NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome Family F080358

Metagenome Family F080358

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F080358
Family Type Metagenome
Number of Sequences 115
Average Sequence Length 48 residues
Representative Sequence APFRPMLERVPAEEWPAIRAEAKAAMERYRVGDEIRFGADVVLASGKA
Number of Associated Samples 102
Number of Associated Scaffolds 115

Quality Assessment
Transcriptomic Evidence No
Most common taxonomic group Bacteria
% of genes with valid RBS motifs 2.61 %
% of genes near scaffold ends (potentially truncated) 92.17 %
% of genes from short scaffolds (< 2000 bps) 88.70 %
Associated GOLD sequencing projects 99
AlphaFold2 3D model prediction Yes
3D model pTM-score0.57

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Bacteria (78.261 % of family members)
NCBI Taxonomy ID 2
Taxonomy All Organisms → cellular organisms → Bacteria

Most Common Ecosystem
GOLD Ecosystem Environmental → Aquatic → Freshwater → Wetlands → Unclassified → Peatland
(12.174 % of family members)
Environment Ontology (ENVO) Unclassified
(42.609 % of family members)
Earth Microbiome Project Ontology (EMPO) Free-living → Non-saline → Soil (non-saline)
(36.522 % of family members)


 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      

 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Globular Signal Peptide: No Secondary Structure distribution: α-helix: 31.58%    β-sheet: 13.16%    Coil/Unstructured: 55.26%
Feature Viewer
Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer
Per-residue confidence (pLDDT):
  0-50   51-70   71-90   91-100  		pTM-score: 0.57
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.

 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 115 Family Scaffolds
PF02590SPOUT_MTase 79.13
PF02572CobA_CobO_BtuR 6.96
PF08592Anthrone_oxy 1.74
PF13414TPR_11 0.87
PF02410RsfS 0.87
PF11638DnaA_N 0.87
PF00857Isochorismatase 0.87
PF13188PAS_8 0.87
PF01523PmbA_TldD 0.87
PF13431TPR_17 0.87
PF03099BPL_LplA_LipB 0.87
PF01039Carboxyl_trans 0.87
PF01553Acyltransferase 0.87
PF08245Mur_ligase_M 0.87

Neighboring Clusters of Orthologous Genes (COGs)

COG IDNameFunctional Category % Frequency in 115 Family Scaffolds
COG157623S rRNA pseudoU1915 N3-methylase RlmHTranslation, ribosomal structure and biogenesis [J] 79.13
COG2109ATP:corrinoid adenosyltransferaseCoenzyme transport and metabolism [H] 6.96
COG0095Lipoate-protein ligase ACoenzyme transport and metabolism [H] 0.87
COG0312Zn-dependent protease PmbA/TldA or its inactivated homologGeneral function prediction only [R] 0.87
COG0321Lipoate-protein ligase BCoenzyme transport and metabolism [H] 0.87
COG0340Biotin-protein ligaseCoenzyme transport and metabolism [H] 0.87
COG0777Acetyl-CoA carboxylase beta subunitLipid transport and metabolism [I] 0.87
COG0799Ribosomal silencing factor RsfS, regulates association of 30S and 50S subunitsTranslation, ribosomal structure and biogenesis [J] 0.87
COG0825Acetyl-CoA carboxylase alpha subunitLipid transport and metabolism [I] 0.87
COG1335Nicotinamidase-related amidaseCoenzyme transport and metabolism [H] 0.87
COG1535Isochorismate hydrolaseSecondary metabolites biosynthesis, transport and catabolism [Q] 0.87
COG4799Acetyl-CoA carboxylase, carboxyltransferase componentLipid transport and metabolism [I] 0.87

