communities from meromictic Lake La Cruz, Castile-La Mancha, Spain - LaCruzMarch2015_19m | Environmental | Open in IMG/M |
3300029286 (restricted) | Freshwater microbial communities from meromictic Lake La Cruz, Castile-La Mancha, Spain - LaCruzMarch2015_18m | Environmental | Open in IMG/M |
3300031565 | Soil microbial communities from Risofladan, Vaasa, Finland - UN-2 | Environmental | Open in IMG/M |
3300031578 | Soil microbial communities from Risofladan, Vaasa, Finland - TR-2 | Environmental | Open in IMG/M |
3300031758 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 12 MA123 | Environmental | Open in IMG/M |
3300031857 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 2 MA125 | Environmental | Open in IMG/M |
3300031951 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 12 MA120 | Environmental | Open in IMG/M |
3300032050 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 2 MA122 | Environmental | Open in IMG/M |
3300032093 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 12 MA117 | Environmental | Open in IMG/M |
3300032116 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 2 MA119 | Environmental | Open in IMG/M |
3300033979 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME30Aug2017-rr0003 | Environmental | Open in IMG/M |
3300033980 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME09Aug2015-rr0007 | Environmental | Open in IMG/M |
3300033992 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME16Jun2014-rr0035 | Environmental | Open in IMG/M |
3300033993 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME20Jul2012-rr0037 | Environmental | Open in IMG/M |
3300033994 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME25Jul2006D11-rr0046 | Environmental | Open in IMG/M |
3300033996 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME20Jul2016-rr0004 | Environmental | Open in IMG/M |
3300034013 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME07Jun2018-rr0034 | Environmental | Open in IMG/M |
3300034019 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME24Sep2014-rr0049 | Environmental | Open in IMG/M |
3300034023 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME21Oct2016-rr0090 | Environmental | Open in IMG/M |
3300034062 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME27Jul2012-rr0045 | Environmental | Open in IMG/M |
3300034068 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME13Apr2016-rr0031 | Environmental | Open in IMG/M |
3300034071 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME17Oct2008D10-rr0110 | Environmental | Open in IMG/M |
3300034092 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME03Aug2012-rr0069 | Environmental | Open in IMG/M |
