NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome Family F080359

Metagenome Family F080359

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F080359
Family Type Metagenome
Number of Sequences 115
Average Sequence Length 43 residues
Representative Sequence MPYRVVAFTMAQVRQGALGFQRQLSAVLREHAEIKVYSVSPFDLD
Number of Associated Samples 108
Number of Associated Scaffolds 115

Quality Assessment
Transcriptomic Evidence No
Most common taxonomic group Bacteria
% of genes with valid RBS motifs 28.70 %
% of genes near scaffold ends (potentially truncated) 100.00 %
% of genes from short scaffolds (< 2000 bps) 92.17 %
Associated GOLD sequencing projects 106
AlphaFold2 3D model prediction Yes
3D model pTM-score0.49

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Bacteria (82.609 % of family members)
NCBI Taxonomy ID 2
Taxonomy All Organisms → cellular organisms → Bacteria

Most Common Ecosystem
GOLD Ecosystem Environmental → Aquatic → Freshwater → Wetlands → Bog → Peatland
(11.304 % of family members)
Environment Ontology (ENVO) Unclassified
(30.435 % of family members)
Earth Microbiome Project Ontology (EMPO) Free-living → Non-saline → Soil (non-saline)
(46.087 % of family members)


 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      

 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Globular Signal Peptide: No Secondary Structure distribution: α-helix: 28.77%    β-sheet: 0.00%    Coil/Unstructured: 71.23%
Feature Viewer
Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer
Per-residue confidence (pLDDT):
  0-50   51-70   71-90   91-100  		pTM-score: 0.49
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.

 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 115 Family Scaffolds
PF02678Pirin 21.74
PF02578Cu-oxidase_4 20.00
PF07228SpoIIE 6.09
PF03989DNA_gyraseA_C 5.22
PF00293NUDIX 4.35
PF01266DAO 4.35
PF00271Helicase_C 3.48
PF05960DUF885 3.48
PF04264YceI 2.61
PF01850PIN 2.61
PF07311Dodecin 1.74
PF01979Amidohydro_1 0.87
PF07498Rho_N 0.87
PF00440TetR_N 0.87
PF03572Peptidase_S41 0.87
PF05176ATP-synt_10 0.87
PF00881Nitroreductase 0.87
PF00857Isochorismatase 0.87
PF04185Phosphoesterase 0.87
PF06262Zincin_1 0.87
PF01380SIS 0.87
PF00543P-II 0.87
PF10026DUF2268 0.87

Neighboring Clusters of Orthologous Genes (COGs)

COG IDNameFunctional Category % Frequency in 115 Family Scaffolds
COG1741Redox-sensitive bicupin YhaK, pirin superfamilyGeneral function prediction only [R] 21.74
COG1496Copper oxidase (laccase) domainInorganic ion transport and metabolism [P] 20.00
COG0188DNA gyrase/topoisomerase IV, subunit AReplication, recombination and repair [L] 5.22
COG4805Uncharacterized conserved protein, DUF885 familyFunction unknown [S] 3.48
COG2353Polyisoprenoid-binding periplasmic protein YceIGeneral function prediction only [R] 2.61
COG3360Flavin-binding protein dodecinGeneral function prediction only [R] 1.74
COG0347Nitrogen regulatory protein PIISignal transduction mechanisms [T] 0.87
COG0793C-terminal processing protease CtpA/Prc, contains a PDZ domainPosttranslational modification, protein turnover, chaperones [O] 0.87
COG1335Nicotinamidase-related amidaseCoenzyme transport and metabolism [H] 0.87
COG1535Isochorismate hydrolaseSecondary metabolites biosynthesis, transport and catabolism [Q] 0.87
COG3511Phospholipase CCell wall/membrane/envelope biogenesis [M] 0.87
COG3824Predicted Zn-dependent protease, minimal metalloprotease (MMP)-like domainPosttranslational modification, protein turnover, chaperones [O] 0.87