 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms78.26 %
UnclassifiedrootN/A21.74 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
3300000567|JGI12270J11330_10114043All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1126Open in IMG/M
3300000574|JGI1357J11328_10058702All Organisms → cellular organisms → Bacteria1432Open in IMG/M
3300001356|JGI12269J14319_10249386All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium663Open in IMG/M
3300001593|JGI12635J15846_10914663All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium501Open in IMG/M
3300002245|JGIcombinedJ26739_100064613All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis3362Open in IMG/M
3300004152|Ga0062386_100518893All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium968Open in IMG/M
3300004152|Ga0062386_101692108Not Available528Open in IMG/M
3300005176|Ga0066679_10763378Not Available621Open in IMG/M
3300005332|Ga0066388_103221347All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → unclassified Terriglobales → Terriglobales bacterium834Open in IMG/M
3300005436|Ga0070713_100065151All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter3060Open in IMG/M
3300005436|Ga0070713_102007313Not Available561Open in IMG/M
3300005445|Ga0070708_100255642All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1646Open in IMG/M
3300005468|Ga0070707_100947981Not Available825Open in IMG/M
3300005555|Ga0066692_10149721All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1432Open in IMG/M
3300005591|Ga0070761_10063062All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter2095Open in IMG/M
3300005938|Ga0066795_10095852All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium882Open in IMG/M
3300006162|Ga0075030_101251942Not Available582Open in IMG/M
3300006174|Ga0075014_100137581All Organisms → cellular organisms → Bacteria → Proteobacteria1180Open in IMG/M
3300006174|Ga0075014_100306911All Organisms → cellular organisms → Bacteria → Acidobacteria838Open in IMG/M
3300009029|Ga0066793_10403551All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium785Open in IMG/M
3300009519|Ga0116108_1251323Not Available516Open in IMG/M
3300009521|Ga0116222_1496646Not Available534Open in IMG/M
3300009548|Ga0116107_1077150Not Available1044Open in IMG/M
3300009621|Ga0116116_1073613All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium974Open in IMG/M
3300009624|Ga0116105_1139069All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium636Open in IMG/M
3300009629|Ga0116119_1103841All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium713Open in IMG/M
3300009630|Ga0116114_1185023Not Available521Open in IMG/M
3300009632|Ga0116102_1064176All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1117Open in IMG/M
3300009632|Ga0116102_1174461Not Available584Open in IMG/M
3300009634|Ga0116124_1159942All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium629Open in IMG/M
3300009640|Ga0116126_1008589All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Acidobacterium → Acidobacterium ailaaui4986Open in IMG/M
3300009645|Ga0116106_1209132All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium621Open in IMG/M
3300009683|Ga0116224_10398581All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium655Open in IMG/M
3300009698|Ga0116216_10327958All Organisms → cellular organisms → Bacteria931Open in IMG/M
3300010339|Ga0074046_10001035All Organisms → cellular organisms → Bacteria25832Open in IMG/M
3300010339|Ga0074046_10685939Not Available602Open in IMG/M
3300012203|Ga0137399_10513861All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → unclassified Terriglobales → Terriglobales bacterium1005Open in IMG/M
3300012203|Ga0137399_11767349Not Available507Open in IMG/M
3300012205|Ga0137362_10280638All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1441Open in IMG/M
3300012208|Ga0137376_10142977All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis2054Open in IMG/M
3300012582|Ga0137358_10530549All Organisms → cellular organisms → Bacteria → Acidobacteria792Open in IMG/M
3300012917|Ga0137395_10330781All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1083Open in IMG/M
3300012918|Ga0137396_10543559All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium861Open in IMG/M
3300012918|Ga0137396_10623734All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium797Open in IMG/M
3300012925|Ga0137419_11233841All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium627Open in IMG/M
3300012927|Ga0137416_10806601All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium830Open in IMG/M
3300014156|Ga0181518_10090630All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1725Open in IMG/M
3300014165|Ga0181523_10022189All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis4191Open in IMG/M
3300014167|Ga0181528_10550311All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium637Open in IMG/M
3300014200|Ga0181526_10054659All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis2546Open in IMG/M
3300014200|Ga0181526_10553555All Organisms → cellular organisms → Bacteria727Open in IMG/M
3300014489|Ga0182018_10164853All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis1258Open in IMG/M
3300014638|Ga0181536_10365808All Organisms → cellular organisms → Bacteria653Open in IMG/M
3300014657|Ga0181522_10189014All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → unclassified Terriglobales → Terriglobales bacterium1210Open in IMG/M
3300017822|Ga0187802_10174955All Organisms → cellular organisms → Bacteria823Open in IMG/M
3300017823|Ga0187818_10057922All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis1667Open in IMG/M
