NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome Family F080403

Metagenome Family F080403

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F080403
Family Type Metagenome
Number of Sequences 115
Average Sequence Length 48 residues
Representative Sequence ALAELEERLANQERELAAYVAKAQTEIQRRESEWWQKQLGSEEVSAA
Number of Associated Samples 107
Number of Associated Scaffolds 115

Quality Assessment
Transcriptomic Evidence No
Most common taxonomic group Bacteria
% of genes with valid RBS motifs 1.01 %
% of genes near scaffold ends (potentially truncated) 84.35 %
% of genes from short scaffolds (< 2000 bps) 76.52 %
Associated GOLD sequencing projects 106
AlphaFold2 3D model prediction Yes
3D model pTM-score0.61

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Bacteria (72.174 % of family members)
NCBI Taxonomy ID 2
Taxonomy All Organisms → cellular organisms → Bacteria

Most Common Ecosystem
GOLD Ecosystem Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil
(32.174 % of family members)
Environment Ontology (ENVO) Unclassified
(30.435 % of family members)
Earth Microbiome Project Ontology (EMPO) Free-living → Non-saline → Soil (non-saline)
(55.652 % of family members)


 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      

 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Globular Signal Peptide: No Secondary Structure distribution: α-helix: 60.00%    β-sheet: 0.00%    Coil/Unstructured: 40.00%
Feature Viewer
Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer
Per-residue confidence (pLDDT):
  0-50   51-70   71-90   91-100  		pTM-score: 0.61
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.

 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 115 Family Scaffolds
PF01370Epimerase 11.30
PF03631Virul_fac_BrkB 2.61
PF11706zf-CGNR 1.74
PF00330Aconitase 1.74
PF12850Metallophos_2 0.87
PF10442FIST_C 0.87
PF16363GDP_Man_Dehyd 0.87
PF13519VWA_2 0.87
PF10431ClpB_D2-small 0.87
PF13476AAA_23 0.87
PF00694Aconitase_C 0.87
PF02965Met_synt_B12 0.87
PF00160Pro_isomerase 0.87
PF00909Ammonium_transp 0.87

Neighboring Clusters of Orthologous Genes (COGs)

COG IDNameFunctional Category % Frequency in 115 Family Scaffolds
COG1295Uncharacterized membrane protein, BrkB/YihY/UPF0761 family (not an RNase)Function unknown [S] 2.61
COG0004Ammonia channel protein AmtBInorganic ion transport and metabolism [P] 0.87
COG0652Peptidyl-prolyl cis-trans isomerase (rotamase) - cyclophilin familyPosttranslational modification, protein turnover, chaperones [O] 0.87
COG1410Methionine synthase I, cobalamin-binding domainAmino acid transport and metabolism [E] 0.87