 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms82.61 %
UnclassifiedrootN/A17.39 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
3300001593|JGI12635J15846_10514830All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium704Open in IMG/M
3300004080|Ga0062385_10408648Not Available813Open in IMG/M
3300004092|Ga0062389_101895218Not Available774Open in IMG/M
3300004152|Ga0062386_100367168All Organisms → cellular organisms → Bacteria1155Open in IMG/M
3300005178|Ga0066688_10600893All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium707Open in IMG/M
3300005181|Ga0066678_10385746All Organisms → cellular organisms → Bacteria928Open in IMG/M
3300005353|Ga0070669_100576872All Organisms → cellular organisms → Bacteria → Acidobacteria940Open in IMG/M
3300005454|Ga0066687_10556428All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium681Open in IMG/M
3300005456|Ga0070678_100070375All Organisms → cellular organisms → Bacteria2615Open in IMG/M
3300005518|Ga0070699_100105082All Organisms → cellular organisms → Bacteria → Acidobacteria2477Open in IMG/M
3300005546|Ga0070696_101600888All Organisms → cellular organisms → Bacteria → Acidobacteria559Open in IMG/M
3300006057|Ga0075026_100430703Not Available747Open in IMG/M
3300006059|Ga0075017_100115221All Organisms → cellular organisms → Bacteria → Acidobacteria1885Open in IMG/M
3300006162|Ga0075030_100125719All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium2083Open in IMG/M
3300006174|Ga0075014_100077910All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1497Open in IMG/M
3300006176|Ga0070765_101075262All Organisms → cellular organisms → Bacteria → Acidobacteria760Open in IMG/M
3300006176|Ga0070765_102289288All Organisms → cellular organisms → Bacteria503Open in IMG/M
3300006237|Ga0097621_101482560All Organisms → cellular organisms → Bacteria → Acidobacteria643Open in IMG/M
3300009038|Ga0099829_10015824All Organisms → cellular organisms → Bacteria → Proteobacteria5043Open in IMG/M
3300009500|Ga0116229_10242182All Organisms → cellular organisms → Bacteria → Acidobacteria1537Open in IMG/M
3300009520|Ga0116214_1087614Not Available1141Open in IMG/M
3300009521|Ga0116222_1113986All Organisms → cellular organisms → Bacteria1164Open in IMG/M
3300009547|Ga0116136_1193188All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium506Open in IMG/M
3300009629|Ga0116119_1164273All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Opitutae → unclassified Opitutae → Opitutae bacterium554Open in IMG/M
3300009643|Ga0116110_1302146All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Opitutae → unclassified Opitutae → Opitutae bacterium508Open in IMG/M
3300009646|Ga0116132_1192472All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Opitutae → unclassified Opitutae → Opitutae bacterium619Open in IMG/M
3300009839|Ga0116223_10388747Not Available822Open in IMG/M
3300010373|Ga0134128_10642443All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1180Open in IMG/M
3300010379|Ga0136449_101461682Not Available1050Open in IMG/M
3300010396|Ga0134126_11620859All Organisms → cellular organisms → Bacteria → Acidobacteria711Open in IMG/M
3300011269|Ga0137392_10184048All Organisms → cellular organisms → Bacteria1702Open in IMG/M
3300011271|Ga0137393_10151167All Organisms → cellular organisms → Bacteria1939Open in IMG/M
3300012351|Ga0137386_11170081Not Available540Open in IMG/M
3300012362|Ga0137361_11212440Not Available677Open in IMG/M
3300012917|Ga0137395_11063035All Organisms → cellular organisms → Bacteria → Acidobacteria576Open in IMG/M
3300012944|Ga0137410_10175939All Organisms → cellular organisms → Bacteria1645Open in IMG/M
3300012951|Ga0164300_10200791Not Available977Open in IMG/M
3300014162|Ga0181538_10178548Not Available1203Open in IMG/M
3300014164|Ga0181532_10619959All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Opitutae → unclassified Opitutae → Opitutae bacterium586Open in IMG/M
3300014164|Ga0181532_10733721All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Opitutae → unclassified Opitutae → Opitutae bacterium531Open in IMG/M
3300014326|Ga0157380_11894629Not Available657Open in IMG/M
3300014491|Ga0182014_10411902All Organisms → cellular organisms → Bacteria673Open in IMG/M
3300015087|Ga0167637_1016665All Organisms → cellular organisms → Bacteria → Acidobacteria1066Open in IMG/M
3300017822|Ga0187802_10247347All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium690Open in IMG/M
3300017823|Ga0187818_10121132All Organisms → cellular organisms → Bacteria → Acidobacteria1134Open in IMG/M
3300017938|Ga0187854_10500262All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium503Open in IMG/M
3300017940|Ga0187853_10277107All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium764Open in IMG/M
3300017943|Ga0187819_10539478All Organisms → cellular organisms → Bacteria → Acidobacteria663Open in IMG/M
3300018002|Ga0187868_1070595All Organisms → cellular organisms → Bacteria1424Open in IMG/M
3300018006|Ga0187804_10032380All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1972Open in IMG/M
3300018013|Ga0187873_1362074All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → unclassified Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter sp. SbA7529Open in IMG/M
3300018016|Ga0187880_1052344All Organisms → cellular organisms → Bacteria2175Open in IMG/M
3300018022|Ga0187864_10424114All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Opitutae → unclassified Opitutae → Opitutae bacterium569Open in IMG/M
3300018026|Ga0187857_10387532Not Available631Open in IMG/M
3300018030|Ga0187869_10327515All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium735Open in IMG/M
3300018033|Ga0187867_10256421All Organisms → cellular organisms → Bacteria984Open in IMG/M
3300018034|Ga0187863_10403960All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium762Open in IMG/M
