NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome / Metatranscriptome Family F080412

Metagenome / Metatranscriptome Family F080412

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F080412
Family Type Metagenome / Metatranscriptome
Number of Sequences 115
Average Sequence Length 44 residues
Representative Sequence SLIKYRYEDPAFEQVEKAAARDVAAVEEDAKYFGPDSPASQDEL
Number of Associated Samples 101
Number of Associated Scaffolds 115

Quality Assessment
Transcriptomic Evidence Yes
Most common taxonomic group Bacteria
% of genes with valid RBS motifs 0.87 %
% of genes near scaffold ends (potentially truncated) 99.13 %
% of genes from short scaffolds (< 2000 bps) 91.30 %
Associated GOLD sequencing projects 98
AlphaFold2 3D model prediction Yes
3D model pTM-score0.44

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Bacteria (70.435 % of family members)
NCBI Taxonomy ID 2
Taxonomy All Organisms → cellular organisms → Bacteria

Most Common Ecosystem
GOLD Ecosystem Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil
(26.956 % of family members)
Environment Ontology (ENVO) Unclassified
(23.478 % of family members)
Earth Microbiome Project Ontology (EMPO) Free-living → Non-saline → Soil (non-saline)
(38.261 % of family members)


 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      

 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Globular Signal Peptide: No Secondary Structure distribution: α-helix: 36.11%    β-sheet: 0.00%    Coil/Unstructured: 63.89%
Feature Viewer
Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer
Per-residue confidence (pLDDT):
  0-50   51-70   71-90   91-100  		pTM-score: 0.44
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.

 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 115 Family Scaffolds
PF00069Pkinase 28.70
PF00753Lactamase_B 20.87
PF03795YCII 6.09
PF03575Peptidase_S51 1.74
PF14310Fn3-like 0.87
PF13649Methyltransf_25 0.87
PF13298LigD_N 0.87
PF03050DDE_Tnp_IS66 0.87

Neighboring Clusters of Orthologous Genes (COGs)

COG IDNameFunctional Category % Frequency in 115 Family Scaffolds
COG0515Serine/threonine protein kinaseSignal transduction mechanisms [T] 114.78
COG2350YciI superfamily enzyme, includes 5-CHQ dehydrochlorinase, contains active-site pHisSecondary metabolites biosynthesis, transport and catabolism [Q] 6.09
COG3436TransposaseMobilome: prophages, transposons [X] 0.87