3300034095 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME02Feb2014D0-rr0091 | Environmental | Open in IMG/M |
3300034118 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME05Aug2017-rr0165 | Environmental | Open in IMG/M |
3300034119 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME21Jul2015-rr0166 | Environmental | Open in IMG/M |
3300034284 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME08Jul2016-rr0075 | Environmental | Open in IMG/M |
3300034356 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME17Jun2014-rr0152 | Environmental | Open in IMG/M |
3300034357 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME12May2017-rr0187 | Environmental | Open in IMG/M |
Geographical Distribution | |
---|---|
Zoom: | Powered by OpenStreetMap |
⦗Top⦘ |
Note: Some of these sequences are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
Protein ID | Sample Taxon ID | Habitat | Sequence |
MLSed_103633513 | 3300001533 | Benthic | MEFIQLNNNQRLIFNPDKGKVYTISTNLLLATFTNQVSFTFNGVKYDLYKYADGKFATVDGDVRLIKLE* |
metazooDRAFT_12285812 | 3300002195 | Lake | KRLIFNPDNGKVYTISSNLLLSTFTNQISFSFNNVKYDLYKFAEGKFSTLDSDIRLIKKQ |
metazooDRAFT_12543282 | 3300002202 | Lake | STNLLLSTFTNQITFSFNGVRYDLYKFANGKFATVDNEVRLIKKE* |
B570J29590_1090551 | 3300002278 | Freshwater | LNNNKRLIFNPDNGKVYTISTNLLLSTFTNQVSFAFNGVKYDLYKYADGKFATVDGDVRLIKLE* |
B570J40625_1013456091 | 3300002835 | Freshwater | TNLLLSTFTNQVSFAFNGIKYDLYKYAEGKFATVDGDVRLIKLE* |
Ga0068872_107347392 | 3300005528 | Freshwater Lake | NLLLSTFTNQVSFAFNGIKYDLYKYADGKFATVDGDVRLIKKE* |
Ga0049081_101190963 | 3300005581 | Freshwater Lentic | NGKVYSISTNLLLSTFTNQISFAFNGVRYDLYKFANGKFATVDNEVRLIKKE* |
Ga0049081_101223794 | 3300005581 | Freshwater Lentic | LLSTFTNQVSFAFNGIKYDLYKYAEGKFATVDGDVRLIKME* |
Ga0049081_102683231 | 3300005581 | Freshwater Lentic | TFTNQVSFAFNGIKYDLYKYAEGKFATVDVDVRLIKME* |
Ga0049081_102734501 | 3300005581 | Freshwater Lentic | LNVNKRLIFNPDNGKVYTISTNLLLSTFTNQVSFAFNGIKYDLYKYADGKFATVDGDVRLIKLE* |
Ga0074649_11262521 | 3300005613 | Saline Water And Sediment | TNQVSFAFNGVRYDLYKFANGKFATVENDVRLIKKE* |
Ga0102689_18240001 | 3300007304 | Freshwater Lake | LNNANRFIFNPDNGKVYSISTNLLLSTFTNQISFAFNGVRYDLYKFANGKFATVDNEVRLIKKE* |
Ga0099848_10552981 | 3300007541 | Aqueous | NGKVYTISTNLLLSTFTNQISFAFNGVRYDLYKFANGRFATVDGEVRLIKKE* |
Ga0099846_11645561 | 3300007542 | Aqueous | NRFIFNPDNGKVYSISTNLVLSTFTNQISFGFNGVRYDLYKFANGRFATVDGDVRLIKKE |
Ga0114361_10274555 | 3300008265 | Freshwater, Plankton | NPDNGKVYSISTNLLLSTFTNQVSFAFNGVRYDLYKFANGKFATVDNEVRLIKKE* |
Ga0114880_12109671 | 3300008450 | Freshwater Lake | NLLLSTFTNQVSFAFNGVKYDLYKYADGKFATVDGDVRLIKME* |
