NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome / Metatranscriptome Family F080370

Metagenome / Metatranscriptome Family F080370

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F080370
Family Type Metagenome / Metatranscriptome
Number of Sequences 115
Average Sequence Length 53 residues
Representative Sequence MSRVTMPVLVRLLLCAALFGVLGASSTPSQESASTPESHLPTTNSLSGYIIAVG
Number of Associated Samples 89
Number of Associated Scaffolds 115

Quality Assessment
Transcriptomic Evidence Yes
Most common taxonomic group Bacteria
% of genes with valid RBS motifs 82.61 %
% of genes near scaffold ends (potentially truncated) 29.57 %
% of genes from short scaffolds (< 2000 bps) 87.83 %
Associated GOLD sequencing projects 85
AlphaFold2 3D model prediction Yes
3D model pTM-score0.30

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Bacteria (95.652 % of family members)
NCBI Taxonomy ID 2
Taxonomy All Organisms → cellular organisms → Bacteria

Most Common Ecosystem
GOLD Ecosystem Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere
(12.174 % of family members)
Environment Ontology (ENVO) Unclassified
(23.478 % of family members)
Earth Microbiome Project Ontology (EMPO) Host-associated → Plant → Plant rhizosphere
(49.565 % of family members)



 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      


 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Fibrous Signal Peptide: Yes Secondary Structure distribution: α-helix: 24.39%    β-sheet: 0.00%    Coil/Unstructured: 75.61%
Feature Viewer
Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer
Per-residue confidence (pLDDT):
  0-50   51-70   71-90   91-100  
pTM-score: 0.30
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.


 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 115 Family Scaffolds
PF13424TPR_12 18.26
PF07719TPR_2 5.22
PF01136Peptidase_U32 1.74
PF02222ATP-grasp 0.87
PF01642MM_CoA_mutase 0.87
PF12392DUF3656 0.87
PF00378ECH_1 0.87

Neighboring Clusters of Orthologous Genes (COGs)

COG IDNameFunctional Category % Frequency in 115 Family Scaffolds
COG082623S rRNA C2501 and tRNA U34 5'-hydroxylation protein RlhA/YrrN/YrrO, U32 peptidase familyTranslation, ribosomal structure and biogenesis [J] 1.74
COG1884Methylmalonyl-CoA mutase, N-terminal domain/subunitLipid transport and metabolism [I] 0.87