 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms70.43 %
UnclassifiedrootN/A29.57 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
2189573001|GZR05M101DOO3HAll Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii506Open in IMG/M
3300004608|Ga0068924_1221268All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii556Open in IMG/M
3300005187|Ga0066675_11339756All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Corynebacteriales → Mycobacteriaceae → Mycobacterium → Mycobacterium simiae complex → Mycobacterium florentinum527Open in IMG/M
3300005336|Ga0070680_100241601All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1526Open in IMG/M
3300005440|Ga0070705_100123211All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1677Open in IMG/M
3300005440|Ga0070705_101577217All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia552Open in IMG/M
3300005518|Ga0070699_100845602All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia838Open in IMG/M
3300005536|Ga0070697_101429883All Organisms → cellular organisms → Bacteria618Open in IMG/M
3300005560|Ga0066670_11003470All Organisms → cellular organisms → Bacteria510Open in IMG/M
3300005577|Ga0068857_100169318Not Available1985Open in IMG/M
3300005614|Ga0068856_102304886All Organisms → cellular organisms → Bacteria546Open in IMG/M
3300006173|Ga0070716_100335575Not Available1064Open in IMG/M
3300006173|Ga0070716_101002188All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii660Open in IMG/M
3300006176|Ga0070765_100305893All Organisms → cellular organisms → Bacteria1470Open in IMG/M
3300006358|Ga0068871_100487572All Organisms → cellular organisms → Bacteria1109Open in IMG/M
3300006755|Ga0079222_10097200All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1536Open in IMG/M
3300006755|Ga0079222_11186394Not Available682Open in IMG/M
3300006797|Ga0066659_10700165All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia828Open in IMG/M
3300006806|Ga0079220_11835043All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii535Open in IMG/M
3300006954|Ga0079219_12207817All Organisms → cellular organisms → Bacteria530Open in IMG/M
3300007258|Ga0099793_10189684Not Available984Open in IMG/M
3300009098|Ga0105245_11983572Not Available635Open in IMG/M
3300009101|Ga0105247_11644193All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia529Open in IMG/M
3300009174|Ga0105241_10587491All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia1004Open in IMG/M
3300009522|Ga0116218_1011992All Organisms → cellular organisms → Bacteria3841Open in IMG/M
3300009551|Ga0105238_12067361All Organisms → cellular organisms → Bacteria604Open in IMG/M
3300009698|Ga0116216_10367729Not Available874Open in IMG/M
3300010371|Ga0134125_10316675Not Available1732Open in IMG/M
3300010379|Ga0136449_102871120Not Available678Open in IMG/M
3300010379|Ga0136449_104305796All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii526Open in IMG/M
3300010401|Ga0134121_10884573All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia866Open in IMG/M
3300010877|Ga0126356_11243548All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia655Open in IMG/M
3300011120|Ga0150983_14824154All Organisms → cellular organisms → Bacteria616Open in IMG/M
3300012209|Ga0137379_10042179All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria4401Open in IMG/M
3300012359|Ga0137385_10532775All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micromonosporales → Micromonosporaceae → unclassified Micromonosporaceae → Micromonosporaceae bacterium992Open in IMG/M
3300012944|Ga0137410_10543517All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia954Open in IMG/M
3300012984|Ga0164309_10770293All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia771Open in IMG/M
3300013100|Ga0157373_10464085Not Available912Open in IMG/M
3300014166|Ga0134079_10149630Not Available940Open in IMG/M
3300014326|Ga0157380_11804901Not Available671Open in IMG/M
3300014745|Ga0157377_10325115Not Available1023Open in IMG/M
3300015374|Ga0132255_105294055All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia546Open in IMG/M
3300016445|Ga0182038_11467186Not Available612Open in IMG/M
3300016445|Ga0182038_12013643Not Available523Open in IMG/M
3300017928|Ga0187806_1033398All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia1528Open in IMG/M
3300017937|Ga0187809_10048317All Organisms → cellular organisms → Bacteria1372Open in IMG/M
3300017973|Ga0187780_10551254All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia826Open in IMG/M
3300018040|Ga0187862_10606280All Organisms → cellular organisms → Bacteria648Open in IMG/M
3300019361|Ga0173482_10412354Not Available631Open in IMG/M
3300020070|Ga0206356_11121492All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii525Open in IMG/M
3300020199|Ga0179592_10460809All Organisms → cellular organisms → Bacteria548Open in IMG/M
3300020580|Ga0210403_10556765All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia929Open in IMG/M
3300021401|Ga0210393_11103323All Organisms → cellular organisms → Bacteria641Open in IMG/M
3300021403|Ga0210397_10259678All Organisms → cellular organisms → Bacteria1263Open in IMG/M
3300021405|Ga0210387_10707689All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptomycetales → Streptomycetaceae → Streptomyces → Streptomyces cinnamoneus group → Streptomyces cinnamoneus892Open in IMG/M
3300021433|Ga0210391_10124632All Organisms → cellular organisms → Bacteria2028Open in IMG/M