 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms72.17 %
UnclassifiedrootN/A27.83 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
3300000597|AF_2010_repII_A1DRAFT_10132481All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium605Open in IMG/M
3300000890|JGI11643J12802_12251915Not Available623Open in IMG/M
3300004463|Ga0063356_105912168All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria525Open in IMG/M
3300004479|Ga0062595_102073271All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria552Open in IMG/M
3300005181|Ga0066678_10582811Not Available743Open in IMG/M
3300005186|Ga0066676_10581123All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria759Open in IMG/M
3300005353|Ga0070669_101275300All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria636Open in IMG/M
3300005356|Ga0070674_100179523All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Actinomycetales1620Open in IMG/M
3300005451|Ga0066681_10265640All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1044Open in IMG/M
3300005456|Ga0070678_100061048All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria2777Open in IMG/M
3300005544|Ga0070686_100213092All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1392Open in IMG/M
3300005574|Ga0066694_10572190All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria526Open in IMG/M
3300006173|Ga0070716_100605837All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria824Open in IMG/M
3300006353|Ga0075370_10849202All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria557Open in IMG/M
3300006358|Ga0068871_101023015All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria770Open in IMG/M
3300006804|Ga0079221_10366613All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria877Open in IMG/M
3300006852|Ga0075433_10972830All Organisms → cellular organisms → Bacteria740Open in IMG/M
3300006854|Ga0075425_103016283Not Available515Open in IMG/M
3300006954|Ga0079219_11311688All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria638Open in IMG/M
3300007076|Ga0075435_100455781All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1103Open in IMG/M
3300009137|Ga0066709_101071695All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1183Open in IMG/M
3300009177|Ga0105248_13461926Not Available501Open in IMG/M
3300009792|Ga0126374_10807425All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria717Open in IMG/M
3300010040|Ga0126308_10020328All Organisms → cellular organisms → Bacteria3569Open in IMG/M
3300010047|Ga0126382_11925493All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria560Open in IMG/M
3300010333|Ga0134080_10447691All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria605Open in IMG/M
3300010335|Ga0134063_10325847Not Available743Open in IMG/M
3300010336|Ga0134071_10727920Not Available526Open in IMG/M
3300010337|Ga0134062_10456401All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria635Open in IMG/M
3300010362|Ga0126377_10512175All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1233Open in IMG/M
3300010397|Ga0134124_11938323All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium625Open in IMG/M
3300011119|Ga0105246_12058374Not Available552Open in IMG/M
3300012285|Ga0137370_10629479All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria665Open in IMG/M
3300012353|Ga0137367_10462718All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium895Open in IMG/M
3300012356|Ga0137371_11081832All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria604Open in IMG/M
3300012469|Ga0150984_110293947All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium670Open in IMG/M
3300012479|Ga0157348_1020986Not Available557Open in IMG/M
3300012506|Ga0157324_1035879Not Available585Open in IMG/M
3300012883|Ga0157281_1074013Not Available572Open in IMG/M
3300012906|Ga0157295_10190736Not Available646Open in IMG/M
3300012951|Ga0164300_10931857All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria552Open in IMG/M
3300012955|Ga0164298_10891264All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria646Open in IMG/M
3300012957|Ga0164303_11078213All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria578Open in IMG/M
3300012958|Ga0164299_10331793All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria949Open in IMG/M
3300012971|Ga0126369_13353309All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria525Open in IMG/M
3300012977|Ga0134087_10226345All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria848Open in IMG/M
3300012985|Ga0164308_11279363All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria665Open in IMG/M
3300013306|Ga0163162_12615034All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria581Open in IMG/M
3300013306|Ga0163162_13338389All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium513Open in IMG/M
3300013308|Ga0157375_10830369All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1072Open in IMG/M
3300014969|Ga0157376_13012064All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria510Open in IMG/M
3300015371|Ga0132258_11102143All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria2007Open in IMG/M
3300015372|Ga0132256_100669513Not Available1153Open in IMG/M
3300015374|Ga0132255_100096456All Organisms → cellular organisms → Bacteria4001Open in IMG/M
3300018064|Ga0187773_10021507All Organisms → cellular organisms → Bacteria2770Open in IMG/M
3300018073|Ga0184624_10028718All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria2136Open in IMG/M
3300018074|Ga0184640_10498725Not Available536Open in IMG/M
3300018081|Ga0184625_10607369Not Available536Open in IMG/M
3300019362|Ga0173479_10025703All Organisms → cellular organisms → Bacteria1731Open in IMG/M
3300019875|Ga0193701_1105583All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria519Open in IMG/M
3300020062|Ga0193724_1006611Not Available2486Open in IMG/M
3300021073|Ga0210378_10341075All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria560Open in IMG/M
3300025905|Ga0207685_10052851All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1575Open in IMG/M
3300025919|Ga0207657_10387057All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1101Open in IMG/M
3300025926|Ga0207659_10838226All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria790Open in IMG/M
3300025931|Ga0207644_10895704All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria743Open in IMG/M
3300025960|Ga0207651_11756931Not Available558Open in IMG/M
3300026316|Ga0209155_1137110All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria833Open in IMG/M
3300026327|Ga0209266_1133537All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1035Open in IMG/M
3300027116|Ga0207539_100670All Organisms → cellular organisms → Bacteria868Open in IMG/M
3300028704|Ga0307321_1070175All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria684Open in IMG/M
3300028710|Ga0307322_10195845All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria550Open in IMG/M
3300028711|Ga0307293_10087647All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria984Open in IMG/M
3300028712|Ga0307285_10000820All Organisms → cellular organisms → Bacteria6155Open in IMG/M
3300028715|Ga0307313_10079436All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria985Open in IMG/M
3300028715|Ga0307313_10164952All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria685Open in IMG/M
3300028716|Ga0307311_10019288All Organisms → cellular organisms → Bacteria1685Open in IMG/M
3300028716|Ga0307311_10127837All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria723Open in IMG/M
3300028719|Ga0307301_10047735All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1313Open in IMG/M
3300028719|Ga0307301_10123247All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria828Open in IMG/M
3300028721|Ga0307315_10033007All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1391Open in IMG/M
3300028755|Ga0307316_10193579All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria732Open in IMG/M
3300028771|Ga0307320_10064535All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1363Open in IMG/M
3300028771|Ga0307320_10256789All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria690Open in IMG/M
3300028778|Ga0307288_10448643All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria529Open in IMG/M
3300028784|Ga0307282_10094882All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1379Open in IMG/M
3300028787|Ga0307323_10022403All Organisms → cellular organisms → Bacteria2166Open in IMG/M
3300028787|Ga0307323_10129846All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria907Open in IMG/M
3300028793|Ga0307299_10056764All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1444Open in IMG/M
3300028812|Ga0247825_10955993All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria622Open in IMG/M
3300028828|Ga0307312_10396655All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria906Open in IMG/M
3300028878|Ga0307278_10229259All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria826Open in IMG/M
3300028881|Ga0307277_10004898All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria5142Open in IMG/M
3300028884|Ga0307308_10135099All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1180Open in IMG/M
3300028885|Ga0307304_10050565All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1537Open in IMG/M
3300028885|Ga0307304_10375508All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria639Open in IMG/M
3300031740|Ga0307468_100038144All Organisms → cellular organisms → Bacteria2380Open in IMG/M
3300031938|Ga0308175_100754921All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1061Open in IMG/M
3300033550|Ga0247829_11221942All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria623Open in IMG/M