 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms95.65 %
UnclassifiedrootN/A4.35 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
3300001305|C688J14111_10025459All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium1757Open in IMG/M
3300002568|C688J35102_120360670All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium1014Open in IMG/M
3300003163|Ga0006759J45824_1122267All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium731Open in IMG/M
3300003267|soilL1_10024278All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium2056Open in IMG/M
3300003544|Ga0007417J51691_1066605All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium1143Open in IMG/M
3300003573|Ga0007412J51696_1102317All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium689Open in IMG/M
3300003576|Ga0007413J51701_1032292All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium1180Open in IMG/M
3300004153|Ga0063455_100028194All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium1646Open in IMG/M
3300004799|Ga0058863_11692184All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium1178Open in IMG/M
3300004803|Ga0058862_12383209All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium673Open in IMG/M
3300005167|Ga0066672_10439659All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium852Open in IMG/M
3300005171|Ga0066677_10289927All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium934Open in IMG/M
3300005177|Ga0066690_10102900All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium1835Open in IMG/M
3300005178|Ga0066688_10112357All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes1676Open in IMG/M
3300005187|Ga0066675_10380963All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium1038Open in IMG/M
3300005187|Ga0066675_10800401All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium712Open in IMG/M
3300005345|Ga0070692_10576031All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium741Open in IMG/M
3300005434|Ga0070709_10022753All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes3671Open in IMG/M
3300005434|Ga0070709_10030355All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium3243Open in IMG/M
3300005434|Ga0070709_10168748All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium1528Open in IMG/M
3300005434|Ga0070709_10545976All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium886Open in IMG/M
3300005435|Ga0070714_100048899All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → Gemmatimonadaceae → Gemmatirosa → Gemmatirosa kalamazoonesis3599Open in IMG/M
3300005436|Ga0070713_100001863All Organisms → cellular organisms → Bacteria13610Open in IMG/M
3300005436|Ga0070713_101835322All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium588Open in IMG/M
3300005439|Ga0070711_101903073All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium523Open in IMG/M
3300005451|Ga0066681_10285616All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium1007Open in IMG/M
3300005458|Ga0070681_10168020All Organisms → cellular organisms → Bacteria2116Open in IMG/M
3300005547|Ga0070693_100277118All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium1122Open in IMG/M
3300005563|Ga0068855_100937304All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium913Open in IMG/M
3300005578|Ga0068854_101015948All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium735Open in IMG/M
3300005587|Ga0066654_10248520All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium937Open in IMG/M
3300005587|Ga0066654_10604803All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium607Open in IMG/M
3300005614|Ga0068856_101035983All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium839Open in IMG/M
3300005616|Ga0068852_100490307All Organisms → cellular organisms → Bacteria1222Open in IMG/M
3300005875|Ga0075293_1014052All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium954Open in IMG/M
3300006028|Ga0070717_10157311All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium1970Open in IMG/M
3300006028|Ga0070717_12155722Not Available501Open in IMG/M
3300006173|Ga0070716_101421963All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium564Open in IMG/M
3300006175|Ga0070712_100028755All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes3721Open in IMG/M
3300006358|Ga0068871_102372045All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium506Open in IMG/M
3300006755|Ga0079222_10605652All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium838Open in IMG/M
3300006755|Ga0079222_11138946All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium690Open in IMG/M
3300006804|Ga0079221_10094367All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium1455Open in IMG/M
3300006804|Ga0079221_10994509All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium629Open in IMG/M
3300006806|Ga0079220_11015124All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium660Open in IMG/M
3300006854|Ga0075425_101490408All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium764Open in IMG/M
3300006871|Ga0075434_100628696All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium1092Open in IMG/M
3300006903|Ga0075426_10516692All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium888Open in IMG/M
3300006954|Ga0079219_10010404All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → Gemmatimonadaceae → Gemmatirosa → Gemmatirosa kalamazoonesis3095Open in IMG/M
3300009551|Ga0105238_12562626All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium546Open in IMG/M
3300010095|Ga0127475_1073301All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium749Open in IMG/M
3300010140|Ga0127456_1009491All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium589Open in IMG/M
3300010320|Ga0134109_10424375All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium536Open in IMG/M
3300010325|Ga0134064_10107805All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium924Open in IMG/M
3300010401|Ga0134121_13130551All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium510Open in IMG/M
3300011332|Ga0126317_10496827All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium1046Open in IMG/M
3300012212|Ga0150985_100789697All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium1317Open in IMG/M
3300012212|Ga0150985_102039205All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium765Open in IMG/M
3300012212|Ga0150985_104257712All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium960Open in IMG/M
3300012212|Ga0150985_107632003All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium899Open in IMG/M
3300012212|Ga0150985_114718874All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium665Open in IMG/M
3300012212|Ga0150985_116558785All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium637Open in IMG/M
3300012212|Ga0150985_118124858All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium991Open in IMG/M
3300012212|Ga0150985_119963465All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium1190Open in IMG/M
3300012384|Ga0134036_1078324All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium1005Open in IMG/M
3300012384|Ga0134036_1146938All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium1154Open in IMG/M
3300012388|Ga0134031_1090441All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium602Open in IMG/M
3300012397|Ga0134056_1196719All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium1209Open in IMG/M
3300012405|Ga0134041_1136116All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium1196Open in IMG/M
3300012405|Ga0134041_1171667All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium989Open in IMG/M
3300012469|Ga0150984_102784155All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium1274Open in IMG/M
3300012469|Ga0150984_110340571All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium941Open in IMG/M
3300012469|Ga0150984_112246377All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium700Open in IMG/M
3300012469|Ga0150984_120926434All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium870Open in IMG/M
3300012955|Ga0164298_10502418All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium811Open in IMG/M
3300012957|Ga0164303_11487613All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium511Open in IMG/M
3300012961|Ga0164302_10745304All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium732Open in IMG/M
3300012961|Ga0164302_11426732All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium567Open in IMG/M
3300012986|Ga0164304_10617336All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium812Open in IMG/M
3300012986|Ga0164304_10745911All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium749Open in IMG/M
3300012989|Ga0164305_10603425All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium882Open in IMG/M
3300013102|Ga0157371_10989918All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium641Open in IMG/M
3300013105|Ga0157369_10236606All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → Gemmatimonadaceae → Gemmatirosa → Gemmatirosa kalamazoonesis1908Open in IMG/M
3300013105|Ga0157369_10615439All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium1121Open in IMG/M
3300013105|Ga0157369_12524996Not Available520Open in IMG/M
3300013296|Ga0157374_10458926All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium1276Open in IMG/M
3300013307|Ga0157372_13382146Not Available508Open in IMG/M
3300014487|Ga0182000_10014176All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium2003Open in IMG/M
3300018433|Ga0066667_10499378All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium1002Open in IMG/M
3300020070|Ga0206356_10696878All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium787Open in IMG/M
3300020077|Ga0206351_10255623All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium546Open in IMG/M
3300020078|Ga0206352_10625544All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium519Open in IMG/M
3300021362|Ga0213882_10206162All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium811Open in IMG/M
3300021445|Ga0182009_10365604All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium739Open in IMG/M
3300021560|Ga0126371_10605163All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium1245Open in IMG/M
3300022531|Ga0242660_1069959All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium806Open in IMG/M
3300025911|Ga0207654_11397600Not Available510Open in IMG/M
3300025915|Ga0207693_10007208All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → Gemmatimonadaceae → Gemmatirosa → Gemmatirosa kalamazoonesis9154Open in IMG/M
3300025929|Ga0207664_10096078All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → Gemmatimonadaceae → Gemmatirosa → Gemmatirosa kalamazoonesis2439Open in IMG/M
3300025933|Ga0207706_11072719All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium674Open in IMG/M
3300025989|Ga0207998_1009412All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium827Open in IMG/M
3300026142|Ga0207698_12087742Not Available580Open in IMG/M
3300026300|Ga0209027_1020411All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → Gemmatimonadaceae → Gemmatirosa → Gemmatirosa kalamazoonesis2511Open in IMG/M
3300026316|Ga0209155_1029972All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium2209Open in IMG/M
3300026322|Ga0209687_1036847All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium1591Open in IMG/M
3300026342|Ga0209057_1178289All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium615Open in IMG/M
3300026542|Ga0209805_1329557All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium579Open in IMG/M
3300030511|Ga0268241_10017126All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → Gemmatimonadaceae → Gemmatirosa → Gemmatirosa kalamazoonesis1397Open in IMG/M
3300030511|Ga0268241_10062497All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium816Open in IMG/M
3300034268|Ga0372943_0002768All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → Gemmatimonadaceae → Gemmatirosa → Gemmatirosa kalamazoonesis8728Open in IMG/M
3300034659|Ga0314780_019081All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium1148Open in IMG/M
3300034661|Ga0314782_076656All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium718Open in IMG/M
3300034665|Ga0314787_015609All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium1039Open in IMG/M
3300034667|Ga0314792_025906All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium1149Open in IMG/M
3300034668|Ga0314793_014255All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium1171Open in IMG/M