3300021479|Ga0210410_11768006Not Available512Open in IMG/M
3300021559|Ga0210409_10286537Not Available1486Open in IMG/M
3300021559|Ga0210409_10549482All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micrococcales → Microbacteriaceae → Clavibacter → Clavibacter michiganensis1021Open in IMG/M
3300021560|Ga0126371_12262629Not Available656Open in IMG/M
3300022467|Ga0224712_10210642Not Available886Open in IMG/M
3300022756|Ga0222622_11458689All Organisms → cellular organisms → Bacteria504Open in IMG/M
3300024254|Ga0247661_1033696Not Available919Open in IMG/M
3300024283|Ga0247670_1018375All Organisms → cellular organisms → Bacteria1252Open in IMG/M
3300024323|Ga0247666_1022325All Organisms → cellular organisms → Bacteria1350Open in IMG/M
3300025735|Ga0207713_1223749All Organisms → cellular organisms → Bacteria566Open in IMG/M
3300025885|Ga0207653_10087565Not Available1087Open in IMG/M
3300025898|Ga0207692_10257803All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia1047Open in IMG/M
3300025898|Ga0207692_10502676Not Available769Open in IMG/M
3300025898|Ga0207692_10578094All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia720Open in IMG/M
3300025898|Ga0207692_10580073All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia719Open in IMG/M
3300025928|Ga0207700_11291224All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia650Open in IMG/M
3300025929|Ga0207664_10114823All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria2244Open in IMG/M
3300025929|Ga0207664_10813476All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → unclassified Actinobacteria → Actinobacteria bacterium 13_2_20CM_2_71_6840Open in IMG/M
3300025936|Ga0207670_11327228All Organisms → cellular organisms → Bacteria610Open in IMG/M
3300025944|Ga0207661_10402695All Organisms → cellular organisms → Bacteria1241Open in IMG/M
3300025949|Ga0207667_10346198Not Available1516Open in IMG/M
3300025961|Ga0207712_10365677All Organisms → cellular organisms → Bacteria1203Open in IMG/M
3300026550|Ga0209474_10428731Not Available678Open in IMG/M
3300027504|Ga0209114_1006006All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1753Open in IMG/M
3300027775|Ga0209177_10404765All Organisms → cellular organisms → Bacteria548Open in IMG/M
3300027882|Ga0209590_10832233All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia585Open in IMG/M
3300027894|Ga0209068_10574578All Organisms → cellular organisms → Bacteria655Open in IMG/M
3300028047|Ga0209526_10238232Not Available1249Open in IMG/M
3300028138|Ga0247684_1050907All Organisms → cellular organisms → Bacteria670Open in IMG/M
3300028906|Ga0308309_10539145All Organisms → cellular organisms → Bacteria1010Open in IMG/M
3300030494|Ga0310037_10030425All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria2597Open in IMG/M
3300030763|Ga0265763_1052094All Organisms → cellular organisms → Bacteria518Open in IMG/M
3300031543|Ga0318516_10059713All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria2095Open in IMG/M
3300031543|Ga0318516_10542067Not Available666Open in IMG/M
3300031544|Ga0318534_10066044All Organisms → cellular organisms → Bacteria → Terrabacteria group2043Open in IMG/M
3300031564|Ga0318573_10019567All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria3030Open in IMG/M
3300031640|Ga0318555_10362992All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia785Open in IMG/M
3300031682|Ga0318560_10149152All Organisms → cellular organisms → Bacteria → Terrabacteria group1237Open in IMG/M
3300031764|Ga0318535_10107666All Organisms → cellular organisms → Bacteria → Terrabacteria group1225Open in IMG/M
3300031771|Ga0318546_10586339Not Available784Open in IMG/M
3300031777|Ga0318543_10336501Not Available676Open in IMG/M
3300031779|Ga0318566_10054325All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1910Open in IMG/M
3300031781|Ga0318547_11073715Not Available504Open in IMG/M
3300031797|Ga0318550_10044437All Organisms → cellular organisms → Bacteria → Terrabacteria group1974Open in IMG/M
3300031846|Ga0318512_10441019All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia657Open in IMG/M
3300031859|Ga0318527_10445869Not Available552Open in IMG/M
3300031897|Ga0318520_10511823Not Available742Open in IMG/M
3300032001|Ga0306922_10482164All Organisms → cellular organisms → Bacteria → Terrabacteria group1323Open in IMG/M
3300032010|Ga0318569_10012760All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria3210Open in IMG/M
3300032010|Ga0318569_10175839All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Pseudonocardiales → Pseudonocardiaceae990Open in IMG/M
3300032052|Ga0318506_10440501All Organisms → cellular organisms → Bacteria578Open in IMG/M
3300032065|Ga0318513_10252306All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii855Open in IMG/M
3300032205|Ga0307472_101602785All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia640Open in IMG/M
3300032770|Ga0335085_10189744All Organisms → cellular organisms → Bacteria → Terrabacteria group2528Open in IMG/M
3300032770|Ga0335085_10390119All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia1619Open in IMG/M
3300032770|Ga0335085_11386442Not Available737Open in IMG/M
3300032805|Ga0335078_10739317Not Available1211Open in IMG/M
3300032892|Ga0335081_11631244All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia707Open in IMG/M
3300032954|Ga0335083_11426797Not Available528Open in IMG/M