 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil32.17%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Soil6.09%
Vadose Zone SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil5.22%
Grasslands SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil5.22%
Groundwater SedimentEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment4.35%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil3.48%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural → Soil2.61%
Populus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere2.61%
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere2.61%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Miscanthus Rhizosphere2.61%
Groundwater SedimentEnvironmental → Aquatic → Freshwater → Sediment → Unclassified → Groundwater Sediment1.74%
Serpentine SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Serpentine Soil1.74%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil1.74%
Agricultural SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil1.74%
Corn, Switchgrass And Miscanthus RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere1.74%
Arabidopsis RhizosphereHost-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere1.74%
Switchgrass RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere1.74%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere1.74%
Terrestrial SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil0.87%
Unplanted SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Unplanted Soil0.87%
Grasslands SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil0.87%
Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil0.87%
Hardwood Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil0.87%
Tropical PeatlandEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland0.87%
SoilEnvironmental → Terrestrial → Soil → Loam → Grasslands → Soil0.87%
Switchgrass RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Switchgrass Rhizosphere0.87%
Arabidopsis Thaliana RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Arabidopsis Thaliana Rhizosphere0.87%
Miscanthus RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere0.87%
Arabidopsis RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Arabidopsis Rhizosphere0.87%
Corn, Switchgrass And Miscanthus RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn, Switchgrass And Miscanthus Rhizosphere0.87%
Miscanthus RhizosphereHost-Associated → Plants → Rhizoplane → Soil → Unclassified → Miscanthus Rhizosphere0.87%
Populus EndosphereHost-Associated → Plants → Roots → Bulk Soil → Unclassified → Populus Endosphere0.87%
Tabebuia Heterophylla RhizosphereHost-Associated → Plants → Roots → Rhizosphere → Unclassified → Tabebuia Heterophylla Rhizosphere0.87%
Miscanthus RhizosphereHost-Associated → Plants → Roots → Rhizosphere → Soil → Miscanthus Rhizosphere0.87%
RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere0.87%
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere0.87%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere0.87%
Corn RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere0.87%
Arabidopsis RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Arabidopsis Rhizosphere0.87%
Avena Fatua RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Avena Fatua Rhizosphere0.87%