Ga0105098_106859871 | 3300009081 | Freshwater Sediment | ISTNLLLATFTNQISFTFNSVKYDLYKYADGKFATVDGDVRLIKME* |
Ga0105103_105243953 | 3300009085 | Freshwater Sediment | GKVYTISTNLLLATFTNQISFNFNAVKYDLYKYADGKFATVDGNVRLIKLE* |
Ga0114980_100609441 | 3300009152 | Freshwater Lake | NQVSFAFNGIKYDLYKYAEGKFATVDGDVKLLKLE* |
Ga0114978_103690062 | 3300009159 | Freshwater Lake | VYTISTNLLLSTFTNQVSFAFNGIKYDLYKYADGKFATVDGDVRLIKLE* |
Ga0114981_107309411 | 3300009160 | Freshwater Lake | NNNKRLIFNPDNGKVYTISTNLLLSTFTNQVSFAFNGIKYDCYKYAEGKFATVDGDVRLIKLE* |
Ga0105102_109140862 | 3300009165 | Freshwater Sediment | LLSTFTNQVSFAFNGVKYDLYKYADGKFATVDGDIRLIKLE* |
Ga0105096_106272791 | 3300009170 | Freshwater Sediment | TFTNQISFTFNSVKYDLYKYADGKFATVDGDVRLIKLE* |
Ga0114979_100468591 | 3300009180 | Freshwater Lake | PDNGKVYTISTNLLLSTFTNQVSFAFNGIKYDLYKYADGKFATVDGDVRLIKLE* |
Ga0114979_103217982 | 3300009180 | Freshwater Lake | DNGKVYTISNNLLLSTFTNQVSFAFNGIKYDLYKYAEDKFATVDGDVKLLKLE* |
Ga0114976_104839961 | 3300009184 | Freshwater Lake | RLIFNPDNGKVYTISTNLLLSTFTNQVSFAFNGIKYDLYKYADGKFATVDGDIRLIKLE* |
Ga0127402_11200731 | 3300009451 | Meromictic Pond | NRFIFNPDNGKVYTISTNLLLSTFTNQISFNFDGVKYDLYKFANGKFSTIDGDVKLIKKE |
Ga0126448_10504081 | 3300009466 | Meromictic Pond | NLLLSTFTNQVSFAFNGVRYDLYKFANGRFATVDGEVRLIKKE* |
Ga0127401_10551024 | 3300009469 | Meromictic Pond | FTNQVSFAFNGVRYDLYKFANGRFATVDGEVRLIKKE* |
Ga0127401_10980272 | 3300009469 | Meromictic Pond | NRFIFNPDNGKVYTISTNLLLSTFTNQISFNFDGVKYDLYKFANGKFSTIDGDVKLIKNK |
Ga0129333_116335682 | 3300010354 | Freshwater To Marine Saline Gradient | IFNPDNGKVYTISTNLLLSTFTNQITFSFNGVRYDLYKFANGKFASVDNEVRLVKKE* |
Ga0139557_10420071 | 3300011010 | Freshwater | FNPDNGKVYTISTNLLLSTFTNQISFTFDSKKYDLYKFADGKFATVDGEVKLIKIK* |
Ga0153801_10196684 | 3300012017 | Freshwater | IELNVNKRLIFNPDNGKVYSIATNLLLSTFTNQVSFAFNGIKYDLYKYAEGKFATVDGHVRLIKME* |
Ga0157208_100028579 | 3300012667 | Freshwater | NQISFTFNSIKYDLYKFADGKFATVDGNVRLIKIE* |
Ga0157208_100087541 | 3300012667 | Freshwater | NQISFTFNSIKYDLYKFANGKFATVDNDVKLIKKE* |
Ga0157600_12200021 | 3300012719 | Freshwater | QVSFAFNGVKYDLYKYADGKFATVDGDVRLIKLE* |
Ga0157616_10844541 | 3300012731 | Freshwater | KVYSISTNLLLSTFTNQVSFAFNGVKYDLYKYADGKFATVDGDVRLIKLE* |
Ga0157606_13028361 | 3300012733 | Freshwater | FTNQVSFAFNGVKYDLYKYADGKFATVDGDVRLIKLE* |
(restricted) Ga0172367_106635021 | 3300013126 | Freshwater | QITFNFNNVRYDLYKFANGKFSTVDGDVKLIKKE* |
(restricted) Ga0172366_107005551 | 3300013128 | Sediment | LLLSTFTNQVTFNFNNVRYDLYKFANGKFSTIDGDVKLIKKE* |
(restricted) Ga0172363_108812531 | 3300013130 | Sediment | YTISSNLLLSTFTNQVSFSFNGIKYDLYKFANGKFSTVDGDVKLIKKE* |