 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil26.96%
Corn, Switchgrass And Miscanthus RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere10.43%
Vadose Zone SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil5.22%
Peatlands SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil5.22%
SoilEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Soil5.22%
Agricultural SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil4.35%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Soil3.48%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil2.61%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil2.61%
Forest SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil2.61%
Corn RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere2.61%
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere2.61%
Freshwater SedimentEnvironmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment1.74%
Terrestrial SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil1.74%
Corn, Switchgrass And Miscanthus RhizosphereEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Corn, Switchgrass And Miscanthus Rhizosphere1.74%
SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Soil1.74%
Corn RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere1.74%
Agricultural SoilEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Agricultural Soil1.74%
Corn RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere1.74%
PeatlandEnvironmental → Aquatic → Freshwater → Wetlands → Bog → Peatland0.87%
WatershedsEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds0.87%
Groundwater SedimentEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment0.87%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil0.87%
Grasslands SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil0.87%
Grass SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Grass Soil0.87%
Hardwood Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil0.87%
Tropical PeatlandEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland0.87%
Switchgrass RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Switchgrass Rhizosphere0.87%
Arabidopsis RhizosphereHost-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere0.87%
Miscanthus RhizosphereHost-Associated → Plants → Roots → Rhizosphere → Soil → Miscanthus Rhizosphere0.87%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere0.87%
Corn RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere0.87%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere0.87%
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere0.87%
Boreal Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Boreal Forest Soil0.87%