Visualization
Powered by ApexCharts



Associated Samples

Taxon OIDSample NameHabitat TypeIMG/M Link
3300000597Forest soil microbial communities from Amazon forest - 2010 replicate II A1EnvironmentalOpen in IMG/M
3300000890Soil microbial communities from Great Prairies - Iowa, Continuous Corn soilEnvironmentalOpen in IMG/M
3300004463Combined assembly of Arabidopsis thaliana microbial communitiesHost-AssociatedOpen in IMG/M
3300004479Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of All WPAsEnvironmentalOpen in IMG/M
3300005181Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_127EnvironmentalOpen in IMG/M
3300005186Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_125EnvironmentalOpen in IMG/M
3300005328Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaGHost-AssociatedOpen in IMG/M
3300005353Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaGHost-AssociatedOpen in IMG/M
3300005356Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaGHost-AssociatedOpen in IMG/M
3300005451Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_130EnvironmentalOpen in IMG/M
3300005456Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaGHost-AssociatedOpen in IMG/M
3300005544Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaGEnvironmentalOpen in IMG/M
3300005558Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_147EnvironmentalOpen in IMG/M
3300005574Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_143EnvironmentalOpen in IMG/M
3300005981Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1Host-AssociatedOpen in IMG/M
3300006173Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaGEnvironmentalOpen in IMG/M
3300006353Populus root and rhizosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5Host-AssociatedOpen in IMG/M
3300006358Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2Host-AssociatedOpen in IMG/M
3300006804Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS200EnvironmentalOpen in IMG/M
3300006852Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2Host-AssociatedOpen in IMG/M
3300006854Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD4Host-AssociatedOpen in IMG/M
3300006954Agricultural soil microbial communities from Georgia to study Nitrogen management - GA ControlEnvironmentalOpen in IMG/M
3300007076Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4Host-AssociatedOpen in IMG/M
3300009137Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_158EnvironmentalOpen in IMG/M
3300009177Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaGHost-AssociatedOpen in IMG/M
3300009792Tropical forest soil microbial communities from Panama - MetaG Plot_12EnvironmentalOpen in IMG/M
3300009840Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot105AEnvironmentalOpen in IMG/M
3300010040Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot55EnvironmentalOpen in IMG/M
3300010047Tropical forest soil microbial communities from Panama - MetaG Plot_30EnvironmentalOpen in IMG/M
3300010323Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Glu_40cm_2_24_1 metaGEnvironmentalOpen in IMG/M
3300010333Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Met_40cm_2_24_1 metaGEnvironmentalOpen in IMG/M
3300010335Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_5_09082015EnvironmentalOpen in IMG/M
3300010336Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_5_09082015EnvironmentalOpen in IMG/M
3300010337Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_2_09082015EnvironmentalOpen in IMG/M
3300010362Tropical forest soil microbial communities from Panama - MetaG Plot_22EnvironmentalOpen in IMG/M
3300010397Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-4EnvironmentalOpen in IMG/M
3300011119Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaGHost-AssociatedOpen in IMG/M
3300012198Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_20_16 metaGEnvironmentalOpen in IMG/M
3300012285Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_20_16 metaGEnvironmentalOpen in IMG/M
3300012353Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_80_16 metaGEnvironmentalOpen in IMG/M
3300012354Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_60_16 metaGEnvironmentalOpen in IMG/M
3300012356Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_40_16 metaGEnvironmentalOpen in IMG/M
3300012469Combined assembly of Soil carbon rhizosphereHost-AssociatedOpen in IMG/M
3300012479Unplanted soil (control) microbial communities from North Carolina - M.Soil.1.yng.030610EnvironmentalOpen in IMG/M
3300012506Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.6.old.040610Host-AssociatedOpen in IMG/M
3300012883Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S014-104B-1EnvironmentalOpen in IMG/M
3300012893Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S059-202B-1EnvironmentalOpen in IMG/M
3300012906Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S212-509R-1EnvironmentalOpen in IMG/M
3300012951Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_226_MGEnvironmentalOpen in IMG/M
3300012955Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_216_MGEnvironmentalOpen in IMG/M
3300012957Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_207_MGEnvironmentalOpen in IMG/M
3300012958Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_221_MGEnvironmentalOpen in IMG/M
3300012971Tropical forest soil microbial communities from Panama - MetaG Plot_1EnvironmentalOpen in IMG/M
3300012977Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Glu_20cm_5_24_1 metaGEnvironmentalOpen in IMG/M
3300012985Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_246_MGEnvironmentalOpen in IMG/M
3300013306Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaGHost-AssociatedOpen in IMG/M
3300013308Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaGHost-AssociatedOpen in IMG/M
3300014969Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaGHost-AssociatedOpen in IMG/M
3300015371Combined assembly of cpr5 and col0 rhizosphere and soilHost-AssociatedOpen in IMG/M
3300015372Soil combined assemblyHost-AssociatedOpen in IMG/M
3300015374Col-0 rhizosphere combined assemblyHost-AssociatedOpen in IMG/M
3300018061Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM0_60_b1EnvironmentalOpen in IMG/M
3300018064Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_BV02_MP05_10_MGEnvironmentalOpen in IMG/M
3300018073Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3_5_b1EnvironmentalOpen in IMG/M
3300018074Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3-1_200_b2EnvironmentalOpen in IMG/M
3300018075Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3-1_50_b1EnvironmentalOpen in IMG/M
3300018081Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3_30_b1EnvironmentalOpen in IMG/M
3300019362Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S104-311B-1 (version 2)EnvironmentalOpen in IMG/M
3300019875Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U3s2EnvironmentalOpen in IMG/M
3300020062Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? H2a1EnvironmentalOpen in IMG/M
3300021073Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_60_b1 redoEnvironmentalOpen in IMG/M
3300021080Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM0_60_coex redoEnvironmentalOpen in IMG/M
3300025899Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300025901Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes)Host-AssociatedOpen in IMG/M
3300025905Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025919Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025926Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025931Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025960Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300026316Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_122 (SPAdes)EnvironmentalOpen in IMG/M
3300026327Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_132 (SPAdes)EnvironmentalOpen in IMG/M
3300027116Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-G01A4-11 (SPAdes)EnvironmentalOpen in IMG/M
3300028704Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_379EnvironmentalOpen in IMG/M
3300028710Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_380EnvironmentalOpen in IMG/M
3300028711Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_150EnvironmentalOpen in IMG/M
3300028712Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_139EnvironmentalOpen in IMG/M
3300028715Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_203EnvironmentalOpen in IMG/M
3300028716Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_198EnvironmentalOpen in IMG/M
3300028719Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_182EnvironmentalOpen in IMG/M
3300028721Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_355EnvironmentalOpen in IMG/M
3300028755Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_356EnvironmentalOpen in IMG/M
3300028771Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_369EnvironmentalOpen in IMG/M
3300028778Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_142EnvironmentalOpen in IMG/M
3300028784Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_121EnvironmentalOpen in IMG/M
3300028787Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_381EnvironmentalOpen in IMG/M
3300028791Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_144EnvironmentalOpen in IMG/M
3300028793Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_159EnvironmentalOpen in IMG/M
3300028812Soil microbial communities from agricultural site in Penn Yan, New York, United States - 13C_Vanillin_Day48EnvironmentalOpen in IMG/M
3300028828Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_202EnvironmentalOpen in IMG/M
3300028878Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_117EnvironmentalOpen in IMG/M
3300028881Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_116EnvironmentalOpen in IMG/M
3300028884Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_195EnvironmentalOpen in IMG/M
3300028885Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_185EnvironmentalOpen in IMG/M
3300031731Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1Host-AssociatedOpen in IMG/M
3300031740Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gases AM2C_05EnvironmentalOpen in IMG/M
3300031938Soil microbial communities from UC Gill Tract Community Farm, Albany, California, United States - DLSLS.C.R1EnvironmentalOpen in IMG/M
3300033550Soil microbial communities from agricultural site in Penn Yan, New York, United States - 12C_Control_Day4EnvironmentalOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap


 ⦗Top⦘

Family Sequences

Protein ID Sample Taxon ID Habitat Sequence
AF_2010_repII_A1DRAFT_1013248113300000597Forest SoilFEADFEIRTEKLEKREGMLAELEARLGKQEAELAAYVAKAQTELQRRESEWWQKQLGSDAEVPAA*
JGI11643J12802_1225191523300000890SoilALAELEERLANQERELGAYVAKAQTEIQRRESEWWKQQLGDDAEVSAA*
Ga0063356_10591216823300004463Arabidopsis Thaliana RhizosphereLAELEARLANQERELAAYVAKAQTEIQRRESEWWQKQLGSEEVSAA*
Ga0062595_10207327123300004479SoilRLANQERELAAYVAKAQTELQRRESEWWQKQLGSRGGEPDEEEVTAA*
Ga0066678_1058281123300005181SoilREEKLAELEERLTKQEADLGAYVAKAQTELQRRESEWWQQQLGRDDAEVPAA*
Ga0066676_1058112313300005186SoilLAGLEERLAKQERELAAYVAKAQTEIQRRESEWWKKQLGGDGAVDDAEINAA*
Ga0070676_1041628223300005328Miscanthus RhizosphereLDADVEIRGDKLEEREQALAELEERLANQERELAAYVAKAQTEIQRRESEWWQKQLGSDAEISAA*
Ga0070669_10127530023300005353Switchgrass RhizosphereGDKLEEREQALAELEERLANQERELAAYVAKAQTEIQRRESEWWQKQLGSDAEISAA*
Ga0070674_10017952333300005356Miscanthus RhizosphereTELEERLANQERELAAYVANAQTEIQRRESEWWQKQLGNEEVSAA*
Ga0066681_1026564013300005451SoilEERLAKQERELAAYVAKAQTEIQRRESEWWQKQLGSDTEVDEINAA*
Ga0070678_10006104843300005456Miscanthus RhizosphereELEERLANQERELAAYVAKAQTEIQRRESEWWQKQLGAEEEVSAA*
Ga0070686_10021309223300005544Switchgrass RhizosphereELEERLANQERELAAYVAKAQTEIQRRESEWWQKQLGHEEEVSAA*
Ga0066698_1111152613300005558SoilDVEIRTDKLEQREAKLAELEERLGKQESELAAYVAQAQTELQRRESEWWQKQLGDDREISAA*
Ga0066694_1057219013300005574SoilAYVAKAQTEIQRRESEWWQKQLGSNDAEVDDAEINAA*
Ga0081538_1009670923300005981Tabebuia Heterophylla RhizosphereKLEKRERALAELEARLGAKESELASYVAKAQHELQRRESEWWAKNLGQEPEDAAASNAA*
Ga0070716_10060583723300006173Corn, Switchgrass And Miscanthus RhizosphereNQERELAAYVAKAQTELQRRESQWWQKQLGSSDTEPDEEEVNAA*
Ga0075370_1084920213300006353Populus EndosphereERELAAYVAKAQTEIQRRESEWWKQQLGDDAEVSAA*
Ga0068871_10102301513300006358Miscanthus RhizosphereELEERLANQERELAAYVAKAQTEIQRRESEWWQKQLGSEAEEASAA*
Ga0079221_1036661323300006804Agricultural SoilERLANQERELAAYVAKAQTELQRRESEWWQKQLGAEEISAA*
Ga0075433_1097283013300006852Populus RhizosphereEQREEALAELEERLAKQERELAAYVAKAQTEIQRREAEVWQRNFDSDAEVSAA*
Ga0075425_10301628313300006854Populus RhizosphereEERLAKQERELAAYVAKAQTEIQRREAEVWQRNFDSDAEVSAA*
Ga0079219_1131168813300006954Agricultural SoilYVAKAQTELQRRESQWWQKQLGSDTEPDEEEVTAA*
Ga0075435_10045578113300007076Populus RhizosphereELAAYVAKAQTEIQRRESEWWQKQLGAEEEVSAA*
Ga0066709_10107169523300009137Grasslands SoilRLGKQETELAAYVAQAQTELQRRESEWWQKQLGDDRVSAA*
Ga0105248_1346192613300009177Switchgrass RhizosphereELEERLANQERELAAYVANAQTEIQRRESEWWQKQLGNEEVSAA*
Ga0126374_1080742523300009792Tropical Forest SoilANQERELQAYVAKAQTELQRRESEWWQKQLGAEEEINAA*
Ga0126313_1004832713300009840Serpentine SoilLEKREKALAELEARLGAKESELASYVAKAQHELQRRESEWWAKNLGKDPEDTANAA*