(restricted) Ga0172373_100791531 | 3300013131 | Freshwater | NVLLSTFQNQITLNYNSVKYDLYKFAEGKFSTLDNDIRLIKKQ* |
(restricted) Ga0172373_101284161 | 3300013131 | Freshwater | NPDNGKVYTISSNLLLSTFTNQVSFSFNGIKYDLYKFANNKFSTVDGDVKLIKKE* |
(restricted) Ga0172372_101033931 | 3300013132 | Freshwater | QVTFNFNNVRYDLYKFANGKFSTVDGDVKLIKKE* |
Ga0181343_11331663 | 3300017766 | Freshwater Lake | NKRLIFNPDNGKVYSISTNLLLSTFTNQVSFAFNGIKYDLYKYADGKFATVDVDVRLIKM |
Ga0181358_11098021 | 3300017774 | Freshwater Lake | NLLLSTFTNQVSFAFNGIKYDLYKYADGKFATVDGDVRLIKME |
Ga0188851_10032386 | 3300018682 | Freshwater Lake | LNNANRFIFNPDNGKVYSISTNLLLSTFTNQVSFAFNGVRYDLYKFANGRFATVDGEVRLIKKE |
Ga0208091_10247211 | 3300020506 | Freshwater | LIFNPDNGKVYSISTNLLLSTFTNQVSFAFNGVKYDLYKYADGKFATVDGDVRLIKLE |
Ga0208091_10406451 | 3300020506 | Freshwater | KRLIFNPDNGKVYTISTNLLLSTFTNQITFSFNGVRYDLYKFANGKFATIDNDVRLIKKE |
Ga0207942_10022079 | 3300020549 | Freshwater | LIFNPDNGKVYTISTNLLLSTFTNQITFSFNGVRYDLYKFGNGRFATVENDVRLIKKE |
Ga0207942_10348421 | 3300020549 | Freshwater | LLLSTFTNQISFTFNGVKYDLYKYADGKFATVDGDVRLIKLE |
Ga0181354_10541664 | 3300022190 | Freshwater Lake | LIFNPDNGKVYTISTNLLLSTFTNQVSFAFNGIKYDLYKYADGKFATVDGDVRLIKLE |
Ga0214917_100512323 | 3300022752 | Freshwater | TNQISFSFNGVKYDLYKYADGKFATVDGEVRLIKKE |
Ga0214917_102241313 | 3300022752 | Freshwater | TNQISFSFNGVKYDLYKYADGKFATVDGDVRLIKKE |
Ga0214917_103751712 | 3300022752 | Freshwater | DNGKVYTISTNLLLSTFTNQISFSFNGVKYDLYKYADGKFATVDGEVKFIKLE |
Ga0214921_105312352 | 3300023174 | Freshwater | VIELNNNKRLIFNPDNGKVYTISTNLLLSTFTNQISFSFNGVKYDLYKYADGKFATVDGDVRLIKKE |
Ga0244777_107335461 | 3300024343 | Estuarine | STNLLLSTFTNQISFTFNSVKYDLYKYADGKFATVDGDVRLIKME |
Ga0244776_104050793 | 3300024348 | Estuarine | STFTNQVSFAFNGVKYDLYKYADGKFATVDGDVRLIKLE |
Ga0209392_11976331 | 3300027683 | Freshwater Sediment | NGKVYTISTNLLLSTFTNQVSFAFNGIKYDLYKYSDGKFATVDGDVRLIKIE |
Ga0209392_12050692 | 3300027683 | Freshwater Sediment | TNLLLATFTNQISFTFNSIKYDLYKFADGKFATVDGNVRLIKLE |
(restricted) Ga0247836_10348506 | 3300027728 | Freshwater | PDNGKVYSISTNLLLSTFTNQISFAFNGVRYDLYKFANGKFSTIDGDIKLIKKE |
(restricted) Ga0247836_13350542 | 3300027728 | Freshwater | VYTITSNLLLSTFTNQISFAFNGVRYDLYKFANGKFATVEGDIRLIKKE |
Ga0209297_12391643 | 3300027733 | Freshwater Lake | NKRLIFNPDNGKVYSISTNLLLSTFTNQVSFAFNGIKYDLYKYADGKFATVDGNVRLIKL |
Ga0209087_10146181 | 3300027734 | Freshwater Lake | RLIFNPDNGKVYTISTNLLLSTFTNQVSFAFNGIKYDLYKYADGKFATVDGDIRLIKLE |
Ga0209088_100690841 | 3300027763 | Freshwater Lake | PDNGKVYTISTNLLLSTFTNQVSFAFNGIKYDLYKYADGKFATVDGDVRLIKLE |
Ga0209353_104186771 | 3300027798 | Freshwater Lake | FNPDNGKVYTISTNLLLATFTNQISFTFNSVKYDLYKYADGKFATVDGDVRLIKLE |