3300018037|Ga0187883_10572477All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium585Open in IMG/M
3300018038|Ga0187855_10516990All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium695Open in IMG/M
3300018040|Ga0187862_10675863All Organisms → cellular organisms → Bacteria605Open in IMG/M
3300018085|Ga0187772_11364859All Organisms → cellular organisms → Bacteria → Acidobacteria525Open in IMG/M
3300018086|Ga0187769_10192121All Organisms → cellular organisms → Bacteria → Acidobacteria1508Open in IMG/M
3300018090|Ga0187770_11187411All Organisms → cellular organisms → Bacteria → Acidobacteria617Open in IMG/M
3300019787|Ga0182031_1179318All Organisms → cellular organisms → Bacteria578Open in IMG/M
3300020061|Ga0193716_1004907All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae7147Open in IMG/M
3300020580|Ga0210403_11492166All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium509Open in IMG/M
3300020582|Ga0210395_10286789All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Terracidiphilus → Terracidiphilus gabretensis1238Open in IMG/M
3300020582|Ga0210395_10426205All Organisms → cellular organisms → Bacteria → Acidobacteria998Open in IMG/M
3300021178|Ga0210408_10061471All Organisms → cellular organisms → Bacteria2934Open in IMG/M
3300021403|Ga0210397_10679684All Organisms → cellular organisms → Bacteria → Acidobacteria790Open in IMG/M
3300021432|Ga0210384_10351377All Organisms → cellular organisms → Bacteria1327Open in IMG/M
3300021478|Ga0210402_10988645All Organisms → cellular organisms → Bacteria768Open in IMG/M
3300021478|Ga0210402_11080363All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium730Open in IMG/M
3300021479|Ga0210410_10354798All Organisms → cellular organisms → Bacteria → Acidobacteria1315Open in IMG/M
3300022840|Ga0224549_1062577All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium509Open in IMG/M
3300023090|Ga0224558_1106724Not Available967Open in IMG/M
3300023090|Ga0224558_1116036Not Available908Open in IMG/M
3300025434|Ga0208690_1073230All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium532Open in IMG/M
3300025923|Ga0207681_10626894All Organisms → cellular organisms → Bacteria890Open in IMG/M
3300025934|Ga0207686_11759792All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium513Open in IMG/M
3300026023|Ga0207677_11791076All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium570Open in IMG/M
3300026217|Ga0209871_1070395All Organisms → cellular organisms → Bacteria → Acidobacteria673Open in IMG/M
3300026281|Ga0209863_10022350All Organisms → cellular organisms → Bacteria → Acidobacteria1939Open in IMG/M
3300026294|Ga0209839_10227484All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium592Open in IMG/M
3300026508|Ga0257161_1084437All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium657Open in IMG/M
3300026547|Ga0209156_10142975All Organisms → cellular organisms → Bacteria → Acidobacteria1162Open in IMG/M
3300026551|Ga0209648_10450778All Organisms → cellular organisms → Bacteria → Acidobacteria799Open in IMG/M
3300026557|Ga0179587_10023899All Organisms → cellular organisms → Bacteria3325Open in IMG/M
3300026998|Ga0208369_1024940All Organisms → cellular organisms → Bacteria586Open in IMG/M
3300027565|Ga0209219_1079853All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium811Open in IMG/M
3300027854|Ga0209517_10341765All Organisms → cellular organisms → Bacteria860Open in IMG/M
3300027875|Ga0209283_10700788All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Occallatibacter → Occallatibacter savannae632Open in IMG/M
3300027895|Ga0209624_10422966All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium888Open in IMG/M
3300027903|Ga0209488_10647388All Organisms → cellular organisms → Bacteria762Open in IMG/M
3300027986|Ga0209168_10233260All Organisms → cellular organisms → Bacteria914Open in IMG/M
3300028776|Ga0302303_10331306Not Available510Open in IMG/M
3300028800|Ga0265338_10892108All Organisms → cellular organisms → Bacteria → Acidobacteria606Open in IMG/M
3300028828|Ga0307312_11060948Not Available536Open in IMG/M
3300029817|Ga0247275_1181443All Organisms → cellular organisms → Bacteria → Acidobacteria516Open in IMG/M
3300029915|Ga0311358_11002765All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Opitutae → unclassified Opitutae → Opitutae bacterium574Open in IMG/M
3300030041|Ga0302274_10093336All Organisms → cellular organisms → Bacteria1639Open in IMG/M
3300030058|Ga0302179_10198511Not Available886Open in IMG/M
3300030494|Ga0310037_10205702All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium870Open in IMG/M
3300030503|Ga0311370_10721691Not Available1165Open in IMG/M
3300030520|Ga0311372_12926458All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium519Open in IMG/M
3300030617|Ga0311356_11864678All Organisms → cellular organisms → Bacteria534Open in IMG/M
3300030618|Ga0311354_10159755All Organisms → cellular organisms → Bacteria → Acidobacteria2451Open in IMG/M
3300030618|Ga0311354_10820841Not Available875Open in IMG/M
3300030706|Ga0310039_10163136All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Terracidiphilus → Terracidiphilus gabretensis895Open in IMG/M
3300031234|Ga0302325_11454318All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium887Open in IMG/M
3300031616|Ga0307508_10683876All Organisms → cellular organisms → Bacteria → Acidobacteria634Open in IMG/M
3300031754|Ga0307475_10282628All Organisms → cellular organisms → Bacteria → Acidobacteria1331Open in IMG/M
3300031754|Ga0307475_10558801All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium918Open in IMG/M
3300032892|Ga0335081_11770801All Organisms → cellular organisms → Bacteria670Open in IMG/M
3300032954|Ga0335083_10793069Not Available760Open in IMG/M