Ga0126308_1002032813300010040Serpentine SoilREQALVELEERLATQERELGAYVANAQTEIQRRESEWWKQQLGEGASAA*
Ga0126382_1192549313300010047Tropical Forest SoilGNQERELAAYVAKAQTEIQRRESEWWQKQLGSEEVSAA*
Ga0134086_1014044023300010323Grasslands SoilEACLSADVEIRTDKLEQREAKLAELEERLGKQETELAAYVAQAQSELQRRESEWWQKQLGDDQKISAA*
Ga0134080_1044769123300010333Grasslands SoilRLGKQETELAAYVAQAQSELQRRESEWWQKQLGDDRVSAA*
Ga0134063_1032584713300010335Grasslands SoilADLGAYVAKAQTELQRRESEWWQQQLGRDDAEVPAA*
Ga0134071_1072792013300010336Grasslands SoilLAELEERLKKQETELAAYVAKAQTEIQRRESEWWQKQLGNDAEIPAA*
Ga0134062_1045640113300010337Grasslands SoilREADLAELEERLAKQETELAAYVAQAQTELQRRESEWWQKQLGHDAEVPAA*
Ga0126377_1051217523300010362Tropical Forest SoilNQERELAAYVAKAQTEIQRRESEWWQKQLGSEEVSAA*
Ga0134124_1193832313300010397Terrestrial SoilERMTKQEAELAAYVASAQTELQRRESQWWQKQADDAEVPAA*
Ga0105246_1205837413300011119Miscanthus RhizosphereNQERELAAYVAKAQTELQRRESEWWQKQLGAEEEVSAA*
Ga0137364_1054879613300012198Vadose Zone SoilADVEIRTDKLEEREAKLAELQERLGKQESELAAYVAQAQTELQRRESEWWQKQLGDDQKISAA*
Ga0137370_1062947913300012285Vadose Zone SoilTDKLEEREAKLAELQERLGKQESELAAYVAQAQTELQRRESEWWQKQLGDDQKISAA*
Ga0137367_1046271833300012353Vadose Zone SoilAELEERLGKQESELAAYVAQAQTELQRRESEWWQKQLGSDAEVPAA*
Ga0137367_1082299013300012353Vadose Zone SoilSVEADVTIRGDKLEQREAELAQLEERLAKQERELGAYVAKAQTEIQRRESEWWQKQLGGDTEVDEINAA*
Ga0137366_1082290813300012354Vadose Zone SoilEIRLEKLEKREGMLAELEERLGKQESELAAYVAQAQTELQRRESEWWQKQLGSDAEVPAA
Ga0137371_1108183223300012356Vadose Zone SoilAELEERLGKQETELAAYVAKAQTELQRRESEWWQKQLGSDTEVPAA*
Ga0150984_11029394723300012469Avena Fatua RhizosphereMTKQEAELAAYVASAQTELQRRESQWWQKQADDAEVPAA*
Ga0157348_102098623300012479Unplanted SoilIEAELEERLAKQERELAAYVAKAQTEIQRREAEAWQRNFDGDAEVSAA*
Ga0157324_103587913300012506Arabidopsis RhizosphereREEALAELEERLAKQERELAAYVAKAQTEIQRREAEAWQRNFDGDAEVSAA*
Ga0157281_107401313300012883SoilLEARLANQERELAAYVAKAQTEIQRRESEWWQKQLGSEEVSAA*
Ga0157284_1001643613300012893SoilEIRTDKLEEREHVLAELEARLANQERELAAYVAKAQTEIQRRESEWWQKQLGSEEVSAA*
Ga0157295_1019073623300012906SoilLDERAEVLAELEERLAKQERELAAYVANAQTEIQRREAEWWQKQLGNEEVSAA*
Ga0164300_1093185713300012951SoilRKQEAELATYVAQAQTEIQRRESEWWQKQLGTDAEVPAA*
Ga0164298_1089126423300012955SoilERERAAYVAKAQTEIQRRESEWWQKQLGNEEVSAA*
Ga0164303_1107821313300012957SoilEVLAELEERLTNQERELAAYVAKAQTEIQRRESEWWQKQLGNEEVSAA*
Ga0164299_1033179313300012958SoilELEERLANQERELAAYVANAQTEIQRRESEWWQKQLGSEEVSAA*
Ga0126369_1335330913300012971Tropical Forest SoilLRELEERLANQERELAAYVAKAQTELQRRESEWWQKQLGAEEINAA*
Ga0134087_1022634513300012977Grasslands SoilKQERELAAYVAKAQTEIQRRESEWWQKQLGSDTEVDEINAA*
Ga0164308_1127936323300012985SoilEHALAELEERLANQERELAAYVAKAQTEIQRRESEWWQKQLGTDAEVPAA*