 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
Corn, Switchgrass And Miscanthus RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere12.17%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Soil9.57%
Avena Fatua RhizosphereHost-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Avena Fatua Rhizosphere9.57%
Grasslands SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil8.70%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil6.09%
Agricultural SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil5.22%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural → Soil4.35%
SoilEnvironmental → Terrestrial → Soil → Loam → Grasslands → Soil4.35%
Corn RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere4.35%
Corn RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere4.35%
Avena Fatua RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Avena Fatua Rhizosphere4.35%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil3.48%
Corn, Switchgrass And Miscanthus RhizosphereEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Corn, Switchgrass And Miscanthus Rhizosphere2.61%
Populus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere2.61%
Grasslands SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil1.74%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil1.74%
Rice Paddy SoilEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Rice Paddy Soil1.74%
Agricultural SoilEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Agricultural Soil1.74%
Host-AssociatedHost-Associated → Human → Digestive System → Large Intestine → Fecal → Host-Associated1.74%
Corn RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere1.74%
SoilEnvironmental → Aquatic → Freshwater → Groundwater → Unclassified → Soil0.87%
Terrestrial SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil0.87%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil0.87%
Sugarcane Root And Bulk SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Sugarcane Root And Bulk Soil0.87%
Corn RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere0.87%
Exposed RockEnvironmental → Terrestrial → Rock-Dwelling (Subaerial Biofilms) → Unclassified → Unclassified → Exposed Rock0.87%
Miscanthus RhizosphereHost-Associated → Plants → Roots → Rhizosphere → Soil → Miscanthus Rhizosphere0.87%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere0.87%
Corn RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere0.87%