 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
PeatlandEnvironmental → Aquatic → Freshwater → Wetlands → Bog → Peatland11.30%
Vadose Zone SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil8.70%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil8.70%
PalsaEnvironmental → Terrestrial → Peat → Unclassified → Unclassified → Palsa6.96%
Peatlands SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil6.09%
PeatlandEnvironmental → Aquatic → Freshwater → Wetlands → Unclassified → Peatland4.35%
Freshwater SedimentEnvironmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment3.48%
WatershedsEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds3.48%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Soil3.48%
Forest SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil3.48%
Bog Forest SoilEnvironmental → Aquatic → Freshwater → Wetlands → Bog → Bog Forest Soil2.61%
BogEnvironmental → Aquatic → Freshwater → Wetlands → Bog → Bog2.61%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil2.61%
Tropical PeatlandEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland2.61%
SoilEnvironmental → Terrestrial → Peat → Unclassified → Unclassified → Soil2.61%
Terrestrial SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil1.74%
Hardwood Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil1.74%
SoilEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Soil1.74%
BogEnvironmental → Terrestrial → Soil → Wetlands → Permafrost → Bog1.74%
SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Soil1.74%
Corn, Switchgrass And Miscanthus RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere1.74%
BogEnvironmental → Terrestrial → Peat → Unclassified → Unclassified → Bog1.74%
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere1.74%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil0.87%
Glacier Forefield SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Glacier Forefield Soil0.87%
Surface SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil0.87%
Grasslands SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil0.87%
Permafrost SoilEnvironmental → Terrestrial → Soil → Wetlands → Permafrost → Permafrost Soil0.87%
SoilEnvironmental → Terrestrial → Soil → Wetlands → Permafrost → Soil0.87%
Prmafrost SoilEnvironmental → Terrestrial → Soil → Wetlands → Permafrost → Prmafrost Soil0.87%
Miscanthus RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere0.87%
Miscanthus RhizosphereHost-Associated → Plants → Rhizoplane → Soil → Unclassified → Miscanthus Rhizosphere0.87%
Miscanthus RhizosphereHost-Associated → Plants → Roots → Rhizosphere → Soil → Miscanthus Rhizosphere0.87%
EctomycorrhizaHost-Associated → Plants → Roots → Unclassified → Unclassified → Ectomycorrhiza0.87%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere0.87%
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere0.87%
RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Rhizosphere0.87%
Host-AssociatedHost-Associated → Plants → Peat Moss → Unclassified → Unclassified → Host-Associated0.87%