Ga0163162_1261503423300013306Switchgrass RhizosphereDKLEEREHALAELEARLANQERELAAYVAKAQTEIQRRESEWWQKQLGSEEVSAA*
Ga0163162_1333838913300013306Switchgrass RhizosphereRMTKQEAELAAYVASAQTELQRRESQWWQKQADDAEVPAA*
Ga0157375_1083036923300013308Miscanthus RhizosphereLEERLANQEREVAAYVAKAQTEIQRRESEWWQKQLGAEEEVSAA*
Ga0157376_1301206423300014969Miscanthus RhizosphereRLANQEREVAAYVAKAQTEIQRRESEWWQKQLGSEAEEVSAA*
Ga0132258_1110214333300015371Arabidopsis RhizosphereALAELEERLAKQERELAAYVAKAQTEIQRREAEAWQRNFDGDAEVSAA*
Ga0132256_10066951313300015372Arabidopsis RhizosphereNQERELAAYVAKAQTELQRRESEWWQKQLGAEEISAA*
Ga0132255_10009645613300015374Arabidopsis RhizosphereKNQERELGAYVAKAQTEIQRRESEWWKQQLGEDAEVSAA*
Ga0184619_1021284323300018061Groundwater SedimentADVEIRGDKLEKRERELAELEERLANHERELAAYVANAQTEIQRRESEWWQKQLGSDAEVSAA
Ga0187773_1002150753300018064Tropical PeatlandKQESELAAYVAQAQTELQRRESEWWQKQLGRDAEMPAA
Ga0184624_1002871843300018073Groundwater SedimentGDKLEEREQALAELEERLANQERELAAYVAKAQTEIQRRESEWWQKQLGSDAEISAA
Ga0184640_1049872513300018074Groundwater SedimentNQERELAAYVANAQTEIQRRESEWWQKQLGNDAEISAA
Ga0184632_1048136023300018075Groundwater SedimentRTDKLEKREKALAELEARLGAKESEMASYVAKAQHELQRRESEWWAKNLGRDPEDAASNA
Ga0184625_1060736913300018081Groundwater SedimentQREQELAELELRLANQERELAAYVANAQTEIQRRESEWWQKQLGSDTEVSAA
Ga0173479_1002570313300019362SoilKLEEREHVLAELEARLANQERELAAYVAKAQTEIQRRESEWWQKQLGSEEVSAA
Ga0193701_110558313300019875SoilLAQLEERLAKQERELAAYVAKAQTELQRRESQWWQKQLGSDDAEVDEEINAA
Ga0193724_100661113300020062SoilRLANQERELAAYVANAQTEIQRRESEWWQKQLGSEEISAA
Ga0210378_1034107523300021073Groundwater SedimentLAELEERLRKQEAELATYVAQAQTEIQRRESEWWQKQLGTDAEVPAA
Ga0210382_1022269623300021080Groundwater SedimentLREASLEADVTIRGDKLEQRETELAGLEERLAKQERELAAYVAKAQTEIQRRESEWWQKQLGSNDAEVDDAEINAA
Ga0207642_1108578223300025899Miscanthus RhizosphereEIRGDKLEEREQALAELEERLANQERELAAYVAKAQTEIQRRKSEWWQKQLGNDAEISAA
Ga0207688_1012779423300025901Corn, Switchgrass And Miscanthus RhizosphereVREAQLTADVEIRTDKLEEREHALAELEARLANQERELAAYVAKAQTEIQRRESEWWQKQLGSEEVSAA
Ga0207685_1005285113300025905Corn, Switchgrass And Miscanthus RhizosphereELEERLANQERELAAYVAKAQTELQRRESEWWQKQLGAEEISAA
Ga0207657_1038705713300025919Corn RhizosphereEREEALAELEERLANQERELAAYVANAQTEIQRRESEWWQKQLGNEEVSAA
Ga0207659_1083822623300025926Miscanthus RhizosphereEQALAELEERLANQERELAAYVAKAQTEIQRRESEWWQKQLGSEEVSAA
Ga0207644_1089570423300025931Switchgrass RhizosphereNQEREVAAYVAKAQTEIQRRESEWWQKQLGSEAEEVSAA
Ga0207651_1175693113300025960Switchgrass RhizosphereANQERELAAYVAKAQTEIQRRESEWWQKQLGHEEEVSAA
Ga0209155_113711013300026316SoilLAELEERLAKQETELAAYVAQAQTELQRRESEWWQKQLGHDAEVPAA
Ga0209266_113353723300026327SoilERLGKQESELAAYVAQAQTELQRRESEWWQKQLGDDREISAA
Ga0207539_10067023300027116SoilANQERELAAYVAKAQTEIQRRESEWWQKQLGSEEVSAA