Visualization
Powered by ApexCharts



Associated Samples

Taxon OIDSample NameHabitat TypeIMG/M Link
3300001305Grasslands soil microbial communities from Hopland, California, USAEnvironmentalOpen in IMG/M
3300002568Grasslands soil microbial communities from Hopland, California, USA - 2EnvironmentalOpen in IMG/M
3300003163Avena fatua rhizosphere microbial communities - H1_Rhizo_Litter_2 (Metagenome Metatranscriptome, Counting Only)Host-AssociatedOpen in IMG/M
3300003267Sugarcane bulk soil Sample L1EnvironmentalOpen in IMG/M
3300003544Grassland soil microbial communities from Hopland, California, USA - Sample H2_Rhizo_33 (Metagenome Metatranscriptome, Counting Only)Host-AssociatedOpen in IMG/M
3300003573Grassland soil microbial communities from Hopland, California, USA - Sample H1_Bulk_28 (Metagenome Metatranscriptome, Counting Only)Host-AssociatedOpen in IMG/M
3300003576Grassland soil microbial communities from Hopland, California, USA - Sample H1_Bulk_29 (Metagenome Metatranscriptome, Counting Only)Host-AssociatedOpen in IMG/M
3300004153Grasslands soil microbial communities from Hopland, California, USA (version 2)EnvironmentalOpen in IMG/M
3300004799Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-3 (Metagenome Metatranscriptome)Host-AssociatedOpen in IMG/M
3300004803Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-2 (Metagenome Metatranscriptome)Host-AssociatedOpen in IMG/M
3300005167Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_121EnvironmentalOpen in IMG/M
3300005171Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_126EnvironmentalOpen in IMG/M
3300005177Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_139EnvironmentalOpen in IMG/M
3300005178Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_137EnvironmentalOpen in IMG/M
3300005187Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_124EnvironmentalOpen in IMG/M
3300005345Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaGEnvironmentalOpen in IMG/M
3300005434Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaGEnvironmentalOpen in IMG/M
3300005435Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaGEnvironmentalOpen in IMG/M
3300005436Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaGEnvironmentalOpen in IMG/M
3300005439Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaGEnvironmentalOpen in IMG/M
3300005451Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_130EnvironmentalOpen in IMG/M
3300005458Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaGEnvironmentalOpen in IMG/M
3300005547Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaGEnvironmentalOpen in IMG/M
3300005563Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2Host-AssociatedOpen in IMG/M
3300005578Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2Host-AssociatedOpen in IMG/M
3300005587Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_103EnvironmentalOpen in IMG/M
3300005614Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2Host-AssociatedOpen in IMG/M
3300005616Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2Host-AssociatedOpen in IMG/M
3300005875Rice paddy soil microbial communities from Twitchell Island, California, USA - SF_Rice_25C_0N_101EnvironmentalOpen in IMG/M
3300006028Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaGEnvironmentalOpen in IMG/M
3300006173Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaGEnvironmentalOpen in IMG/M
3300006175Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaGEnvironmentalOpen in IMG/M
3300006358Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2Host-AssociatedOpen in IMG/M
3300006755Agricultural soil microbial communities from Georgia to study Nitrogen management - GA PlitterEnvironmentalOpen in IMG/M
3300006804Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS200EnvironmentalOpen in IMG/M
3300006806Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS100EnvironmentalOpen in IMG/M
3300006854Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD4Host-AssociatedOpen in IMG/M
3300006871Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3Host-AssociatedOpen in IMG/M
3300006903Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD5Host-AssociatedOpen in IMG/M
3300006954Agricultural soil microbial communities from Georgia to study Nitrogen management - GA ControlEnvironmentalOpen in IMG/M
3300009551Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaGHost-AssociatedOpen in IMG/M
3300010095Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Met_20_5_16_1 metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300010140Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Wat_40_5_24_1 metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300010320Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_2_11112015EnvironmentalOpen in IMG/M
3300010325Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_20cm_2_0_1 metaGEnvironmentalOpen in IMG/M
3300010401Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-1EnvironmentalOpen in IMG/M
3300011332Soil microbial communities from California, USA to study soil gas exchange rates - SR-CA-SC2 metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300012212Combined assembly of Hopland grassland soilHost-AssociatedOpen in IMG/M
3300012384Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Glu_20cm_5_24_1 metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300012388Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Glu_20cm_2_24_2 metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300012397Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Glu_40cm_5_24_1 metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300012405Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Glu_20cm_5_24_2 metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300012469Combined assembly of Soil carbon rhizosphereHost-AssociatedOpen in IMG/M
3300012955Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_216_MGEnvironmentalOpen in IMG/M
3300012957Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_207_MGEnvironmentalOpen in IMG/M
3300012961Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_202_MGEnvironmentalOpen in IMG/M
3300012986Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_217_MGEnvironmentalOpen in IMG/M
3300012989Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_237_MGEnvironmentalOpen in IMG/M
3300013102Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaGHost-AssociatedOpen in IMG/M
3300013105Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaGHost-AssociatedOpen in IMG/M
3300013296Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaGHost-AssociatedOpen in IMG/M
3300013307Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaGHost-AssociatedOpen in IMG/M
3300014487Bulk soil microbial communities from Mexico - Magueyal (Ma) metaGEnvironmentalOpen in IMG/M
3300018433Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_116EnvironmentalOpen in IMG/M
3300020070Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2)EnvironmentalOpen in IMG/M
3300020077Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) (v2)EnvironmentalOpen in IMG/M
3300020078Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-5 (Metagenome Metatranscriptome) (v2)EnvironmentalOpen in IMG/M
3300021362Barbacenia macrantha exposed rock microbial communities from rupestrian grasslands, the National Park of Serra do Cipo, Brazil - ER_R09EnvironmentalOpen in IMG/M
3300021445Bulk soil microbial communities from the field in Mead, Nebraska, USA - 072115-187_1 MetaGEnvironmentalOpen in IMG/M
3300021560Tropical forest soil microbial communities from Panama - MetaG Plot_4EnvironmentalOpen in IMG/M
3300022531Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-H-28-M (Metagenome Metatranscriptome) (v2)EnvironmentalOpen in IMG/M
3300025911Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025915Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025929Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025933Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025989Rice paddy soil microbial communities from Twitchell Island, California, USA - SF_Rice_10C_0N_303 (SPAdes)EnvironmentalOpen in IMG/M
3300026142Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300026300Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 09_27_2013_1_20cm (SPAdes)EnvironmentalOpen in IMG/M
3300026316Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_122 (SPAdes)EnvironmentalOpen in IMG/M
3300026322Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_136 (SPAdes)EnvironmentalOpen in IMG/M
3300026342Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_146 (SPAdes)EnvironmentalOpen in IMG/M
3300026542Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_148 (SPAdes)EnvironmentalOpen in IMG/M
3300030511Bulk soil microbial communities from Mexico - Amatitan (Am) metaG (v2)EnvironmentalOpen in IMG/M
3300034268Forest soil microbial communities from Eldorado National Forest, California, USA - SNFC_MG_FRD_1.2EnvironmentalOpen in IMG/M
3300034659Metatranscriptome of lab incibated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T60R1 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300034661Metatranscriptome of lab incibated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T60R3 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300034665Metatranscriptome of lab incibated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T20R4 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300034667Metatranscriptome of lab incibated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C8R1 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300034668Metatranscriptome of lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C0R1 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap



 ⦗Top⦘

Family Sequences

Protein ID Sample Taxon ID Habitat Sequence
C688J14111_1002545923300001305SoilLPVMARLLLCAALFGVMGASATPSQEGASTQESHLPTTNSLSGYIIAVG*
C688J35102_12036067013300002568SoilMSRVHLPVMARLLLCAALFGVMGASATPSQEGASTQESHLPTTNSLSGYIIAVG*
Ga0006759J45824_112226733300003163Avena Fatua RhizosphereMSRVTMPVLVRLLLCAALFGVMGASATPSQESASTPDSHLPTTNSLS
soilL1_1002427823300003267Sugarcane Root And Bulk SoilMSRVNLPVLVRLLLCAALFGVLGASTMPSQESASTPESHLPTTNSLSGYIIAVG*
Ga0007417J51691_106660523300003544Avena Fatua RhizosphereMSRVTMPVPVRLLLCAALFGVMGASATPSQEGASTPESHLPTTNSLS
Ga0007412J51696_110231723300003573Avena Fatua RhizosphereMSRVTMPVPVRLLLCAALFGVMGASATPSQEGASTPESHLPTTNSLSGYIIAVG*
Ga0007413J51701_103229223300003576Avena Fatua RhizosphereMSRVTMPVLVRLLLCAALFGVMGASATPSQESASTPDSHLPTTNSLSGYIIAVG*
Ga0063455_10002819433300004153SoilMSRVHLPVMARLLLCAALFGVMGASATPSQESASTPDSHLPTTNSLSGYIIAVG*
Ga0058863_1169218413300004799Host-AssociatedMSRVTMPVLVRLLLCAALFGVLGASVTPSQESASTPESHLPTTNSLSGYIIAVG*
Ga0058862_1238320913300004803Host-AssociatedMSRVHLPVLVRLLACAALFAVMSASMAPSSKSSDEGDMAATHLPTTNSFSGYIIAVG*
Ga0066672_1043965923300005167SoilMPVLVRLLMCAALAGVLSASTEPSQDGASSAATHLPTTNSFSGYIIAVG*
Ga0066677_1028992723300005171SoilMPVLVRLLMCAALAGVLSASTEPSQDGATSAATHLPTTNSFSGYIIAVG*
Ga0066690_1010290043300005177SoilMSRVTMPVLVRLLMCAALAGVLSASTEPSQDGASSAATHLPTTNSFS
Ga0066688_1011235723300005178SoilMSRVTMPVLVRLLMCAALAGVLSASTEPSQDGASSAATHLPTTNSFSGYIIAVG*
Ga0066675_1038096313300005187SoilMSRVTMPVLVRLLLCAALFGVLSASTKPSGLWPEDGASSAAMHLPTTNSLSGYIIAVG*
Ga0066675_1080040123300005187SoilMSRVTMPVLVRLLMCAALVGVLGAATEPSQDGASSAATHLPTTNSFSGYIIAVG*
Ga0070692_1057603123300005345Corn, Switchgrass And Miscanthus RhizosphereMSRVNLPVMARLLLCAALFGVLGAATTPSQESANTPESHLPTTNSLSGYIIAVG*
Ga0070709_1002275323300005434Corn, Switchgrass And Miscanthus RhizosphereVLVRLLLCAALFGVLSASATPSGQAAYESASMPDGHLPTTNSLSGYIIAVG*
Ga0070709_1003035523300005434Corn, Switchgrass And Miscanthus RhizosphereMSRLTMPVLVRLLLCAALFGVPSASATHSGQAAYASASMPDSHLPTTNSLSGYIIAVG*
Ga0070709_1016874823300005434Corn, Switchgrass And Miscanthus RhizosphereMSRVTMPVLVRLLMCAALFAVLGASASPSSQWSHEGDSAATHLPTTNSFSGYIIAVG*
Ga0070709_1054597623300005434Corn, Switchgrass And Miscanthus RhizosphereMSRVHLPVLVRLLACAALFAVMSASMAPSSKSSDEGDMAATHLPTTNSFSGY
Ga0070714_10004889933300005435Agricultural SoilMSRLTMPVLVRLLLCAALLGVPSASATHSGQAAYASASMPDSHLPTTNSLSGYIIAVG*
Ga0070713_10000186323300005436Corn, Switchgrass And Miscanthus RhizosphereMSQVTMPVLVRLLLCAALFGVLSASATPSGQAAYESASMPDGHLPTTNSLSGYIIAVG*
Ga0070713_10183532213300005436Corn, Switchgrass And Miscanthus RhizosphereMSRFRTPVLVRLLMCATLLGVSASATRSGQLPDNSASVAATDLPINSSFSGYIIAVG*
Ga0070711_10190307323300005439Corn, Switchgrass And Miscanthus RhizosphereMSRVNMPVLVRLLMCAALFAVLGASASPSSQWSHEGDAAATHLPTTNSFSG
Ga0066681_1028561623300005451SoilMFRTTMPVLVRLLMCAALFAVLGVSASPSSQWSHEGNSAATHLPTTNSFSGYIIAVG*
Ga0070681_1016802023300005458Corn RhizosphereMSRVTMPVLVRLLLCAALFGVLGASATPSQESAGTPESHLPTTNSLSGYIIAVG*