Visualization
Powered by ApexCharts



Associated Samples

Taxon OIDSample NameHabitat TypeIMG/M Link
3300001593Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM2_M2EnvironmentalOpen in IMG/M
3300004080Coassembly of ECP04_OM1, ECP04_OM2, ECP04_OM3EnvironmentalOpen in IMG/M
3300004092Coassembly of ECP03_0M1, ECP03_OM2, ECP03_OM3, ECP04_OM1, ECP04_OM2, ECP04_OM3, ECP14_OM1, ECP14_OM2, ECP14_OM3EnvironmentalOpen in IMG/M
3300004152Coassembly of ECP12_OM1, ECP12_OM2, ECP12_OM3EnvironmentalOpen in IMG/M
3300005178Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_137EnvironmentalOpen in IMG/M
3300005181Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_127EnvironmentalOpen in IMG/M
3300005353Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaGHost-AssociatedOpen in IMG/M
3300005454Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_136EnvironmentalOpen in IMG/M
3300005456Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaGHost-AssociatedOpen in IMG/M
3300005518Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaGEnvironmentalOpen in IMG/M
3300005546Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaGEnvironmentalOpen in IMG/M
3300006057Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Straight Creek_MetaG_SC_2012EnvironmentalOpen in IMG/M
3300006059Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Alex Branch Run_MetaG_ABR_2012EnvironmentalOpen in IMG/M
3300006162Freshwater sediment microbial communities from Pennsylvania, USA - Little Laurel Run_MetaG_LLR_2012EnvironmentalOpen in IMG/M
3300006174Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Alex Branch Run_MetaG_ABR_2014EnvironmentalOpen in IMG/M
3300006176Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 5EnvironmentalOpen in IMG/M
3300006237Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2)Host-AssociatedOpen in IMG/M
3300009038Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H2.8 metaGEnvironmentalOpen in IMG/M
3300009500Host-associated microbial communities from peat moss isolated from Minnesota, USA - S1T2_Fc - Sphagnum magellanicum MGHost-AssociatedOpen in IMG/M
3300009520Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_1_NS metaGEnvironmentalOpen in IMG/M
3300009521Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_9_AC metaGEnvironmentalOpen in IMG/M
3300009547Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_20_40EnvironmentalOpen in IMG/M
3300009629Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_11_100EnvironmentalOpen in IMG/M
3300009643Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_8_40EnvironmentalOpen in IMG/M
3300009646Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_17_150EnvironmentalOpen in IMG/M
3300009839Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_a_PC metaGEnvironmentalOpen in IMG/M
3300010373Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-4EnvironmentalOpen in IMG/M
3300010379Sb_50d combined assemblyEnvironmentalOpen in IMG/M
3300010396Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-2EnvironmentalOpen in IMG/M
3300011269Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h3.4A metaGEnvironmentalOpen in IMG/M
3300011271Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h3.4B metaGEnvironmentalOpen in IMG/M
3300012351Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_100_16 metaGEnvironmentalOpen in IMG/M
3300012362Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_80_16 metaGEnvironmentalOpen in IMG/M
3300012917Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czobulk2.16 metaGEnvironmentalOpen in IMG/M
3300012944Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug1_16fungal (Illumina Assembly)EnvironmentalOpen in IMG/M
3300012951Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_226_MGEnvironmentalOpen in IMG/M
3300014162Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin23_30_metaGEnvironmentalOpen in IMG/M
3300014164Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin11_30_metaGEnvironmentalOpen in IMG/M
3300014326Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaGHost-AssociatedOpen in IMG/M
3300014491Permafrost microbial communities from Stordalen Mire, Sweden - 612S2D metaGEnvironmentalOpen in IMG/M
3300015087Arctic soil microbial communities from a glacier forefield, Russell Glacier, Kangerlussuaq, Greenland (Sample G6A, Proglacial plain, adjacent to northern proglacial tributary)EnvironmentalOpen in IMG/M
3300017822Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - Control_2EnvironmentalOpen in IMG/M
3300017823Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_3EnvironmentalOpen in IMG/M
3300017938Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_6_150EnvironmentalOpen in IMG/M
3300017940Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_6_100EnvironmentalOpen in IMG/M
3300017943Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_4EnvironmentalOpen in IMG/M
3300018002Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_13_40EnvironmentalOpen in IMG/M
3300018006Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - Control_4EnvironmentalOpen in IMG/M
3300018013Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_16_100EnvironmentalOpen in IMG/M
3300018016Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_19_40EnvironmentalOpen in IMG/M
3300018022Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_11_40EnvironmentalOpen in IMG/M
3300018026Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_8_100EnvironmentalOpen in IMG/M
3300018030Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_13_100EnvironmentalOpen in IMG/M
3300018033Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_13_10EnvironmentalOpen in IMG/M
3300018034Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_11_10EnvironmentalOpen in IMG/M
3300018037Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_20_10EnvironmentalOpen in IMG/M
3300018038Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_8_10EnvironmentalOpen in IMG/M
3300018040Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_10_150EnvironmentalOpen in IMG/M
3300018085Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP15_20_MGEnvironmentalOpen in IMG/M
3300018086Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP02_10_MGEnvironmentalOpen in IMG/M
3300018090Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP02_20_MGEnvironmentalOpen in IMG/M
3300019787Permafrost microbial communities from Stordalen Mire, Sweden - 812S3M metaG (PacBio error correction)EnvironmentalOpen in IMG/M
3300020061Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U2c1EnvironmentalOpen in IMG/M
3300020580Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-19-MEnvironmentalOpen in IMG/M
3300020582Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-4-OEnvironmentalOpen in IMG/M
3300021178Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-4-MEnvironmentalOpen in IMG/M
3300021403Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-OEnvironmentalOpen in IMG/M
3300021432Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-MEnvironmentalOpen in IMG/M
3300021478Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-7-MEnvironmentalOpen in IMG/M
3300021479Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-4-MEnvironmentalOpen in IMG/M
3300022840Peat soil microbial communities from Stordalen Mire, Sweden - 717 P3 1-5EnvironmentalOpen in IMG/M
3300023090Peat soil microbial communities from Stordalen Mire, Sweden - 717 S3 20-24EnvironmentalOpen in IMG/M
3300025434Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_16_10 (SPAdes)EnvironmentalOpen in IMG/M
3300025923Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025934Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300026023Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300026217Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Organic soil replicate 1 DNA2013-045 (SPAdes)EnvironmentalOpen in IMG/M
3300026281Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Organic soil replicate 1 DNA2013-046 (SPAdes)EnvironmentalOpen in IMG/M
3300026294Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Organic soil replicate 3 DNA2013-050 (SPAdes)EnvironmentalOpen in IMG/M
3300026508Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - NR-01-AEnvironmentalOpen in IMG/M
3300026547Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_124 (SPAdes)EnvironmentalOpen in IMG/M
3300026551Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_115cm (SPAdes)EnvironmentalOpen in IMG/M
3300026557Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_08_16fungalEnvironmentalOpen in IMG/M
3300026998Forest soil microbial communities from Harvard Forest Long Term Ecological Research site in Petersham, Massachusetts, USA - MetaG HF046 (SPAdes)EnvironmentalOpen in IMG/M
3300027565Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM1_M1 (SPAdes)EnvironmentalOpen in IMG/M
3300027854Peat soil microbial communities from Weissenstadt, Germany - SII-2010 (SPAdes)EnvironmentalOpen in IMG/M
3300027875Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H1.8 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300027895Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM2H0_O1 (SPAdes)EnvironmentalOpen in IMG/M
3300027903Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_2 (SPAdes)EnvironmentalOpen in IMG/M
3300027986Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen07_05102014_R1 (SPAdes)EnvironmentalOpen in IMG/M
3300028776Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - III_Palsa_E2_1EnvironmentalOpen in IMG/M
3300028800Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaGHost-AssociatedOpen in IMG/M
3300028828Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_202EnvironmentalOpen in IMG/M
3300029817Soil microbial communities from Marcell Experimental Forest, Minnesota, USA - Bog25EnvironmentalOpen in IMG/M
3300029915III_Bog_E1 coassemblyEnvironmentalOpen in IMG/M
3300030041Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - III_Bog_N2_1EnvironmentalOpen in IMG/M
3300030058Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Palsa_E3_1EnvironmentalOpen in IMG/M
3300030494Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_3_AS metaG (v2)EnvironmentalOpen in IMG/M
3300030503III_Palsa_E3 coassemblyEnvironmentalOpen in IMG/M
3300030520III_Palsa_N2 coassemblyEnvironmentalOpen in IMG/M
3300030617II_Palsa_N2 coassemblyEnvironmentalOpen in IMG/M
3300030618II_Palsa_E3 coassemblyEnvironmentalOpen in IMG/M
3300030706Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_6_BS metaG (v2)EnvironmentalOpen in IMG/M
3300031234Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Palsa_T0_2EnvironmentalOpen in IMG/M
3300031616Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EMHost-AssociatedOpen in IMG/M
3300031754Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM1C_515EnvironmentalOpen in IMG/M
3300032892Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.5EnvironmentalOpen in IMG/M
3300032954Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.2EnvironmentalOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap


 ⦗Top⦘

Family Sequences

Protein ID Sample Taxon ID Habitat Sequence
JGI12635J15846_1051483013300001593Forest SoilMAQVRQGALEFQRQLSAALPNLSELKVYSVSPFDLDERRRA
Ga0062385_1040864813300004080Bog Forest SoilMAYRVVSFTMAQVRQGALGFQRSLSAVLREHPEIKVYSVSPFDLDERRR
Ga0062389_10189521813300004092Bog Forest SoilMSYHVVALTMAQVRQGGLDFQRALGTALREAREIRVYSASPFDLEER
Ga0062386_10036716813300004152Bog Forest SoilMSYHVVAFTMAQVRQGALEFQRQLSAVLRESRDLKVYSASPFDLEE
Ga0066688_1060089313300005178SoilGALAFQRRLGAILRESKDLKVYSASPFDLDERRRLRERFG*
Ga0066678_1038574613300005181SoilMPYHVVSFTMAQVRQGALGFQRQLSAALRESSQLKVYSVSPFDLDERRRIKD
Ga0070669_10057687213300005353Switchgrass RhizosphereMSYHVVALTLAQVRQGALGFQRQLGAAVREASGVKVYSPSPFDLDARR
Ga0066687_1055642813300005454SoilMAQVRQGALGFQRELSAILRERPDLKVYSVSPFDLDERRRFKDRF
Ga0070678_10007037523300005456Miscanthus RhizosphereMSYHVVALTLAQVRQGALGFQRQLGAAVREASGVKVYSPSPFDLDARRRFRER
Ga0070699_10010508213300005518Corn, Switchgrass And Miscanthus RhizosphereMSYHVVAFTMAQVRQGALEFQRQLGATVDKVKDLKVYSASPFDLDE
Ga0070696_10160088823300005546Corn, Switchgrass And Miscanthus RhizosphereMAYHVVALTMAQVRLGALAFQRQLSAALAESRDLKVYSVSPFALDERRRFKD
Ga0075026_10043070323300006057WatershedsMPYHVVALTMNQVRQGGLAFQRELGAILRDSSDVKVYSCSPFDLEERRRMK
Ga0075017_10011522113300006059WatershedsMSYHVVALSMAQVRQGALEFQRQLGAALRDVTDLKVYSPSPFDL
Ga0075030_10012571943300006162WatershedsMPYHVVAFTMAQVRQGALAFQRQLSAALRESKDLKVYSVSPFDLEERRRF
Ga0075014_10007791013300006174WatershedsMPYHVVAFTMAQVRQGALAFQRELSAALRESKDLKVYSVSPFDLEERRRF
Ga0070765_10107526213300006176SoilMSYHVVAFTLAQVRQGSLAFQRQLSGILRDSTEIKVYSASPF
Ga0070765_10228928823300006176SoilMAEVRQGALGFQRDLSAILRENAEIKVYSVSPFDLDERRRFKDRFGG
Ga0097621_10148256023300006237Miscanthus RhizosphereMPYHVVAFTMAEVRQGALSFQRELSAALRESKDLKVYSVSPFDLD
Ga0099829_1001582463300009038Vadose Zone SoilMPYHVVALTMTQVRQGGLAFQRELGAMLRDSSDVKVYSCSPFDLEERRRIK
Ga0116229_1024218223300009500Host-AssociatedMAQVRAGGLDFQRALGTALRESREIKVYSASPFDLEERRRVKD
Ga0116214_108761423300009520Peatlands SoilMPYRVVAFTMAQVRQGALGFQRQLSAVLREHAEIKVYSVSPFDLDERRRAKDR
Ga0116222_111398613300009521Peatlands SoilMAQVRHGALDFQRELGAVLRDAPNLKVYSASPFDLD
Ga0116136_119318823300009547PeatlandMPYRVVSFTMAQVRRGALGFQRQLSAVLREHAEIKVYSVSPFDLDERRR
Ga0116119_116427313300009629PeatlandMPYRVVSFTMAQVRQGALDFQRQLSAVLRECAEIKVYSVSPFDLD
Ga0116110_130214623300009643PeatlandMAYRVVAFTMAQVRRGALGFQRQLSAVLREHAEIKVYSVSPF
Ga0116132_119247223300009646PeatlandMPYRVVAFTMAQVRQGALGFQRQLSAVLREHAEIKVYSVSPFDLDERRRAK
Ga0116223_1038874723300009839Peatlands SoilMPYRVVAFTMAQVRRGALGFQRQLSAVLREHAEIKVYSVSPFDL
Ga0134128_1064244313300010373Terrestrial SoilMAYHVVALTMAQVRLGALAFQRQLSAALAESRDLKVYSVSPFALDERRRFK
Ga0136449_10146168223300010379Peatlands SoilMPYRVVAFTMAQVRRGALGFQRQLSAVLREHAEIKVYSVSPFDLDE
Ga0134126_1162085923300010396Terrestrial SoilMPYHVVAFTMAQVRQGALEFQRLLGTALRESRELKVY
Ga0137392_1018404813300011269Vadose Zone SoilMPFRVVSFTMAQVRQGALGFQRELSAILRERPDIKVYS
Ga0137393_1015116713300011271Vadose Zone SoilMPYHVLALTMAQVRQGGLEFQRRLGPIVRDVKDVKVYS
Ga0137386_1117008113300012351Vadose Zone SoilMPYRVVSFTMAQVRQGALGFQRELSAILRERPDIKVYSVSPFDLDERRR
Ga0137361_1121244023300012362Vadose Zone SoilMPYRVVSFTMAQVRQGALGFQRELSAILRERPDLKVYSVSPFDLDERRRFKD
Ga0137395_1106303513300012917Vadose Zone SoilMPYRVVSFTMAQVRQGALGFQRELSAILRERPDIKVYSVSPFALDE