3300017932|Ga0187814_10358881All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium563Open in IMG/M
3300017933|Ga0187801_10346621All Organisms → cellular organisms → Bacteria611Open in IMG/M
3300017938|Ga0187854_10033078All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis2713Open in IMG/M
3300017943|Ga0187819_10466082All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium722Open in IMG/M
3300017946|Ga0187879_10767437Not Available538Open in IMG/M
3300017972|Ga0187781_10114187All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → unclassified Rhodospirillales → Rhodospirillales bacterium TMPK11881Open in IMG/M
3300017972|Ga0187781_10629659All Organisms → cellular organisms → Bacteria774Open in IMG/M
3300017988|Ga0181520_10595657All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium768Open in IMG/M
3300017995|Ga0187816_10193897All Organisms → cellular organisms → Bacteria883Open in IMG/M
3300017995|Ga0187816_10195397Not Available879Open in IMG/M
3300018006|Ga0187804_10318307All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium680Open in IMG/M
3300018016|Ga0187880_1258635All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium764Open in IMG/M
3300018021|Ga0187882_1293092Not Available624Open in IMG/M
3300018030|Ga0187869_10083044Not Available1637Open in IMG/M
3300018033|Ga0187867_10014158All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis5355Open in IMG/M
3300018033|Ga0187867_10581014Not Available614Open in IMG/M
3300018035|Ga0187875_10036917All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis2899Open in IMG/M
3300018035|Ga0187875_10679607Not Available541Open in IMG/M
3300018038|Ga0187855_10223468All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1108Open in IMG/M
3300018044|Ga0187890_10198756All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1137Open in IMG/M
3300018062|Ga0187784_10114822All Organisms → cellular organisms → Bacteria2195Open in IMG/M
3300018089|Ga0187774_10287966All Organisms → cellular organisms → Bacteria950Open in IMG/M
3300020582|Ga0210395_10229558All Organisms → cellular organisms → Bacteria1393Open in IMG/M
3300021405|Ga0210387_10179908All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis1826Open in IMG/M
3300023090|Ga0224558_1066563All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1380Open in IMG/M
3300023101|Ga0224557_1218896All Organisms → cellular organisms → Bacteria649Open in IMG/M
3300025434|Ga0208690_1020192All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1156Open in IMG/M
3300025442|Ga0208034_1063413Not Available716Open in IMG/M
3300025453|Ga0208455_1027332All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1327Open in IMG/M
3300026320|Ga0209131_1090356Not Available1633Open in IMG/M
3300026490|Ga0257153_1068706All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium715Open in IMG/M
3300027439|Ga0209332_1042010All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium849Open in IMG/M
3300027545|Ga0209008_1096936Not Available659Open in IMG/M
3300027562|Ga0209735_1046699All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium924Open in IMG/M
3300027562|Ga0209735_1134578All Organisms → cellular organisms → Bacteria538Open in IMG/M
3300027587|Ga0209220_1026909Not Available1543Open in IMG/M
3300027629|Ga0209422_1020472Not Available1645Open in IMG/M
3300027633|Ga0208988_1097068All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium732Open in IMG/M
3300027829|Ga0209773_10077642All Organisms → cellular organisms → Bacteria1361Open in IMG/M
3300027879|Ga0209169_10715627Not Available518Open in IMG/M
3300028673|Ga0257175_1004949Not Available1784Open in IMG/M
3300028736|Ga0302214_1095302All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → unclassified Terriglobales → Terriglobales bacterium627Open in IMG/M
3300028868|Ga0302163_10084274All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium793Open in IMG/M
3300029995|Ga0302210_10043825All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1306Open in IMG/M
3300029998|Ga0302271_10479665All Organisms → cellular organisms → Bacteria → Acidobacteria537Open in IMG/M
3300030052|Ga0302217_10113245All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium623Open in IMG/M
3300030339|Ga0311360_10015735All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis7246Open in IMG/M
3300030494|Ga0310037_10156657All Organisms → cellular organisms → Bacteria1030Open in IMG/M
3300031231|Ga0170824_120363333All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1095Open in IMG/M
3300031234|Ga0302325_10474316All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis1905Open in IMG/M
3300031708|Ga0310686_116004977All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium867Open in IMG/M
3300031711|Ga0265314_10092616All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1964Open in IMG/M
3300031718|Ga0307474_11271603All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium581Open in IMG/M
3300031720|Ga0307469_10129746All Organisms → cellular organisms → Bacteria1843Open in IMG/M
3300031820|Ga0307473_10262540All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1066Open in IMG/M
3300031962|Ga0307479_11251337All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium704Open in IMG/M
3300033402|Ga0326728_11122903All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium530Open in IMG/M
3300033798|Ga0334821_099414All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium578Open in IMG/M
3300033808|Ga0314867_163371All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium523Open in IMG/M