Ga0307321_107017513300028704SoilRELAAYVAKAQTEIQRRESEWWQKQLGNDAEISAA
Ga0307322_1019584513300028710SoilQALAELEERLANQERELAAYVAKAQTEIQRRESEWWQKQLGNDAEISAA
Ga0307293_1008764723300028711SoilRLANQERELAAYVANAQTEIQRRESEWWQKQLGSDTEVSAA
Ga0307285_1000082013300028712SoilQELAELELRLANQERELAAYVANAQTEIQRRESEWWQKQLGSDTEVSAA
Ga0307313_1007943613300028715SoilRGDKLEQREQELAELELRLANQERELAAYVANAQTEIQRRESEWWQKQLGNEEVSAA
Ga0307313_1016495213300028715SoilQERELAAYVAKAQTEIQRRESEWWQKQLGNDAEISAA
Ga0307311_1001928833300028716SoilEQREQELAELELRLANQERELAAYVANAQTEIQRRESEWWQKQLGSDTEVSAA
Ga0307311_1012783723300028716SoilAALEELEERLAKQEREVAAYVAKAQTELQRRESEWWQKQLGKDAEINAA
Ga0307301_1004773513300028719SoilDKLEKRERELAELEQRLANQERELAAYVANAQTEIQRRESEWWQKQLGSDAEASAA
Ga0307301_1012324723300028719SoilELAELELRLANQERELAAYVANAQTEIQRRESEWWQKQLGSDTEVSAA
Ga0307315_1003300713300028721SoilGDKLEQREQELAELELRLANQERELAAYVANAQTEIQRRESEWWQKQLGNEEVSAA
Ga0307316_1019357923300028755SoilLANQERELAAYVANAQTEIQRRESEWWQKQLGSDAEVSAA
Ga0307320_1006453523300028771SoilRGDKLEQREQELAELELRLANQERELAAYVANAQTEIQRRESEWWQKQLGSDTEVSAA
Ga0307320_1025678913300028771SoilLGELEERLRKQEREVAAYVAKAQTELQRRESEWWQKQLGKDAEINAA
Ga0307288_1044864313300028778SoilLEERLAKQERELAAYVAKAQTELQRRESQWWQKQLGSDDAEVDEEINAA
Ga0307282_1009488223300028784SoilQVMAELEERLRKQEAELATYVAQAQTEIQRRESEWWQKQLGTDAEVPAA
Ga0307323_1002240313300028787SoilQREQELAELELRLANQERELAAYVANAQTEIQRRESEWWQKQLGNEEVSAA
Ga0307323_1012984623300028787SoilLANQERELAAYVAKAQTEIQRRESEWWQKQLGSDAEISAA
Ga0307290_1006349413300028791SoilDADVEIRGDKLEQREQELAELELRLANQERELAAYVANAQTEIQRRESEWWQKQLGSDTEVSAA
Ga0307299_1005676413300028793SoilDKLEQREQELAELELRLANQERELAAYVANAQTEIQRRESEWWQKQLGSDTEVSAA
Ga0247825_1095599313300028812SoilALAELEERLANQERELAAYVAKAQTEIQRRESEWWQKQLGSEEVSAA
Ga0307312_1039665513300028828SoilQEAELATYVAQAQTEIQRRESEWWQKQLGTDAEVPAA
Ga0307278_1022925923300028878SoilAELEERLRKQEAELATYVAQAQTEIQRRESEWWQKQLGTDAEVPAA
Ga0307277_1000489813300028881SoilLAKQEREVAAYVAKAQTELQRRESEWWQKQLGKDAEINAA
Ga0307308_1013509923300028884SoilIRGDKLEEREQALAELEERLANQERELAAYVAKAQTEIQRRESEWWQKQLGNDAEISAA
Ga0307304_1005056513300028885SoilEERLAKQERELAAYVAKAQTELQRRESQWWQKQLGSDDAEVDEEINAA
Ga0307304_1037550823300028885SoilEAELAELEERLVKQESELAAYVAQAQTELQRRESEWWQKQLGHDAEVPAA
Ga0307405_1005663413300031731RhizosphereLDLHQAQLTADVEIRTDKLEEREQALAELEERLATQERELGAYVANAQTEIQRRESEWWKQQLGEGASAA
Ga0307468_10003814413300031740Hardwood Forest SoilLAELEARLANQERELAAYVAKAQTEIQRRESEWWQKQLGSEEVSAA
Ga0308175_10075492123300031938SoilDKLDAKEEALAELEERLANQERELAAYVANAQTELQRRESEWWQKQLGAEEEVSAA
Ga0247829_1122194223300033550SoilAELEERLRKQEAELATYVAQAQTEIQRRESEWWQKQLGTDAEIPAA

 ⦗Top⦘


Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.