Ga0137410_1017593913300012944Vadose Zone SoilMPYHVVAFTMAQVRQGALAFQRQLSAALHESRDLKVYSVSPFDLEE
Ga0164300_1020079123300012951SoilMSYHVVALTLAQVRQGALGFQRQLGAAVRDASGVRV
Ga0181538_1017854813300014162BogMPYRVISFTMAQVRQGAPGFQRQLSAVLRERAEIKVYSV
Ga0181532_1061995913300014164BogMPYRVVAFTMAQVRRGALGFQRQLSAVLREHAEIKVYSVSPFDLDER
Ga0181532_1073372113300014164BogMPYRVISFTMAQVRQGALGFQRQLSAVLRERAEIKV
Ga0157380_1189462913300014326Switchgrass RhizosphereMSYHVVALTLAQVRQGALGFQRQLGAAVREASGVKVYS
Ga0182014_1041190223300014491BogMSYRVISFTMAQVRQGALGFQRRLSAVLRERAEIKVYSV
Ga0167637_101666513300015087Glacier Forefield SoilMAQVRQGALAFQRQLSAALRESRDLKVYSVSPFDLE
Ga0187802_1024734713300017822Freshwater SedimentMAEVRQGALDFQRELGAVLRDAPNLKVYSASPFDLDERRRAKDR
Ga0187818_1012113223300017823Freshwater SedimentMPYRVVAFTMAQVRQGALGFQRQLSAVLREHAEIKVYSVSPFDLD
Ga0187854_1050026213300017938PeatlandMTLQPMSYRVVAFTMAQVRQGALGFQRQLGATLREHVE
Ga0187853_1027710713300017940PeatlandMTLQPMSYRVVAFTMAQVRQGALGFQRQLGATLREHVEIKVYSVSPFD
Ga0187819_1053947823300017943Freshwater SedimentMPYRVVAFTMAQVRQGALGFQRQLSAVLREHAEIKVY
Ga0187868_107059513300018002PeatlandMAQVRQGALDFQRQLSAALRECAEIKVYSVSPFDLDERRRFK
Ga0187804_1003238013300018006Freshwater SedimentMAQVRQGALGFQRQLSAVLREQAEIKVYSVSPFDLDERR
Ga0187873_136207423300018013PeatlandMSYHVVALTMVQVRQGALDFQRDLGAVLRDAPELKVYSASPFDLEERRRV
Ga0187880_105234413300018016PeatlandMTLQPMSYRVVAFTMAQVRQGALGFQRQLGATLREHVEIKVYSV
Ga0187864_1042411413300018022PeatlandMPYRVVAFTMAQVRRGALGFQRQLSAVLREHAEIKVY
Ga0187857_1038753213300018026PeatlandMPYHVVAFTMAQVRQGALGFQRQLSAVLREHAEIK
Ga0187869_1032751523300018030PeatlandMSYRVVAFTMAQVRQGALGFQRQLGAMLRAHVEIKVYSV
Ga0187867_1025642133300018033PeatlandMSYHVVALTMAQVRQGALDFQRDLGAVLRDAPELKVYSASPFDLEERRRVK
Ga0187863_1040396013300018034PeatlandMSYHVVALTMAQVRQGALDFQRDLGAVLRDAPELKVY
Ga0187883_1057247723300018037PeatlandMAYRVVSLTMAQVRQGALVFQRELGAVLREHLEIKVYSVSPFDLDER
Ga0187855_1051699023300018038PeatlandMPYQVIAFTMAQVRQGALSFQRELSAVLRENPEIKVYSASPFD
Ga0187862_1067586313300018040PeatlandMSYRVVAFTMAQVRQGALGFQRQLSAVLREHPEIK
Ga0187772_1136485923300018085Tropical PeatlandMTYRVIAFTMNQVRQGALEFQRRLSVIVREYPEIKVYGVSPFDLE
Ga0187769_1019212113300018086Tropical PeatlandMPYRVVALTMAQVRQGALGFQRQLSALLREHAEIKVYSVSPFDLDERR
Ga0187770_1118741123300018090Tropical PeatlandMPYRVVAFTMAQVRQGALGFQRQLSALLREHAEIKVYAVSPFDLEE
Ga0182031_117931823300019787BogMAYRVIAFTMAQVRQGALNFQRELTAVLRERPEIKVYSANPFDLDERRRARD
Ga0193716_100490783300020061SoilMPYHVVAFTMAQVRQGALEFQRLLGTAVRESRDLKVYSVSPFDL
Ga0210403_1149216623300020580SoilMPYHVVAFTMAQVRQGALAFQRQLSAALRESRDLK
Ga0210395_1028678913300020582SoilMSYHVVAFTMAEVRQGALDFQRELGAVLRDAPNLKVYSASPFDL
Ga0210395_1042620513300020582SoilMSYHVVALTMAQVRQGALDFQRELGSVLKDAPELKVYS
Ga0210408_1006147163300021178SoilMPYHVVAFTMAQVRQGALAFQRQLSAALRESRDLKVYSVSP
Ga0210397_1067968413300021403SoilMPYHVLPLTMMQVRKGALAFQRELGAAVRESSPLKVYSVSPFDL
Ga0210384_1035137713300021432SoilMSYHVLPLTMMQVRKGALAFQRELGAAVRESSPLKVYSVSPFDL
Ga0210402_1098864523300021478SoilMSYHVVAFTMAQVRQGALKFQRELSAVLSNAPELKVYSASPFDLD
Ga0210402_1108036313300021478SoilMSYHVVALTMAQVRQGALQFQRELGAALHEGSNLKVYSASPFD
Ga0210410_1035479813300021479SoilMPYRVVSFTMAQVRQGALGFQRELSVVLRERPDIKVYSVSPFDLDERRRFK
Ga0224549_106257713300022840SoilVNAYRVVSFTMAQVRQGALGFQRELGAALREHPEIKVYSVSPF
Ga0224558_110672423300023090SoilMAQVRQGALGFQRRLSAVLRERAEIKVYSVSPFDLDE