 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
PeatlandEnvironmental → Aquatic → Freshwater → Wetlands → Unclassified → Peatland12.17%
PeatlandEnvironmental → Aquatic → Freshwater → Wetlands → Bog → Peatland9.57%
Vadose Zone SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil8.70%
Forest SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil7.83%
BogEnvironmental → Aquatic → Freshwater → Wetlands → Bog → Bog6.96%
Freshwater SedimentEnvironmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment6.96%
Peatlands SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil5.22%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil3.48%
Hardwood Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil3.48%
Tropical PeatlandEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland3.48%
Corn, Switchgrass And Miscanthus RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere3.48%
FenEnvironmental → Terrestrial → Peat → Unclassified → Unclassified → Fen3.48%
Bog Forest SoilEnvironmental → Aquatic → Freshwater → Wetlands → Bog → Bog Forest Soil2.61%
WatershedsEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds2.61%
SoilEnvironmental → Terrestrial → Peat → Unclassified → Unclassified → Soil2.61%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Soil1.74%
Bog Forest SoilEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Bog Forest Soil1.74%
SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Soil1.74%
BogEnvironmental → Terrestrial → Peat → Unclassified → Unclassified → Bog1.74%
GroundwaterEnvironmental → Aquatic → Freshwater → Groundwater → Contaminated → Groundwater0.87%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil0.87%
Grasslands SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil0.87%
Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil0.87%
PeatlandEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Peatland0.87%
SoilEnvironmental → Terrestrial → Soil → Wetlands → Permafrost → Soil0.87%
Prmafrost SoilEnvironmental → Terrestrial → Soil → Wetlands → Permafrost → Prmafrost Soil0.87%
PalsaEnvironmental → Terrestrial → Soil → Wetlands → Permafrost → Palsa0.87%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil0.87%
PalsaEnvironmental → Terrestrial → Peat → Unclassified → Unclassified → Palsa0.87%
Peat SoilEnvironmental → Terrestrial → Peat → Unclassified → Unclassified → Peat Soil0.87%
RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Rhizosphere0.87%