Ga0209229_102664443 | 3300027805 | Freshwater And Sediment | FTNQVSFAFNGVKYDLYKYADGKFATVDGDVRLIKLE |
Ga0209990_100162419 | 3300027816 | Freshwater Lake | TNLLLSTFTNQVSFAFNGVKYDLYKYADGKFATVDGDVRLIKLE |
Ga0209820_11649311 | 3300027956 | Freshwater Sediment | NKRLIFNPDNGKVYTISTNLLLATFTNQISFTFNSVKYDLYKYADGKFATVDGDVRLIKM |
Ga0209079_101743371 | 3300027972 | Freshwater Sediment | KVYSISTNLLLSTFTNQVSFSFNGVKYDLYKYADGKFATVDGDVRLIKLE |
(restricted) Ga0247834_10541991 | 3300027977 | Freshwater | PDNGKVYSISTNLLLSTFTNQISFAFNGVRYDLYKFANGKFSTVDGEVKLIKKE |
(restricted) Ga0247834_12742321 | 3300027977 | Freshwater | IELNINKRLIFNPDNGKVYSISTNLLLSTFTNQISFAFNGVRYDLYKFANGKFATIEGDIRLIKKE |
(restricted) Ga0247834_13249942 | 3300027977 | Freshwater | LLSTFTNQISFAFNGVRYDLYKFANGKFATVEGDIRLIKKE |
(restricted) Ga0247834_13370042 | 3300027977 | Freshwater | FTNQISFAFNGVRYDLYKFANGKFATIEGDVRLIKKE |
(restricted) Ga0247838_12733481 | 3300028044 | Freshwater | VYSISTNLLLSTFTNQISFAFNGVRYDLYKFANGKFATVEGDVRLIKKE |
(restricted) Ga0247835_100348315 | 3300028114 | Freshwater | KRLIFNPDNGKVYSISTNLLLSTFTNQISFAFNNVRYDLYKFANGKFATVEGDVRLIKKE |
(restricted) Ga0247839_10259251 | 3300028553 | Freshwater | NGKVYSISTNLLLSTFTNQISFAFNGVRYDLYKFANGKFSTIDGDIKLIKKE |
(restricted) Ga0247839_12688851 | 3300028553 | Freshwater | VYSISTNLLLSTFTNQISFAFNGVRYDLYKFANGKFATVEGDIRLIKKE |
(restricted) Ga0247839_13779332 | 3300028553 | Freshwater | KVYSISTNLLLSTFTNQISFAFNGVRYDLYKFANGKFATVEGDVRLIKKE |
(restricted) Ga0247831_100529016 | 3300028559 | Freshwater | LNINKRLIFNPDNGKVYTITSNLLLSTFTNQISFAFNNVRYDLYKFANGKFATVEGDVRLIKKE |
(restricted) Ga0247831_12111211 | 3300028559 | Freshwater | NPDNGKVYSISTNLLLSTFTNQISFAFNGVRYDLYKFANGKFSTIDGDIKLIKKE |
(restricted) Ga0247844_12451801 | 3300028571 | Freshwater | DNGKVYSISTNLLLSTFTNQISFAFNGVRYDLYKFANGKFATIEGDIRLIKKE |
(restricted) Ga0247840_102557093 | 3300028581 | Freshwater | TNLLLSTFTNQISFAFNGVRYDLYKFANGKFSTVDGEVKLIKKE |
(restricted) Ga0247842_103988412 | 3300029268 | Freshwater | LLSTFTNQISFAFNGVRYDLYKFANGKFSTVDGEVKLIKKE |
(restricted) Ga0247841_100443266 | 3300029286 | Freshwater | NPDNGKVYSISTNLLLSTFTNQISFAFNGVRYDLYKFADGKFATVEGDIKLIKKE |
(restricted) Ga0247841_102653253 | 3300029286 | Freshwater | NGKVYSISTNLLLSTFTNQISFAFNGVRYDLYKFANGKFSTVDGEVKLIKKE |
(restricted) Ga0247841_105882871 | 3300029286 | Freshwater | GKVYTITSNLLLSTFTNQISFAFNGVRYDLYKFANGKFATVEGDVRLIKKE |
Ga0307379_107699361 | 3300031565 | Soil | LLSTFTNQVSFAFNGVRYDLYKFANGKFATVDGEVRLIKKE |
Ga0307376_107355522 | 3300031578 | Soil | ISTNLLLSTFTNQVSFAFNGVRYDLYKFANGRFATVDGEVRLIKKE |
Ga0315907_100238451 | 3300031758 | Freshwater | GKVYSISTNLLLSTFTNQISFAFNGVRYDLYKFANGKFATVDNDVRLIKKE |