Ga0224558_111603613300023090SoilMPYRVVSFTMAQVRQGALGFQRQLGAALRGNAEIKVYSVSP
Ga0208690_107323013300025434PeatlandMPYHVVAFTMSQVRQGALGFQRDLGAVVREQPDIKVYSASPFDL
Ga0207681_1062689423300025923Switchgrass RhizosphereMSYHVVALTLAQVRQGALGFQRQLGAAVREASGVKVYSPSPFDLDARRRFR
Ga0207686_1175979223300025934Miscanthus RhizosphereMSYHVVALTLAQVRQGALGFQRQLGAAVREASGVKVYSPSPFD
Ga0207677_1179107623300026023Miscanthus RhizosphereMSYHVVALTLAQVRQGALGFQRQLGAAVREASGVKVYSPSPF
Ga0209871_107039513300026217Permafrost SoilMSYYVVAFTMAQVRQGALAFQRQLSAALRESRDLKVYSVSPFDL
Ga0209863_1002235013300026281Prmafrost SoilMAYHVVAFTMAQVRTGALDFQRLLSAVLREQKDIKVYQVSPFD
Ga0209839_1022748413300026294SoilMAYRVIAFTMAQVRQGALGFQRDLSSALQEHRDIKVYSVSP
Ga0257161_108443723300026508SoilMAQVRQGALGFQRDLSAILRERPDIKVYSVSPFDLDERRRFKDRF
Ga0209156_1014297523300026547SoilMSYHVVAFTLAQVRQGALAFQRRLGAILRDSKDLKVYSASP
Ga0209648_1045077813300026551Grasslands SoilMPYRVVSFTMAQVRQGALGFQRQLSAVLREHAEIKVFSVNPFDL
Ga0179587_1002389913300026557Vadose Zone SoilMTYRVIAFTMAQVRQGALGFQRQLGTALRESPAIKVYSVSP
Ga0208369_102494013300026998Forest SoilMAQVRQGALDFQRELGAVLRDAPELKVYSASPFDLDERRRAKDR
Ga0209219_107985323300027565Forest SoilMPYHVAAFTMAQVRTGALEFQRQLGAIVRDVKDLKVYSASPF
Ga0209517_1034176513300027854Peatlands SoilMAQVRKGALEFQRQLSAVVPSAKEIKVYSASPFDL
Ga0209283_1070078813300027875Vadose Zone SoilMPYHVVSLTMTQVRRGGLAFQRELGAILRDSSDMK
Ga0209624_1042296623300027895Forest SoilRQGALEFQRQLSASLPGLKELKVYSASPFDLDERRRAKDRFVSACHI
Ga0209488_1064738823300027903Vadose Zone SoilMPYRVIAFTMAQVRQGSLGFHRDLAAILRENPEIKVYSASPFDLEER
Ga0209168_1023326023300027986Surface SoilMSYHVVAFTMAQVRQGALDFQRQLSAVLSEARELKVYSA
Ga0302303_1033130613300028776PalsaMLRLIQPMPYRVLSFTMAEVRQGALRFQRQLSAALREHAEIKVYSVSPFDLDERR
Ga0265338_1089210813300028800RhizosphereMPYHVVAFTMAQVRQGALAFQRDLSAALRESKDLKVYSVSPFDLDERR
Ga0307312_1106094813300028828SoilMPYHVLALTMAQVRAGGLEFQRQLGPMVCEMRELKVYSASPFDLDE
Ga0247275_118144313300029817SoilMTLQPMSYRVVAFTMAQVRQGALGFQRQLGATLREHVEIKVYSVSPFDLDE
Ga0311358_1100276513300029915BogMSYRIVAYTMAQVRQGALNFQRDLSAVLTENPQIKVYSASPFDLEERRRLKDR
Ga0302274_1009333633300030041BogMAQVRQGALNFQRDLSAVLSENPGIKVYSASPFDLEERRRL
Ga0302179_1019851113300030058PalsaMSYRVVSLTMAQVRQGALGFQRELGAVLVEHPEIKVYAVSPF
Ga0310037_1020570223300030494Peatlands SoilMSYHVVAFTMAQVRQGALEFQRQLSAILRESKELKVY
Ga0311370_1072169113300030503PalsaMLRLIQPMPYRVLSFTMAEVRQGALRFQRQLSDALREHAEIKVYSVSPFDLDELRR
Ga0311372_1292645813300030520PalsaMAQVRQGALGFQRELGAALREHPEIKVYSVSPFDLDER
Ga0311356_1186467823300030617PalsaMSYRVVSLTMAQVRQGALGFQRELGAVLVEHPEIKVYAVSPFDLEE
Ga0311354_1015975513300030618PalsaVNAYRVISFTMAQVRQGALGFQRELGAALREHPEIKVYSVS
Ga0311354_1082084113300030618PalsaMLRLIQPMPYRVLSFTMAEVRQGALRFQRQLSAALREH
Ga0310039_1016313613300030706Peatlands SoilMPYHVVAFTMAQVRQGALDFQRELGAVLRDAPNLKVYSASP
Ga0302325_1145431813300031234PalsaMAQVRQGALDFQRELGSVLSDAPQLKVYSASPFDLEERRRVKDRF
Ga0307508_1068387623300031616EctomycorrhizaMAQVRQGGLNFQRELGALLGERPEIKVYSVSPFDLDE
Ga0307475_1028262833300031754Hardwood Forest SoilMSYHVVSFSMAQVRQGALGFERELSAILRERPDIKV
Ga0307475_1055880133300031754Hardwood Forest SoilMSYHVVALTLAQVRQGALAFQRELGDALRESKELKVYSA
Ga0335081_1177080113300032892SoilMPYHVLPLTMAQVRQGALAFQRQLSPAAPDGAELKVYSASPF
Ga0335083_1079306913300032954SoilMRYHVVALTLSQIRQGALAFQRQLSRTLPDGTELK

 ⦗Top⦘


Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.