Visualization
Powered by ApexCharts



Associated Samples

Taxon OIDSample NameHabitat TypeIMG/M Link
3300000567Peat soil microbial communities from Weissenstadt, Germany - SII-2010EnvironmentalOpen in IMG/M
3300000574Subsurface groundwater microbial communities from S. Glens Falls, New York, USA - GMW46 contaminated, 5.4 mEnvironmentalOpen in IMG/M
3300001356Peat soil microbial communities from Weissenstadt, Germany - SII-SIP-2007EnvironmentalOpen in IMG/M
3300001593Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM2_M2EnvironmentalOpen in IMG/M
3300002245Jack Pine, Ontario site 1_JW_OM2H0_M3 (Jack Pine, Ontario combined, ASSEMBLY_DATE=20131027)EnvironmentalOpen in IMG/M
3300004152Coassembly of ECP12_OM1, ECP12_OM2, ECP12_OM3EnvironmentalOpen in IMG/M
3300005176Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_128EnvironmentalOpen in IMG/M
3300005332Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly)EnvironmentalOpen in IMG/M
3300005436Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaGEnvironmentalOpen in IMG/M
3300005445Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaGEnvironmentalOpen in IMG/M
3300005468Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaGEnvironmentalOpen in IMG/M
3300005555Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_141EnvironmentalOpen in IMG/M
3300005591Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF1EnvironmentalOpen in IMG/M
3300005938Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Permafrost soil replicate 2 DNA2013-191EnvironmentalOpen in IMG/M
3300006162Freshwater sediment microbial communities from Pennsylvania, USA - Little Laurel Run_MetaG_LLR_2012EnvironmentalOpen in IMG/M
3300006174Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Alex Branch Run_MetaG_ABR_2014EnvironmentalOpen in IMG/M
3300009029Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Permafrost soil replicate 1 DNA2013-189EnvironmentalOpen in IMG/M
3300009519Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_6_150EnvironmentalOpen in IMG/M
3300009521Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_9_AC metaGEnvironmentalOpen in IMG/M
3300009548Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_6_100EnvironmentalOpen in IMG/M
3300009621Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_10_150EnvironmentalOpen in IMG/M
3300009624Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_6_10EnvironmentalOpen in IMG/M
3300009629Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_11_100EnvironmentalOpen in IMG/M
3300009630Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_10_40EnvironmentalOpen in IMG/M
3300009632Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_4_40EnvironmentalOpen in IMG/M
3300009634Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_13_150EnvironmentalOpen in IMG/M
3300009640Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_16_40EnvironmentalOpen in IMG/M
3300009645Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_6_40EnvironmentalOpen in IMG/M
3300009683Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_b_LC metaGEnvironmentalOpen in IMG/M
3300009698Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_3_AS metaGEnvironmentalOpen in IMG/M
3300010339Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - Bog Forest MetaG ECP23OM3EnvironmentalOpen in IMG/M
3300012203Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz3.16 metaGEnvironmentalOpen in IMG/M
3300012205Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_100_16 metaGEnvironmentalOpen in IMG/M
3300012208Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_20_16 metaGEnvironmentalOpen in IMG/M
3300012582Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_20_16 metaGEnvironmentalOpen in IMG/M
3300012917Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czobulk2.16 metaGEnvironmentalOpen in IMG/M
3300012918Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czcobulk3.16 metaGEnvironmentalOpen in IMG/M
3300012925Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_2_16fungal (Illumina Assembly)EnvironmentalOpen in IMG/M
3300012927Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_1_16fungal (Illumina Assembly)EnvironmentalOpen in IMG/M
3300014156Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin01_60_metaGEnvironmentalOpen in IMG/M
3300014165Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin05_30_metaGEnvironmentalOpen in IMG/M
3300014167Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin10_10_metaGEnvironmentalOpen in IMG/M
3300014200Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin06_30_metaGEnvironmentalOpen in IMG/M
3300014489Permafrost microbial communities from Stordalen Mire, Sweden - 812P2M metaGEnvironmentalOpen in IMG/M
3300014638Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin17_60_metaGEnvironmentalOpen in IMG/M
3300014657Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin05_10_metaGEnvironmentalOpen in IMG/M
3300017822Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - Control_2EnvironmentalOpen in IMG/M
3300017823Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_3EnvironmentalOpen in IMG/M
3300017932Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - ASW-S_4EnvironmentalOpen in IMG/M
3300017933Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - Control_1EnvironmentalOpen in IMG/M
3300017938Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_6_150EnvironmentalOpen in IMG/M
3300017943Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_4EnvironmentalOpen in IMG/M
3300017946Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_19_10EnvironmentalOpen in IMG/M
3300017972Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0715_SJ02_MP02_20_MGEnvironmentalOpen in IMG/M
3300017988Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin02_30_metaGEnvironmentalOpen in IMG/M
3300017995Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_1EnvironmentalOpen in IMG/M
3300018006Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - Control_4EnvironmentalOpen in IMG/M
3300018016Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_19_40EnvironmentalOpen in IMG/M
3300018021Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_19_150EnvironmentalOpen in IMG/M
3300018030Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_13_100EnvironmentalOpen in IMG/M
3300018033Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_13_10EnvironmentalOpen in IMG/M
3300018035Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_17_10EnvironmentalOpen in IMG/M
3300018038Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_8_10EnvironmentalOpen in IMG/M
3300018044Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_21_10EnvironmentalOpen in IMG/M
3300018062Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_SJ02_MP15_20_MGEnvironmentalOpen in IMG/M
3300018089Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_BV02_MP05_20_MGEnvironmentalOpen in IMG/M
3300020582Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-4-OEnvironmentalOpen in IMG/M
3300021405Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-7-OEnvironmentalOpen in IMG/M
3300023090Peat soil microbial communities from Stordalen Mire, Sweden - 717 S3 20-24EnvironmentalOpen in IMG/M
3300023101Peat soil microbial communities from Stordalen Mire, Sweden - 717 S3 10-14EnvironmentalOpen in IMG/M
3300025434Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_16_10 (SPAdes)EnvironmentalOpen in IMG/M
3300025442Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_8_100 (SPAdes)EnvironmentalOpen in IMG/M
3300025453Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_4_40 (SPAdes)EnvironmentalOpen in IMG/M
3300026320Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_40cm (SPAdes)EnvironmentalOpen in IMG/M
3300026490Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - DW-10-AEnvironmentalOpen in IMG/M
3300027439Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM3_M1 (SPAdes)EnvironmentalOpen in IMG/M
3300027545Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_Ref_O3 (SPAdes)EnvironmentalOpen in IMG/M
3300027562Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_Ref_M2 (SPAdes)EnvironmentalOpen in IMG/M
3300027587Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM3_M3 (SPAdes)EnvironmentalOpen in IMG/M
3300027629Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM2_M3 (SPAdes)EnvironmentalOpen in IMG/M
3300027633Forest soil microbial communities from El Dorado National Forest, California, USA - Mediterranean Blodgett CA Ref_M1 (SPAdes)EnvironmentalOpen in IMG/M
3300027829Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP14_OM1 (SPAdes)EnvironmentalOpen in IMG/M
3300027879Warmed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WRM 4 (SPAdes)EnvironmentalOpen in IMG/M
3300028673Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - NI-69-BEnvironmentalOpen in IMG/M
3300028736Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Fen_N1_3EnvironmentalOpen in IMG/M
3300028868Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Fen_E2_3EnvironmentalOpen in IMG/M
3300029995Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Fen_E3_2EnvironmentalOpen in IMG/M
3300029998Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - III_Bog_N1_1EnvironmentalOpen in IMG/M
3300030052Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Fen_N3_3EnvironmentalOpen in IMG/M
3300030339III_Bog_N1 coassemblyEnvironmentalOpen in IMG/M
3300030494Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_3_AS metaG (v2)EnvironmentalOpen in IMG/M
3300031231Coassembly Site 11 (all samples) - Champenoux / Amance forestEnvironmentalOpen in IMG/M
3300031234Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Palsa_T0_2EnvironmentalOpen in IMG/M
3300031708FICUS49499 Metagenome Czech Republic combined assemblyEnvironmentalOpen in IMG/M
3300031711Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaGHost-AssociatedOpen in IMG/M
3300031718Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM1C_05EnvironmentalOpen in IMG/M
3300031720Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM2C_515EnvironmentalOpen in IMG/M
3300031820Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_515EnvironmentalOpen in IMG/M
3300031962Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM4C_515EnvironmentalOpen in IMG/M
3300033402Lab enriched peat soil microbial communities from McLean, Ithaca, NY, United States - MB31MNEnvironmentalOpen in IMG/M
3300033798Peat soil microbial communities from Stordalen Mire, Sweden - 713 E-3-SEnvironmentalOpen in IMG/M
3300033808Tropical peat soil microbial communities from peatlands in Loreto, Peru - MAQ_100_20EnvironmentalOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap


 ⦗Top⦘

Family Sequences

Protein ID Sample Taxon ID Habitat Sequence
JGI12270J11330_1011404333300000567Peatlands SoilDQWPGIRAQAKAAIARYRVGGEIRFGADVVLASGKA*
JGI1357J11328_1005870213300000574GroundwaterTAVSIPFRAMLDRVPQEKWPAVRAEVHAAIDRYRVGDEIRFGAVVILASGKA*
JGI12269J14319_1024938613300001356Peatlands SoilVPAEEWPVVRAKAKTAIEQYRVGDEIRFGADVVLASGRA*
JGI12635J15846_1091466313300001593Forest SoilYFCAVAAPFRSMLDRVRVEEWPVIRAEAKAAIERYRVGDEIRFGADVVLASGKA*
JGIcombinedJ26739_10006461313300002245Forest SoilAPFRPMLERVPVEEWPAIRAEAKAAIERYRVGDEVRFGADVVLASGKA*
Ga0062386_10051889313300004152Bog Forest SoilERVPEAMWPSVRAEAGAAMERYRVGDEIRFGADVVFSSGRA*
Ga0062386_10169210823300004152Bog Forest SoilFEYACAVAAPFRPMLERVPAEEWPAIRADAKAAIERYRVGDEIRFGAEVVLASGKA*
Ga0066679_1076337813300005176SoilVPAEEWPSIRAEAKAAMERNRVGDEIRFGADVVLASGKA*
Ga0066388_10322134723300005332Tropical Forest SoilLDRVPADEWPKIRAEVKSAISRYQVGDEIRFGADVILVSGKA*
Ga0070713_10006515113300005436Corn, Switchgrass And Miscanthus RhizosphereEVFDYACTVAAPFRPMIERVQEKDWPAIRADATLAMQQYRVGNEIRFGADVVLASGKA*
Ga0070713_10200731323300005436Corn, Switchgrass And Miscanthus RhizosphereERVPAEEWPAIRAEAKAAIERYRVGDEIRFGADVVLASGKA*
Ga0070708_10025564213300005445Corn, Switchgrass And Miscanthus RhizosphereVSVPFRGMLDRVPAEKWPAVRSEVYAAIDQYRVGDEIRFGAVVILASGKA*
Ga0070707_10094798123300005468Corn, Switchgrass And Miscanthus RhizosphereVAAPFRPMLERVPAEEWPVIRAEAKAAIERYRVGDEIRFGADVVLASGKD*
Ga0066692_1014972143300005555SoilVAAPFRPMLERLPLEEWPVIRAEAKVAMERYRVGDEIRFSADVVLASGKA*
Ga0070761_1006306233300005591SoilLERVKAEDWPTIRDEATAAIERYRVGDEIRFGANVIFASGKA*
Ga0066795_1009585223300005938SoilVPADQWPMIRAQAKAAIERYRVGNEIRFGADVVLASGKA*
Ga0075030_10125194223300006162WatershedsERAHPEEWPAIRAAAIAAIDRCRVGNELRFGADVVLASGRA*
Ga0075014_10013758123300006174WatershedsMLERVPSDEWPAIRAEAKEAIERHRVGDEIRFGAELVFASGKA*
Ga0075014_10030691113300006174WatershedsMLERVPAEQWPAIRAEAKAAIERYRVGDEIRFGADVVLASGKA*
Ga0066793_1040355123300009029Prmafrost SoilEEVFEYACAVAAPFRPMLERVRAEEWPVIRAEAKAAIKRYRVGDEIRFGADVVLASGKA*
Ga0116108_125132313300009519PeatlandFRPMLERVRAEEWLAIRAEATAAIERYRVGDEIRFGADIVLASGKA*
Ga0116222_149664623300009521Peatlands SoilCAVAAPFRPMLERVPAEEWPVVRAKAKTAIEQYRVGDEIRFGADVVLASGRA*
Ga0116107_107715013300009548PeatlandAAPFRPMLERVRVEEWPVIRAEATAAIERYRVGDEIRFGADVVLASGKA*
Ga0116116_107361313300009621PeatlandMLERVPAEEWPAIRAEATAAIERYRVGNEIRFSADVILASGEA*
Ga0116105_113906923300009624PeatlandFEYACAVAAPFRPMLERVPAEEWPAIRAEAKAAIERYRVGDEIRFGAEVVLASGKA*
Ga0116119_110384123300009629PeatlandMLERVRVEEWPAIRAEATAAIERYRVGDEIRFGADVVLASGKA*
Ga0116114_118502323300009630PeatlandAVAAPFRPMLERVPAEQWAVIRAEAKAAIERYRVGDEIRFGADVVLASGKA*
Ga0116102_106417633300009632PeatlandFRPMLERVRVEEWPAIRAEATAAIERYRVGDEIRFGADVVLASGKA*
Ga0116102_117446113300009632PeatlandAVAAPFRPMLERVRVEEWPAIRAEAKAAIERYRVGDEIRFGADVVLASGKA*
Ga0116124_115994223300009634PeatlandYACAVAAPFRPMLERVRAEEWPVIRAEAKAAIERYRVGDEIRFGADVVLASGKA*
Ga0116126_100858983300009640PeatlandRPMLERVPAEEWPAIRAEATAAIERYRVGNEIRFSADVILASGEA*
Ga0116106_120913223300009645PeatlandFRPMLERVQVEEWPAIRAEATAAIERYRLGNEIRFGADVVLASGKA*
Ga0116224_1039858123300009683Peatlands SoilEYACAVAAPFRPMLERVPAEEWPVVRAKAKTAIEQYRVGDEIRFGADVVLASGRA*
Ga0116216_1032795833300009698Peatlands SoilRAEEWPAIRAEAKAAIERYRVGDEIRFGADVVLASGRA*
Ga0074046_1000103513300010339Bog Forest SoilQVSAPFRPMLERVSADRWPVIRAEARAAIERYRVGDEIRFGADIVFVSGKA*
Ga0074046_1068593923300010339Bog Forest SoilSAPFRPIGERVPAEEWPAIRAEAKAAIERYRVGDEIRFGADVILASGKA*
Ga0137399_1051386133300012203Vadose Zone SoilASIPFRAMLDRIPAEKWPAVRDEVYDAINRYRVGDEIRFGAVVVLASGKA*