Visualization
Powered by ApexCharts



Associated Samples

Taxon OIDSample NameHabitat TypeIMG/M Link
2189573001Grass soil microbial communities from Rothamsted Park, UK - FD2 (NaCl 300g/L 5ml)EnvironmentalOpen in IMG/M
3300004608Peat soil microbial communities from Weissenstadt, Germany - Metatranscriptome 9 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300005187Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_124EnvironmentalOpen in IMG/M
3300005336Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaGEnvironmentalOpen in IMG/M
3300005440Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaGEnvironmentalOpen in IMG/M
3300005518Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaGEnvironmentalOpen in IMG/M
3300005536Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaGEnvironmentalOpen in IMG/M
3300005560Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_119EnvironmentalOpen in IMG/M
3300005577Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2Host-AssociatedOpen in IMG/M
3300005614Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2Host-AssociatedOpen in IMG/M
3300006173Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaGEnvironmentalOpen in IMG/M
3300006176Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 5EnvironmentalOpen in IMG/M
3300006358Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2Host-AssociatedOpen in IMG/M
3300006755Agricultural soil microbial communities from Georgia to study Nitrogen management - GA PlitterEnvironmentalOpen in IMG/M
3300006797Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_108EnvironmentalOpen in IMG/M
3300006806Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS100EnvironmentalOpen in IMG/M
3300006954Agricultural soil microbial communities from Georgia to study Nitrogen management - GA ControlEnvironmentalOpen in IMG/M
3300007258Vadose zone soil and rhizosphere microbial communities from the Eel River Critical Zone Observatory, Northern California to study diel carbon cycling - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_3EnvironmentalOpen in IMG/M
3300009098Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaGHost-AssociatedOpen in IMG/M
3300009101Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaGHost-AssociatedOpen in IMG/M
3300009174Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaGHost-AssociatedOpen in IMG/M
3300009522Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_5_LS metaGEnvironmentalOpen in IMG/M
3300009551Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaGHost-AssociatedOpen in IMG/M
3300009698Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_3_AS metaGEnvironmentalOpen in IMG/M
3300010371Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-1EnvironmentalOpen in IMG/M
3300010379Sb_50d combined assemblyEnvironmentalOpen in IMG/M
3300010401Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-1EnvironmentalOpen in IMG/M
3300010877Boreal forest soil eukaryotic communities from Alaska, USA - W3-2 Metatranscriptome (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300011120Combined assembly of Microbial Forest Soil metaTEnvironmentalOpen in IMG/M
3300012209Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_80_16 metaGEnvironmentalOpen in IMG/M
3300012359Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_80_16 metaGEnvironmentalOpen in IMG/M
3300012944Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug1_16fungal (Illumina Assembly)EnvironmentalOpen in IMG/M
3300012984Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_247_MGEnvironmentalOpen in IMG/M
3300013100Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaGHost-AssociatedOpen in IMG/M
3300014166Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_2_09182015EnvironmentalOpen in IMG/M
3300014326Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaGHost-AssociatedOpen in IMG/M
3300014745Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaGHost-AssociatedOpen in IMG/M
3300015374Col-0 rhizosphere combined assemblyHost-AssociatedOpen in IMG/M
3300016445Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.108EnvironmentalOpen in IMG/M
3300017928Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - ASW_1EnvironmentalOpen in IMG/M
3300017937Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - ASW_4EnvironmentalOpen in IMG/M
3300017973Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_Q2_SP10_20_MGEnvironmentalOpen in IMG/M
3300018040Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_10_150EnvironmentalOpen in IMG/M
3300019361Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S133-311R-2 (version 2)EnvironmentalOpen in IMG/M
3300020070Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2)EnvironmentalOpen in IMG/M
3300020199Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_08_16fungal (Illumina Assembly)EnvironmentalOpen in IMG/M
3300020580Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-19-MEnvironmentalOpen in IMG/M
3300021401Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-27-OEnvironmentalOpen in IMG/M
3300021403Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-OEnvironmentalOpen in IMG/M
3300021405Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-7-OEnvironmentalOpen in IMG/M
3300021433Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-12-OEnvironmentalOpen in IMG/M
3300021479Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-4-MEnvironmentalOpen in IMG/M
3300021559Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-17-MEnvironmentalOpen in IMG/M
3300021560Tropical forest soil microbial communities from Panama - MetaG Plot_4EnvironmentalOpen in IMG/M
3300022467Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2)EnvironmentalOpen in IMG/M
3300022756Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM2_5_b1EnvironmentalOpen in IMG/M
3300024254Soil microbial communities from Purdue University Martell Research Forest, Indiana, United States - CNK02EnvironmentalOpen in IMG/M
3300024283Soil microbial communities from Purdue University Martell Research Forest, Indiana, United States - CNK11EnvironmentalOpen in IMG/M
3300024323Soil microbial communities from Purdue University Martell Research Forest, Indiana, United States - CNK07EnvironmentalOpen in IMG/M
3300025735Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025885Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025898Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025928Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025929Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025936Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025944Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025949Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300025961Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300026550Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_145 (SPAdes)EnvironmentalOpen in IMG/M
3300027504Forest soil microbial communities from Davy Crockett National Forest, Groveton, Texas, USA - Texas A ecozone_RefH0_O3 (SPAdes)EnvironmentalOpen in IMG/M
3300027775Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Control (SPAdes)EnvironmentalOpen in IMG/M
3300027882Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con1.8 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300027894Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Cold Stream Run_MetaG_CSR_2012 (SPAdes)EnvironmentalOpen in IMG/M
3300028047Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM2H0_M1 (SPAdes)EnvironmentalOpen in IMG/M
3300028138Soil microbial communities from Purdue University Martell Research Forest, Indiana, United States - CNK25EnvironmentalOpen in IMG/M
3300028906Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 5 (v2)EnvironmentalOpen in IMG/M
3300030494Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_3_AS metaG (v2)EnvironmentalOpen in IMG/M
3300030763Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI5 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300031543Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f20EnvironmentalOpen in IMG/M
3300031544Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.117b4f26EnvironmentalOpen in IMG/M
3300031564Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f21EnvironmentalOpen in IMG/M
3300031640Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f23EnvironmentalOpen in IMG/M
3300031682Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.065b5f22EnvironmentalOpen in IMG/M
3300031764Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.117b4f27EnvironmentalOpen in IMG/M
3300031771Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f19EnvironmentalOpen in IMG/M
3300031777Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.168b4f24EnvironmentalOpen in IMG/M
3300031779Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.066b5f22EnvironmentalOpen in IMG/M
3300031781Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f20EnvironmentalOpen in IMG/M
3300031797Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f23EnvironmentalOpen in IMG/M
3300031846Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.171b2f19EnvironmentalOpen in IMG/M
3300031859Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.052b4f25EnvironmentalOpen in IMG/M
3300031897Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f16EnvironmentalOpen in IMG/M
3300032001Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.082 (v2)EnvironmentalOpen in IMG/M
3300032010Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.088b5f22EnvironmentalOpen in IMG/M
3300032052Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.084b2f19EnvironmentalOpen in IMG/M
3300032065Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.171b2f20EnvironmentalOpen in IMG/M
3300032205Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_05EnvironmentalOpen in IMG/M
3300032770Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.5EnvironmentalOpen in IMG/M
3300032805Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.2EnvironmentalOpen in IMG/M
3300032892Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.5EnvironmentalOpen in IMG/M
3300032954Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.2EnvironmentalOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap


 ⦗Top⦘

Family Sequences

Protein ID Sample Taxon ID Habitat Sequence
FD2_066644802189573001Grass SoilKYRYEDPANEAVEKAAAEDIAAVEQDAKFFGPDSPASQDEL
Ga0068924_122126823300004608Peatlands SoilDEPPSLIRYRYEDPAFEETEEAAAADVARVEEDDKYFGSDSSADQDEL*
Ga0066675_1133975613300005187SoilDPPGDEPNSFVKYRYEDPAFEQVEKAAAQDVAAVEEDAKYFGSDSPASQDEL*
Ga0070680_10024160133300005336Corn RhizospherePSSLIKYRYEDPAYEQVEKAAAQDVAAVEEDAKYFSPDSPASQDEL*
Ga0070705_10012321133300005440Corn, Switchgrass And Miscanthus RhizosphereSSLIKYRYEDPAYEQVEKAAAQDVAAVEEDAKYFSPDSPASQDEL*
Ga0070705_10157721713300005440Corn, Switchgrass And Miscanthus RhizosphereYRYEDPALEEVEKAAAADVAAVEEDAKFFGPDSPASQSEV*
Ga0070699_10084560213300005518Corn, Switchgrass And Miscanthus RhizosphereNSFIKYRYEDPAFEATERAAAADVAAVEKDAKFFGPDSPASQDEL*
Ga0070697_10142988323300005536Corn, Switchgrass And Miscanthus RhizospherePSSLIKYRYEDPAFEQVEKAAAQDVAAVEEDDKYFSRDSPASQDEL*
Ga0066670_1100347013300005560SoilYEDPDLEQVEKAAAQDVAAVEEDDKYFGRDSPASQDEL*
Ga0068857_10016931833300005577Corn RhizosphereDGQKSLIKYRYEDPDFEPVEEAAAADVAAVEEDDKYFGKDSPASQDEL*
Ga0068856_10230488623300005614Corn RhizosphereYEDPAYEQVEKAAAQDVAAVEEDDKYFSRDSPASQDEL*
Ga0070716_10033557513300006173Corn, Switchgrass And Miscanthus RhizosphereSSLIKYRYEDPAYEQVEKAAAQDVAAVEEDDKYFSRDSPASQDEL*
Ga0070716_10100218823300006173Corn, Switchgrass And Miscanthus RhizosphereNSFIKYRYEDPAFEPVEKAAAADVAAVEEDAKFFGPDSPASQDEL*
Ga0070765_10030589333300006176SoilPDLEETEEAAAADVAAVEEDAKYFGSGSAADRDEL*
Ga0068871_10048757223300006358Miscanthus RhizosphereDEPSSLIKYRYEDPAYEQVEKAAAQDVAAVEEDDKYFSRDSPASQDEL*
Ga0079222_1009720013300006755Agricultural SoilPDDEPSSLIKYRYEDPAFEQVEKAAAQDVAAVEEDDKYFSRDSPASQDEL*
Ga0079222_1118639413300006755Agricultural SoilPSSLIKYRYEDPAFEQVEKAAAQDVAAVEEDAKYFSPDSPASQDEL*
Ga0066659_1070016523300006797SoilAFEEVEKAAARDVAAVEEDAKYLGPDSPASQDEL*
Ga0079220_1183504323300006806Agricultural SoilDGQKSLIKYRYEDPGFEPVEEAAAADVAAVEEDAKYFGSDSPASQDEL*
Ga0079219_1220781723300006954Agricultural SoilYEDPAFEQVEKAAAQDVAAVEEDAKYFSPDSPASQDEL*
Ga0099793_1018968413300007258Vadose Zone SoilSLVKYRYEDPAFEAVEKAAAEDVAAVEQDAKFFGPDSPASQDEL*
Ga0105245_1198357213300009098Miscanthus RhizosphereRYEDPAFEQVEKAAARDVAAVEEDAKYFGPDSPASQDEL*
Ga0105247_1164419323300009101Switchgrass RhizosphereAFEATERAAAADVAAVEKDAKFFGPDSPASQDEL*
Ga0105241_1058749113300009174Corn RhizosphereLIKYRYEDPGFEPVEEAAAADVAAVEEDAKYFGKDSPASQDEL*
Ga0116218_101199263300009522Peatlands SoilEPPSLIRYRYEDPAFEETEEAAAADVARVEEDDKYFGSDSSADQDEL*
Ga0105238_1206736123300009551Corn RhizospherePSSLIKYRYEDPAFEQVEKAAAQDVAAVEEDAKYFGPDSPASQDEL*
Ga0116216_1036772923300009698Peatlands SoilNEDPAFQETEEAAAADVARVEEDAKYFGSDSPGDQDEL*
Ga0134125_1031667513300010371Terrestrial SoilPDFEPVERAAAEDVAAVEKDAKFFGPNSPASQDEL*
Ga0136449_10287112013300010379Peatlands SoilPAFQETEEAAAADVARVEEDAKYFGSDSPADQDEL*
Ga0136449_10430579623300010379Peatlands SoilPEDPDFEPTEEAAAADVAAVEQDDKYFRANSPSDQDEL*
Ga0134121_1088457323300010401Terrestrial SoilDEPNSFIKYRYEDPDFEQVEKAAARDVAAVEEDAKYFDPDSPASQDEL*
Ga0126356_1124354823300010877Boreal Forest SoilRYEDPGFEPVEEAAAADVAAVEQDDKYFGKDSPASQDEL*
Ga0150983_1482415413300011120Forest SoilPNLIKYRYEDPEFEPVERAAARDVAAVEEDAKYFGRDSPADEDEL*
Ga0137379_1004217993300012209Vadose Zone SoilHSLIKYRYEDPDFEPVEEAAAEDVAAVEEDDKYFGSDAPAKQDEL*
Ga0137385_1053277513300012359Vadose Zone SoilEPNSLIKYRYEDPAFEEVEKAAAEDVAAVEEDAKLFGPDSPASQDEL*
Ga0137410_1054351713300012944Vadose Zone SoilSLIKYRYEDPAFEQVEKAAARDVAAVEEDAKYFGPDSPASQDEL*