Ga0070693_10027711823300005547Corn, Switchgrass And Miscanthus RhizosphereMSRVNLPVLVRLLMCAALFGVLGAATTPSQESAGTPESHLPTTNSLSGYIIAVG*
Ga0068855_10093730413300005563Corn RhizosphereMSRVTMPVLVRLLLCAALFGVLSASATPSGQAAYESASMPDGHLPTTNSLSGYIIAVG*
Ga0068854_10101594823300005578Corn RhizosphereMSRVTMPVLVRLLLCAALFGVLGASATPSQESGGTPESHLPTTNSLSGYIIAVG*
Ga0066654_1024852023300005587SoilMSLVTMPVVVRLLSCAALFGAVSVSSAPDGQWSQSNASTPATHLPTTNSFSGYIIAVG*
Ga0066654_1060480313300005587SoilLYRTRRRLDPMSRVTMPVLVRLLMCAALFGVLSASTLPSEESASNAATHLPTTNSLSGYIIAVG*
Ga0068856_10103598323300005614Corn RhizospherePVLVRLLMCAALFGVLGAATTPSQESAGTPESHLPTTNSLSGYIIAVG*
Ga0068852_10049030723300005616Corn RhizosphereMSRVTMPVLVRLLLCAALFGALGASATPSSESASTPESHLPTTNSLSGYIIAVG*
Ga0075293_101405223300005875Rice Paddy SoilMSRVTMPVLVRLLMCAALFGVLGTASQPAWCHAQDQASFPSGKLPIKSSFSGYIIAVG*
Ga0070717_1015731123300006028Corn, Switchgrass And Miscanthus RhizosphereMSRVTMPVLVRLLLCAALFGVLSASATPSTQSAYESASMPDAHLPTTNSLSGYIIAVG*
Ga0070717_1215572213300006028Corn, Switchgrass And Miscanthus RhizosphereMSRVTMPVLVRLLLCAALVVLGASTTPSSQWSNEGDSSAATHLPTTNSFSGYIIAVG*
Ga0070716_10142196313300006173Corn, Switchgrass And Miscanthus RhizosphereLLLCAALFGVLSASATPSGQAAYESASMPDGHLPTTNSLSGYIIAVG*
Ga0070712_10002875513300006175Corn, Switchgrass And Miscanthus RhizosphereVTMPVLVRLLMCAALFAVLGASASPSTQWAHEGDSAATHLPTTNSFSGYIIAVG*
Ga0068871_10237204523300006358Miscanthus RhizospherePRRLDPMSRVTMPVLVRLLLCAALFGVLGASVTPSQESASTPESHLPTTNSLSGYIIAVG
Ga0079222_1060565223300006755Agricultural SoilMSRFRTPVLVRLLMCAALLGVSASATRSGQLPDNSASVAATDLPINSSFSGYIIAVG*
Ga0079222_1113894613300006755Agricultural SoilMSRVTMPVLVRLLLCAALFGVLGGSATPSQESASTPDSHLPTTNSLSGYIIAVG*
Ga0079221_1009436723300006804Agricultural SoilMSRVTTPVLVRLLLCAALVVLGASTTPSNQWSNEGDGSAATHLPTTNSFSGYIIAVG*
Ga0079221_1099450923300006804Agricultural SoilMSRVNLPVLVRLVLCAALFGVLGGSAMPSQESAGTPESHLPTTNSLSGYIIAVG*
Ga0079220_1101512423300006806Agricultural SoilMSRVTMPVLVRLLLCAALFGVLGASSTPSQESASTPESHLPTTNSLSGYIIAVG*
Ga0075425_10149040813300006854Populus RhizosphereMSRVNLPVLVRLLTCAALFAVVSASASPSSNEGDVAATHLPTTNSFSGYIIAVG*
Ga0075434_10062869613300006871Populus RhizosphereMSQVRMPVLVRLLTCAALVGVLSASTMPTDDASAQGGSSSEHLPTTNSLSGYIIAVG*
Ga0075426_1051669213300006903Populus RhizosphereMSRVTMPVLVRLLLCAALVVSGARTTPSSQWSNEGDSSAATHLPTTNSFSGYIIAVG*
Ga0079219_1001040423300006954Agricultural SoilMSQVHLPVLVRLLTCAALFAVMSASTAPSSKSSDEGDMAATHLPTTNSFSGYIIAVG*
Ga0105238_1256262613300009551Corn RhizosphereMPVLVRLLMCAALFGVLGAATTPSQESAGTPESHLPTTNSLSGYIIAVG*
Ga0127475_107330113300010095Grasslands SoilMPVLVRLLACAALFGAVSVSSAPDGQWSQSSANTPATHLPTTNSFSGYIIAVG*
Ga0127456_100949123300010140Grasslands SoilMPVLVRLLMCAALFGVLSASTLPSQESASNAATHLPTTNSLSGYIIAVG*
Ga0134109_1042437513300010320Grasslands SoilMFRTTMPVLVRLLMCAALFAVLGVSASPSSQWSHEGNSAATHLPTTNSFSG
Ga0134064_1010780523300010325Grasslands SoilMSRVTMPVLVRLLMCAALAGVLSASTEPPQDGASSAATHLPTTNSFSGYIIAVG*
Ga0134121_1313055113300010401Terrestrial SoilMSRVNMPVLVRLLMCAALFAVLGASASPSSQWSHEADSAATHLPTTNSFSGYIIAVG*