Ga0315909_100485209 | 3300031857 | Freshwater | FNPDNGKVYSISTNLLLSTFTNQISFAFNGVRYDLYKFANGKFATVDNDVRLIKKE |
Ga0315909_105895173 | 3300031857 | Freshwater | FNPDNGKVYSISTNLLLSTFTNQISFAFNGVRYDLYKFANGKFATVDNEVRLIKKE |
Ga0315904_100484031 | 3300031951 | Freshwater | NQISFAFNGVRYDLYKFANGKFATVDNEVRLIKKE |
Ga0315906_110082861 | 3300032050 | Freshwater | ISTNLLLSTFTNQVSFAFNGVRYDLYKFANGKFATVDNDVRLIKKE |
Ga0315902_110278662 | 3300032093 | Freshwater | IFNPDNGKVYSISTNLLLSTFTNQISFAFNGVRHDLYKFANGKFATVDNEVRLIKKE |
Ga0315903_104578643 | 3300032116 | Freshwater | NRFIFNPDNGKVYSISTNLLLSTFTNQLSFAFNGVRYDLYKFANGKFATVDNDVRLIKKE |
Ga0334978_0311017_14_163 | 3300033979 | Freshwater | VYSISTNLLLSTFTNQVSFAFNGIKYDLYKYADGKFATVDGDVRLIKLE |
Ga0334981_0286945_1_198 | 3300033980 | Freshwater | QLNSNKRLIFNPDNGKVYTISTNLLLSTFTNQVSFAFNGIKYDLYKYADGKFATVDGDVRLIKLE |
Ga0334992_0410568_2_160 | 3300033992 | Freshwater | NGKVYTISTNLLLSTFTNQVSFAFNGVKYDLYKYADGKFATVDGDVRLIKLE |
Ga0334994_0258183_1_186 | 3300033993 | Freshwater | NKRLIFNPDNGKVYSISTNLLLSTFTNQVSFAFNGVKYDLYKYADGKFATVDGDVRLIKL |
Ga0334996_0260475_1_144 | 3300033994 | Freshwater | TISTNLLLATFTNQISFTFNAVKYDLYKYADGKFATVDGDVRLIKLE |
Ga0334979_0397706_607_762 | 3300033996 | Freshwater | GKVYTISTNLLLSTFTNQVSFAFNGVKYDCYKYAEGKFATVDGDVRLIKLE |
Ga0334991_0166661_881_988 | 3300034013 | Freshwater | NQISFNFNGVKYDLYKYADGKFATVDGDVRLIKLE |
Ga0334998_0241188_943_1101 | 3300034019 | Freshwater | NGKVYSISTNLLLSTFTNQVSFAFNGVKYDLYKYADGKFATVDGDVRLIKLE |
Ga0335021_0516250_475_603 | 3300034023 | Freshwater | LLLSTFTNQVSFAFNGVRYDCYKYADGKFATVDGDVRLIKLE |
Ga0334995_0789492_3_146 | 3300034062 | Freshwater | SISTNLLLSTFTNQISFIFNSIKYDLYKFADGKFATVDGDVRLIKIE |
Ga0334990_0163599_1038_1214 | 3300034068 | Freshwater | LIINPDNGKVYSISTNLLLSTFTNQVSFAFNGIKYDLYKYAEGKFATVDGDVRLIKLE |
Ga0335028_0405908_1_132 | 3300034071 | Freshwater | NLLLSTFTNQVSFAFNGVKYDLYKYADGKFATVDGDVRLIKLE |
Ga0335010_0639794_3_170 | 3300034092 | Freshwater | NPDNGKVYTISTNLLLSTFTNQVSFAFNGIKYDLYKYTEGKFATVDGDVRLIKLE |
Ga0335022_0604434_374_553 | 3300034095 | Freshwater | RLIFNPDNGKVYTISTNLLLSTFTNQVSFAFNGVKYDLYKYADGKFATVDGDVRLIKLE |
Ga0335053_0494300_1_111 | 3300034118 | Freshwater | TNQVSFAFNGIKYDLYKYADGKFATVDGDVRLIKME |
Ga0335054_0748481_2_124 | 3300034119 | Freshwater | LATFTNQISFNFNSVKYDLYKYADGKFATVDGDVRLIKLE |
Ga0335013_0770544_399_539 | 3300034284 | Freshwater | ISTNLLLSTFTNQVSFAFNGVKYDCYKYAEGKFATVDGDVRLIKLE |
Ga0335048_0394056_523_687 | 3300034356 | Freshwater | PDNGKVYSISTNLLLSTFTNQITFNFNGVKYDLYKFANGKFATVDNDVRLIKKE |
Ga0335064_0777340_477_587 | 3300034357 | Freshwater | TNQISFAFNGIKYDLYKYADGKFATVDGDVRLIKLE |
⦗Top⦘ |