Ga0137399_1176734923300012203Vadose Zone SoilERVPAEQWPTIRAEAKAAIERYRVGNEIRFGADVVLASGKA*
Ga0137362_1028063813300012205Vadose Zone SoilADEVLEYFCAVSAPFRPMLERVPAEEWPSIRAEAKAAIERYRVGNEIRFGADVVLASGKA
Ga0137376_1014297723300012208Vadose Zone SoilMLERVPLEEWPVIRAEAKVAMERYRVGDEIRFIADVVLASGKA*
Ga0137358_1053054913300012582Vadose Zone SoilAPFRPMLERVPAEEWPSIRAEAKTAIERHRVGNEIRFGADVVLASGKA*
Ga0137395_1033078133300012917Vadose Zone SoilVAAPFRPMLERVPVEEWPAIRAEAKAAMERYRVGDEIRFGADVVLASGTA*
Ga0137396_1054355933300012918Vadose Zone SoilRPMLERVPAGEWPAIRAEAKAAMERYRVGDEIRFGADVGLASGTA*
Ga0137396_1062373413300012918Vadose Zone SoilAPFRPMLERVPAEEWPAIRAEAKAAMERYRVGDEIRFGADVVLASGKA*
Ga0137419_1123384123300012925Vadose Zone SoilAPFRPMLERVPAEEWPLIHSEAKAAMERYHVGDEIRFGADVVLASGKA*
Ga0137416_1080660113300012927Vadose Zone SoilEEAFEYFCAVSAPFRPMLERVPAGEWPAIRAEAKAAMERYRVGDEIRFGADVVLASGKA*
Ga0181518_1009063053300014156BogPAEEWPAIRAEATAAIERYRVGDEIRFGADVVLASGKA*
Ga0181523_1002218973300014165BogFEYACAVAAPFRPMLERVPAEEWPAIRAEATAAIERYRVGDEIRFTADVVLASGEA*
Ga0181528_1055031123300014167BogMSAPFRSMMERVSPEAWPAIRTEGAATIERYRVGDEIVFGADVILASGKA*
Ga0181526_1005465953300014200BogMLERVRVEEWPAIRTEAKAAIERYRVGNEIRFGADVVLASGTA*
Ga0181526_1055355523300014200BogACAISAPFRPMLEQVRAEQWPAIRAEVKAAIERYRVGDEIRFGADVILASGKA*
Ga0182018_1016485323300014489PalsaLKRIAWAVAAPFRPMLERVRVEEWPAIRAEAKAAIERYRAGNEIQFGADVVLASGKA*
Ga0181536_1036580813300014638BogYACAVAAPFRPMLERVRMEEWPAIRAEAKAAIERYRVGDEIRFGADVVLASGRA*
Ga0181522_1018901443300014657BogPDEKWPAIRAEAKAAIERYRVGDEIRFGADVILASGVA*
Ga0187802_1017495523300017822Freshwater SedimentGDANEVFEYACAVAAPFRPMLERAPEAMWPAIRAEAEAAIERYRVGDEIRFGADVVLASGQA
Ga0187818_1005792233300017823Freshwater SedimentVPFRAMLERVPADEWPAIRAEAKEAIERYRVRDELRFGAELVFASGKA
Ga0187814_1035888123300017932Freshwater SedimentERVPADQWPVIRAQAKAEIERFRVGDEIRFGADIVLASGKV
Ga0187801_1034662123300017933Freshwater SedimentAPFRPMLERAPEAMWPAIRAEAEAAIERYRVGDEIRFGADVVLASGQA
Ga0187854_1003307853300017938PeatlandFDYACAVAAPFRPMLERVRAEEWPVIRAEAKAAIERYRVGDEIRFGADVVLASGKA
Ga0187819_1046608223300017943Freshwater SedimentCAVSAPFRPMLERVRVEEWPAIRAEAKAAIERDRVGDEIRFGADVVLASGKA
Ga0187879_1076743723300017946PeatlandVAAPFRPMLERVPAEEWPAIRAEAKAAIERYRVGDEIRFGAEVVLASGKA
Ga0187781_1011418713300017972Tropical PeatlandAGDADEVFAYACALSVPFRRMLDRVAEEMWPAIRADAREAIERYRVGNEIRFGAEIVMASGRA
Ga0187781_1062965923300017972Tropical PeatlandEEMWPAIRAEAKAAIERYRVGNEIRFGADVVLASGRA
Ga0181520_1059565733300017988BogSAPFRSMMERVSPEAWPAIRTEGAATIERYRVGDEIVFGADVILASGKA
Ga0187816_1019389713300017995Freshwater SedimentMLERAPEAMWPAIRAAAEAAIERYRVGDEIRFGADVVLASGQA
Ga0187816_1019539713300017995Freshwater SedimentDQWPVIRAEAKEAIKCYRVGDEIRFGADIVLASGNA
Ga0187804_1031830713300018006Freshwater SedimentERVRVEEWPTIRAEAKAAIERYRVGDEIRFGADVVLASGKA
Ga0187880_125863523300018016PeatlandGDGEEVFEYACAVAAPFRPMLERVRVEEWLAIRAEATAAIERYRVGDEIRFGADIVLASGKA
Ga0187882_129309223300018021PeatlandMLERVRAEEWPVIRAEAKAAIERYRVGDEIRFGADVVLASGKA
Ga0187869_1008304443300018030PeatlandEEWLAIRAEATAAIERYRVGDEIRFGADIVLASGKA
Ga0187867_1001415813300018033PeatlandYACAVAAPFRPMLERVRVEEWLAIRAEATAAIERYRVGDEIRLGADIVLASGKA
Ga0187867_1058101413300018033PeatlandVFEYACAVAAPFRPMLERVAAEDWPTIRTEAKAAIERYRVGDEIRFGADVVLASGKA
Ga0187875_1003691763300018035PeatlandFRPMLERVPAEEWPAIRAEAKAAIERYRVGDEIRFGAEVVLASGKG
Ga0187875_1067960713300018035PeatlandEYACAVAAPFRPMLERVPDEKWAAIRAEAKAAIERYRVGDEIRFGADVILTSGVA
Ga0187855_1022346813300018038PeatlandAIQAEAKEAIERYRVGDEIRFGADVVFASGKVRPAGTS