Ga0126317_1049682723300011332SoilMPVLVRLLLCAALFGVMGASATPSQESASTPDSHLPTTNSLSGY
Ga0150985_10078969723300012212Avena Fatua RhizosphereMPVLVRLLACAALFGAVSVSSVPDGEWSQSNADTPATHLPTTNSFSGYIIAVG*
Ga0150985_10203920523300012212Avena Fatua RhizosphereMPVLFRLLMCAALFGVLSATTLPSDESASSAATHLPTTNSLSGYIIAVG*
Ga0150985_10425771223300012212Avena Fatua RhizosphereMPVLVRLLACAALFGAVSVSSVPEGQWSQSNASTPATHLPTTNSFSGYIIAVG*
Ga0150985_10763200323300012212Avena Fatua RhizosphereMPVPVRLLLCAALFGVMGASATPSQEGASTPESHLPTTNSLSGYIIAVG*
Ga0150985_11471887423300012212Avena Fatua RhizosphereMPVLVRLLMCAALFGVLSASATPSGQPADESATAATHLPTTNSFSGYIIAVG*
Ga0150985_11655878523300012212Avena Fatua RhizosphereMPVLVRLLMCAALFGVLGASATPSGQAADESATAATHLPTTNSFSGYII
Ga0150985_11812485823300012212Avena Fatua RhizosphereMPVLVRLLLCAALFGVMGAGATPSQESASTPDSHLPTTNSLSGYIIAVG*
Ga0150985_11996346523300012212Avena Fatua RhizosphereMPVLVRLLLCAALFGVLGASATPSQESASTPESHLPTTNSLSGYIIAVG*
Ga0134036_107832413300012384Grasslands SoilMSLVTMPVVVRLLSCAALFGAVSVNSAPDGQWSQSNASTPATHLPTTNSFSGYIIAVG*
Ga0134036_114693813300012384Grasslands SoilMPVLVRLLACAALFGAVSVSSAPDGQWSQSSANTPATHLPTTNSFS
Ga0134031_109044113300012388Grasslands SoilMPVLVRLLACAALFGAVSVSSAPDGQWSQSSANTPATHLPTTNSF
Ga0134056_119671913300012397Grasslands SoilMSRVTMPVLVRLLACAALFGAVSVSSVPEGQWSQSNASTPATHLPTTNSFSGYIIAVG*
Ga0134041_113611613300012405Grasslands SoilMSLVTMPVVVRLLSCAALFGAVSVSSAPDGQWSQSNASTPATYLPTTNSFSGYIIAVG*
Ga0134041_117166713300012405Grasslands SoilMPVLVRLLMCAALFGVLSASTLPSEESASNAATHLPTTNSLSGYIIAVG*
Ga0150984_10278415523300012469Avena Fatua RhizosphereMSRVNLPVLARLLLCAALFGVMGASVTPSQESAGTPESHLPTTNSLSGYIIAVG*
Ga0150984_11034057113300012469Avena Fatua RhizosphereMSHVTMPVLVRLLACAALFGAVSVSSVPEGQWSQSNASTPATHLPTTNSFSGYIIAVG*
Ga0150984_11224637713300012469Avena Fatua RhizosphereMPVLVRLLLCAALFGVMGASATPSQESASTPDSHLPTTNSLSGYIIAVG*
Ga0150984_12092643413300012469Avena Fatua RhizosphereMARLLLCAALFGVMGASATPSQEGASTQESHLPTTNSLS
Ga0164298_1050241813300012955SoilSSINLLSNPTEARSMSRVTMPVLVRLLMCAALFAVLGASASPSTQWAHEGDSAATHLPTTNSFSGYIIAVG*
Ga0164303_1148761313300012957SoilMPVLVRLLMCAALFAVVSASTNPSSQWSYEGANSAATHLPT
Ga0164302_1074530423300012961SoilMPVLVRLLMCAALFAVLGASASPSSQCSQEGDSAATHLPTTNSFSGYIIAVG*
Ga0164302_1142673213300012961SoilMSRVTMPVLVRLLTCAALFAVMSASASPSSNEGDSAATHLPTTNSFSGYIIAVG*
Ga0164304_1061733613300012986SoilMPVLSRLLLCAALFGVLGASTTPSQESASTPESHLPTTNSLSGYIIAVG*
Ga0164304_1074591113300012986SoilMPVLVRLLMCAALFAVLGASASPSSQWSHEGDSAATHLPTTNSFSGYIIAVG*
Ga0164305_1060342523300012989SoilMPVLVRLLMCAALFAVLGASASPSTQWSHEGDAAATHLPTTNSFSGYIIAVG*
Ga0157371_1098991823300013102Corn RhizospherePVLVRLLLCAALFGALGASATPSSESASTPESHLPTTNSLSGYIIAVG*
Ga0157369_1023660623300013105Corn RhizosphereMPVLVRLLLCAALFGVLGASVTPSQESASTPESHLPTTNSLSGYIIAVG*
Ga0157369_1061543923300013105Corn RhizosphereMPVLVRLLLCAALFGVLGASATPSQESAGTPESHLPTTNSLSGYIIAVG*
Ga0157369_1252499623300013105Corn RhizosphereMPVLVRLLLCAALFGALSASATPSGQAAYESASMPDGHLPTTNSLSGYIIAVG*