Ga0164309_1077029323300012984SoilPAFEQVEQAAARDVAAVEEDAKYFGPDSPASQDEL*
Ga0157373_1046408513300013100Corn RhizosphereDEPSSLIKYRYEDPAYEQVEKAAAQDVAAVEEDAKYFSPDSPASQDEL*
Ga0134079_1014963013300014166Grasslands SoilPSSLIKYRYEDPDLEQVEKAAAQDVAAVEEDDKYFGRDSPASQDEL*
Ga0157380_1180490113300014326Switchgrass RhizosphereSSLIKYRYEDPAFEQVEKAAAQDVAAVEEDAKYFSPDSPASQDEL*
Ga0157377_1032511523300014745Miscanthus RhizosphereYRYEDPGFEQVEKAAAQDVAAVEEDAKYFGPDSPASQDEL*
Ga0132255_10529405513300015374Arabidopsis RhizosphereESNRLIKYRYEDPDFEPVERAAAQDVAAIEEDAKYFGPDSPASQDEL*
Ga0182038_1146718613300016445SoilPDDGGSSLIKYRYDDPDLEETQRAAAEDVGALEQADKCFGRDSPASQDEL
Ga0182038_1201364313300016445SoilSLIKYRYEDPDFESVEKAAAEDVAAVEQDDKYFGRDSPASQDEL
Ga0187806_103339823300017928Freshwater SedimentSSDVPDEPPSLIRYRYEDPAFEETEEAAAADVARVEEDAKYFGSDSNADQDEL
Ga0187809_1004831713300017937Freshwater SedimentSLIKYRYEDPAFEQVEKAAAQDVAAVEEDAKYFSPDSPASQDEL
Ga0187780_1055125423300017973Tropical PeatlandEDPSLEPIEKAAAADVARVEEDAKYFGPNSPAGKSSEVL
Ga0187862_1060628013300018040PeatlandSLLRCRYEDPAFQETEEAAAADVAAVEEDAKYFGSDSPADQDEL
Ga0173482_1041235423300019361SoilYEDPDYEEVEKAAAQDVAAVEENDKYFSPDSPASQDEL
Ga0206356_1112149213300020070Corn, Switchgrass And Miscanthus RhizosphereEDESNSFIKYRYEDPAFEATERAAAADVAAVEKDAKFFGPDSPASQDEL
Ga0179592_1046080923300020199Vadose Zone SoilPEDEPNSLIKYRYEDPALEEVEKAAAADVAAVEEDAKFFGPASPASQSEV
Ga0210403_1055676513300020580SoilIKYRYEDPAFEPVEQAAAADVAAVEEDAKFFGPDSPASQDEL
Ga0210393_1110332313300021401SoilDAPDDGRSSLIKYRYEDPDFEPIEKAAAADVAAVEEDDKFFGRDSPASQDEL
Ga0210397_1025967823300021403SoilSLIRLRYEDPDLEETEEAAAADVAAVEEDAKYFGSDSRADRDEL
Ga0210387_1070768923300021405SoilPDIPDDERPSLLKLRYEDPDFEPTEQAAAADVAAVEEDAKYFGPDSPASQDAL
Ga0210391_1012463213300021433SoilIPDEPHSLIRLRYEDPDLEETEEAAAADVAAVEEDAKYFGSDSRADRDEL
Ga0210410_1176800613300021479SoilFIKYRYEDPSFEPTERAAAADVAAVEEDAKYFGSDSPANQDEL
Ga0210409_1028653713300021559SoilEDPAFEPVEKAAAADVAAVEEDAKFFGPDSPASQDEL
Ga0210409_1054948213300021559SoilQDEPHSLIRSRPEDPDFEEIEAAAAADVAQVEQDDKYFRSDSPANQDEL
Ga0126371_1226262913300021560Tropical Forest SoilSSLIKYRYEDPAFEEVENAAARDVAAVEEDDKYFAPDSPASQDEL
Ga0224712_1021064223300022467Corn, Switchgrass And Miscanthus RhizosphereDEPSSSLIKYRYEDPAYEQVEKAAAQDVAAVEEDAKYFSLDSPASQDEL
Ga0222622_1145868913300022756Groundwater SedimentYEDPAFEQVEKAAAQDVAAVEEDAKYFGPDSPASQDEL
Ga0247661_103369613300024254SoilEDEPSSLIKYRYEDPDFEEVENAAAQDVAAVEEDDKYFSPDSPASQDEL
Ga0247670_101837523300024283SoilPDDEPSSSLIKYRYEDPAYEQVEKAAAQDVAAVEEDDKYFSRDSPASQDEL
Ga0247666_102232513300024323SoilPAYEQVEKAAAQDVAAVEEDDKYFSRDSPASQDEL
Ga0207713_122374923300025735Switchgrass RhizospherePSSLIKYRYEDPAYEQVEKAAAQDVAAVEEDDKYFSRDSPASQDEL
Ga0207653_1008756523300025885Corn, Switchgrass And Miscanthus RhizosphereDEDDVPDDEPSSLIKYRYEDPAFEQVENAAAQDVAAVEEDDKYFSRDSPASQDEL
Ga0207692_1025780323300025898Corn, Switchgrass And Miscanthus RhizosphereIKYRYEDPDFEPVEEAAAADVAAVEEDDKYFGKDSPASQDEL
Ga0207692_1050267623300025898Corn, Switchgrass And Miscanthus RhizosphereYRYEDPAFEPVEKAAAADVAAVEEDAKFFGPDSPASQDGL
Ga0207692_1057809413300025898Corn, Switchgrass And Miscanthus RhizosphereRYEDPAFEPVEKAAAADVAAVEEDAKFFGPDSPASQDEL
Ga0207692_1058007313300025898Corn, Switchgrass And Miscanthus RhizosphereEDPSFEPVEKAAAADVAAVEEDAKYFGPDSPASQDEL
Ga0207700_1129122413300025928Corn, Switchgrass And Miscanthus RhizosphereVPEDEPNSFIKYRYEDPDFEPIERAAAEDVAAVEKDAKFFGPDSPASQDEL
Ga0207664_1011482313300025929Agricultural SoilKSLIKYRYEDPGFEPVEEAAAADVAAVEEDAKYFGSDSPASQDEL