Ga0157374_1045892623300013296Miscanthus RhizosphereMPGLVRLLLCAALFGALSASATPSGQAAYESASMPDGHLPTTNSLSGYIIAVG*
Ga0157372_1338214613300013307Corn RhizosphereMPVLVRLLLCAALFGVLSASATPSGQAAYESASMPDGHLPTTNSLSGYIIAVG*
Ga0182000_1001417623300014487SoilMSRVTMPVLVRLLMCAALFGVLGASTAPSAQWAQESASMPGSHLPTTNSFSGYIIAVG*
Ga0066667_1049937823300018433Grasslands SoilMFRTTMPVLVRLLMCAALFAVLGVSASPSSQWSHEGNSAATHLPTTNSFSGYIIAVG
Ga0206356_1069687823300020070Corn, Switchgrass And Miscanthus RhizosphereMSRVTMPVLVRLLLCAALFGVLGASATPSQESAGTPESHLPTTNSLSGYIIAVG
Ga0206351_1025562313300020077Corn, Switchgrass And Miscanthus RhizosphereMSRVNLPVMARLLLCAALFGVLGAATTPSQESANTPESHLPTTNSLSG
Ga0206352_1062554423300020078Corn, Switchgrass And Miscanthus RhizosphereMSRVNLPVMARLLLCAALFGVLGAATTPSQESANTPESHLP
Ga0213882_1020616213300021362Exposed RockMSRVTIPVLVRLLLCAALFGVLSATSLQGQSVDESASTPASHLPTTNSFSGYIIAVG
Ga0182009_1036560423300021445SoilMSRVTMPVLVRLLLCAALFGVLGASATPSPESASTPESHLPTTNSLSGYIIAVG
Ga0126371_1060516323300021560Tropical Forest SoilMSRVTMPVLVRLLLCAALVVLGASTTPSSQWSNEGGSSAATHLPTTNSFSGYIIAVG
Ga0242660_106995913300022531SoilMSRVTMPVLARLLACAALVGVLSVSTMPTDDLSAQGSSSAEHLPTTNSFSGYIIA
Ga0207654_1139760013300025911Corn RhizosphereMSRVNLPVLVRLLMCAALFGVLGAATTPSQESAGTPESHLPTTNSLSGYIIAVG
Ga0207693_1000720833300025915Corn, Switchgrass And Miscanthus RhizosphereMSRVTMPVLVRLLMCAALFAVLGASASPSTQWAHEGDSAATHLPTTNSFSGYIIAVG
Ga0207664_1009607833300025929Agricultural SoilMSRLTMPVLVRLLLCAALLGVPSASATHSGQAAYASASMPDSHLPTTNSLSGYIIAVG
Ga0207706_1107271923300025933Corn RhizosphereSVLVRLLLCAALVGVLGASVTPSQESASTPESHLPTTNSLSGYIIAVG
Ga0207998_100941213300025989Rice Paddy SoilRLDPMSRVTMPVLVRLLMCAALFGVLGTASQPAWCHAQDQASFPSGKLPIKSSFSGYIIAVG
Ga0207698_1208774213300026142Corn RhizosphereMSRVTMPVLVRLLLCAALFGALGASATPSSESASTPESHLPTTNSLSGYIIAVG
Ga0209027_102041123300026300Grasslands SoilMSRVTMPVLVRLLMCAALAGVLSASTEPSQDGASSAATHLPTTNSFSGYIIAVG
Ga0209155_102997213300026316SoilGSIHMSRVTMPVLVRLLMCAALAGVLSASTEPSQDGASSAATHLPTTNSFSGYIIAVG
Ga0209687_103684723300026322SoilTTMPVLVRLLMCAALFAVLGVSASPSSQWSHEGNSAATHLPTTNSFSGYIIAVG
Ga0209057_117828913300026342SoilMSRVTMPVLVRLLMCAALVGVLGAATEPSQDGASSAATHLPTTNSFSGYIIAVG
Ga0209805_132955723300026542SoilMPVLVRLLMCAALAGVLSASTEPSQDGATSAATHLPTTNSFSGYIIAVG
Ga0268241_1001712623300030511SoilMSRVTMPVLSRLLLCAALFGVMGASATPSQESASMPDSHLPTTNSLSGYIIAVG
Ga0268241_1006249723300030511SoilMSRVHKPVLVRLLMCAALAGVLSASTMPTDQSSVQGGSSVEHLPTTNSFSGYIIAVG
Ga0372943_0002768_1209_13853300034268SoilMSRVTMPVLVRLLACAALFGAASVSSAPDGQWSQSSASTPTTHLPTTNSFSGYIIAVG
Ga0314780_019081_982_11313300034659SoilMPVLVRLLTCAALFAVMSASASPSSNEGDSAATHLPTTNSFSGYIIAVG
Ga0314782_076656_591_7163300034661SoilMSRVTMPVLVRLLTCAALFAVMSASASPSSNEGDSAATHLPT
Ga0314787_015609_915_10373300034665SoilMSRVTMPVLVRLLTCAALFAVMSASASPSSNEGDSAATHLP
Ga0314792_025906_1006_11493300034667SoilMSRVTMPVLVRLLTCAALFAVMSASASPSSNEGDSAATHLPTTNSFSG
Ga0314793_014255_1011_11693300034668SoilMSRVTMPVLVRLLTCAALFAVMSASASPSSNEGDSAATHLPTTNSFSGYIIAV


 ⦗Top⦘


© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.