Ga0207664_1081347623300025929Agricultural SoilPSFIKYRYEDPYFEPTERAAAADVAAVEEDAKYFGSDSPANQDEL
Ga0207670_1132722813300025936Switchgrass RhizosphereYRYEDPAYEQVEKAAAQDVAAVEEDDKYFSRDSPASQDEL
Ga0207661_1040269513300025944Corn RhizosphereDEPSSSLIKYRYEDPAYEQVEKAAAQDVAAVEEDDKYFSRDSPASQDEL
Ga0207667_1034619813300025949Corn RhizosphereSFIKYRYEDPDFEPVERAAAEDVAAVEKDAKFFGPNSPASQDEL
Ga0207712_1036567713300025961Switchgrass RhizosphereYEDPAYEQVEKAAAQDVAAVEEDDKYFSRDSPASQDEL
Ga0209474_1042873113300026550SoilEPSSLIKYRYEDPDLEQVEKAAAQDVAAVEEDDKYFGRDSPASQDEL
Ga0209114_100600623300027504Forest SoilVDTDEPPSLIRLRYEDPALEEIEQAAADDVARVQQDDRYFHADTPADHDEL
Ga0209177_1040476513300027775Agricultural SoilYEDPAFEQVEKAAAQDVAAVEEDAKYFSPDSPASQDEL
Ga0209590_1083223323300027882Vadose Zone SoilYEDPDFEPVEEAAAADVAAVEEDAKYFGSDSPANQDEL
Ga0209068_1057457823300027894WatershedsYRYEDPDFEPIEKAAAADVAAVEEDDKFFGRDSPASQDEL
Ga0209526_1023823223300028047Forest SoilRYEDPAFEPVERAAAEDVAAVEKDAKFFGPDSPASQDEL
Ga0247684_105090723300028138SoilVPDDEPSSLIKYRYEDPAYEQVEKAAAQDVAAVEEDDKYFSRDSPASQDEL
Ga0308309_1053914513300028906SoilPDLEETEEAAAADVAAVEEDAKYFGSGSAADRDEL
Ga0310037_1003042533300030494Peatlands SoilEPPSLIRYRYEDPAFEETEEAAAADVARVEEDDKYFGSDSSADQDEL
Ga0265763_105209413300030763SoilEDPDLEETEEAAAADVAAVEEDAKYFGSGSAADRDEL
Ga0318516_1005971313300031543SoilDGQSSLIKYRYDDPDFEPVEKAAAEDVAAVEEDDKFFGRDSPASQDEL
Ga0318516_1054206723300031543SoilLIKLSYQDPDFAPIQEAAARDVAAVEEDDKYFGADSPANQDEL
Ga0318534_1006604413300031544SoilNLIKYRYEDPDFEATERAAAEDVAAVEEDDKFFGRDSPANQDEL
Ga0318573_1001956763300031564SoilSEDAPDDGGSSLIKYRYDDPDLEETQRAAAADVAAVEQDDKYFGRDSPASQDEL
Ga0318555_1036299213300031640SoilEDPDFEPIERAAAEDVAAVEEDDKYFGRDSPASQDEL
Ga0318560_1014915243300031682SoilSDAPDDGQSSLIKYRYDDPDFEPVEKAAAEDVAAVEEDDKFFGRDSPASQDEL
Ga0318535_1010766623300031764SoilRSEDAPDDGGSSLIKYRYDDPDLEETQRAAAADVAAVEQDDKYFGRDSPASQDEL
Ga0318546_1058633913300031771SoilPDDGGSSLIKYRYDDPDLEETQRAAAADVAAVEQDDKYFGRDSPASQDEL
Ga0318543_1033650133300031777SoilGQSSLIKYRYDDPDFEPVEKAAAEDVAAVEEDDKFFGRDSPASQDEL
Ga0318566_1005432513300031779SoilSSLIKYRYDDPDFEPVEKAAAEDVAAVEEDDKFFGRDSPASQDEL
Ga0318547_1107371523300031781SoilPDDGGSNLIKYRYEDPDFEPIERAAAEDVAAVEEDDKYFGRDSPASQDEL
Ga0318550_1004443743300031797SoilADTPEDDGGSSLIKYRYEDPDFEATERAAAEDVAAVEEDDKFFGRDSPANQDEL
Ga0318512_1044101913300031846SoilLIKYRYEDPDFEPIERAAAEDVAAVEEDDKYFGRDSPASQDEL
Ga0318527_1044586913300031859SoilDDGGSSLIKYRYEDPDFEATERAAAEDVAAVEEDDKFFGRDSPANQDEL
Ga0318520_1051182323300031897SoilRYEDPRFETIQEAAAADVAAVEEDDKYFGPDSPANQDEL
Ga0306922_1048216443300032001SoilQSSLIKYRYDDPDFEPVEKAAAEDVAAVEEDDKFFGRDSPASQDEL
Ga0318569_1001276013300032010SoilSSLIKYRYEDPDFEATERAAAEDVAAVEEDDKFFGRDSPANQDEL
Ga0318569_1017583933300032010SoilLIKYRYEDPDFESVEKAAAEDVAAVEQDDKYFGRDSPASQDEL
Ga0318506_1044050123300032052SoilRYDDPDLEETQRAAAADVAAVEQDDKYFGRDSPASQDEL
Ga0318513_1025230633300032065SoilEDPDFEETERAAAADVAAVEEDDKYFGKDSPARQDEL
Ga0307472_10160278513300032205Hardwood Forest SoilDPDFEEVEKAAAADVAAVEKDAKFFGPDSPASQDEL
Ga0335085_1018974453300032770SoilEDPDLEPVERAAAEDVAAVEEDDKFFGRDSPASQDEL
Ga0335085_1039011913300032770SoilKHSLIKLRYEDPDFEETERAAAADVAAVEEDDKYFGKDSPANQDEL
Ga0335085_1138644213300032770SoilYEDPDFEPVEKAAAEDVAAVEQDDKYFGRDSPASQDEL
Ga0335078_1073931723300032805SoilQDEHSLVKLRYEDPAFEETERAAAADVAAVEENDKYSGKDAPGNQGGV
Ga0335081_1163124423300032892SoilSQDQPEPAGPHSLIKYRYEDPAFEPTEDAAAADVAAVEEDAKYFGHGSPASQDEL
Ga0335083_1142679713300032954SoilYRYEDPDFEPIERAAAEDVAAVEEDDKFFGRDSPASQDEL

 ⦗Top⦘


Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.