Ga0187890_1019875613300018044PeatlandAEEWPAIRAEATAAIERYRVGDEIRFGADVVLASEKA
Ga0187784_1011482213300018062Tropical PeatlandVFVYACTLSVPFWPMLDRVPDTMWPAIRAEAREAIERYRVGEEIRFGAEIVMASGRA
Ga0187774_1028796613300018089Tropical PeatlandPFRPMLERVQEKQWPDILAEAHAAIDRYRVGEEIRFGAQVILASGRA
Ga0210395_1022955813300020582SoilFEYACAVAAPFRPMLERVKAEDWPTIRDEAAAAIERYRVGDEIRFGADVIFASGKA
Ga0210387_1017990853300021405SoilEWPGIRAEAKRAMERYRVGDEIRFGADVVLASGKA
Ga0224558_106656353300023090SoilAEEWPAIRAEAKAAIERYRVGDEIRFGADVVLASGKA
Ga0224557_121889623300023101SoilMLERVPAEEWPAIRAEAKAAIERYRVGDEIRFGADVVLASGKA
Ga0208690_102019243300025434PeatlandACAVAAPFRPMLERVPAEEWPAIRAEAKAAIERYRVGDEIRFGAEVVLASGKA
Ga0208034_106341313300025442PeatlandAISAPFRPMLERVPADEWPAIRAEAKAAIERYRVGDEIRFGADVVLASGKA
Ga0208455_102733213300025453PeatlandSAPFRPMLERVRVEEWPAIRAEATAAIERYRVGDEIRFGADVVLASGKA
Ga0209131_109035613300026320Grasslands SoilRVPAEQWPAIRAEAKAAIERFRVGDEIRFGADVILASGKA
Ga0257153_106870623300026490SoilGSAEEVFDYACTVAAPFRPMIERVQEKDWPAIRADATLAMQQYRVGNEIRFGADVVFASGKA
Ga0209332_104201023300027439Forest SoilPGSAEEVFDYACTVAAPFRPMIERVPEKDWPAIRADAVNAMEQYRMGYEIRFGAEVVFASGKA
Ga0209008_109693623300027545Forest SoilEQWPAIRAEAKTAIERFRVGGEIRFGVEVILASGKA
Ga0209735_104669933300027562Forest SoilEEVLEYFCAVAAPFRAMLERVPAEEWPVIRAAAKAAMERYRVGDEIRFGADVVLASGKA
Ga0209735_113457813300027562Forest SoilLDYFCAVAAPFRPMLERVPVEEWPAIRAEAKAAIERYRVGDEVRFGADVVLASGKA
Ga0209220_102690943300027587Forest SoilVLEYFCAVAAPFRPMLERVPVEEWPAIRAEAKAAIERYRVGDEVRFGADVVLASGKA
Ga0209422_102047243300027629Forest SoilFEYFCAVAAPFRPMLERLRLEQWPVIRAEAKAAMERYRVGDEIRFGADVVLASGKA
Ga0208988_109706823300027633Forest SoilERVPAEQWPTIRAEAKAAIERYRVGDEIRFGADVVLASGKA
Ga0209773_1007764243300027829Bog Forest SoilPAEEWPAIRADAKAAMERYRVGDEIRFGADVILASGKA
Ga0209169_1071562723300027879SoilFRPMVERVPEAMWPAIRSEASAAMEQYRVDDEIRFGADVVLASGRA
Ga0257175_100494953300028673SoilYACAVAAPFRPMLERAPADEWPLIRAEAKAAMERYRVGDEIRFSADVVLASGKA
Ga0302214_109530223300028736FenFGDADEVFEYACAVAAPFRPMLDRVPNEKWPAICSEAKSAIEQYRVGDEIRFGAEVILASGKA
Ga0302163_1008427413300028868FenVAAPFRPMLDRVPNEKWPAICSEAKSAIEQYRVGDEIRFGAEVILASGKA
Ga0302210_1004382513300029995FenDEVFEYACAVAAPFRPMLDRVPNEKWPAICSEAKSAIEQYRVGDEIRFGAEVILASGKA
Ga0302271_1047966513300029998BogNEKWPAICSEAKSAIEQYRVGDEIRFGAEVILASGKA
Ga0302217_1011324513300030052FenDRVPNEKWPAICSEAKSAIEQYRVGDEIRFGAEVILASGKA
Ga0311360_1001573583300030339BogYRVPNEKWPAICSEAKSAIEQYRVGDEIRFGAEVILASGKA
Ga0310037_1015665733300030494Peatlands SoilDAEEVFEYACAVAAPFRPMLERVRAEEWPAIRAEAKAAIERYRVGDEIRFGADVVLASGR
Ga0170824_12036333313300031231Forest SoilEVLEYFCAVAAPFRPMLDRVQVEEWPVIRAEAKAAIERYRVGDEIRFGADVVLASGKA
Ga0302325_1047431623300031234PalsaLKRIAWAVAAPFRPMLERVRVEEWPAIRAEAKAAIERYRAGNEIQFGADVVLASGKA
Ga0310686_11600497723300031708SoilAAPFRPMLERVPAEEWPAIRAEAKAAMERYRVGDEIRFGADVILASGKA
Ga0265314_1009261613300031711RhizospherePMLERVSAEQWPAIRGEATTAIERYRVGDEIRFGADVVLASGTA
Ga0307474_1127160323300031718Hardwood Forest SoilEYACAVAAPFRPMLERVKSEDWPAIRAEAIAAIELYRVGNEIRFSVDVVLASGKA
Ga0307469_1012974613300031720Hardwood Forest SoilKWPDVRAESYAAIDRYRVRDEIRFGAVVILASGRA
Ga0307473_1026254033300031820Hardwood Forest SoilADQWPMIRNQAKAAIERYRVGDEIRFGADVVLVSGKA
Ga0307479_1125133713300031962Hardwood Forest SoilMIERVQEKDWPAIRADATLAMRQYRVGNEIRFGADVVFVSGKA
Ga0326728_1112290323300033402Peat SoilRPMLERVPADQWTVIRAEAKEAIERYRVDDEIRFGADIVLASGKA
Ga0334821_099414_265_3963300033798SoilMMERVPAEEWPAIRAEAKASIERYRVGDEIRFGANVVLASGKA
Ga0314867_163371_43_1743300033808PeatlandMLESVPDKMWPAIRADARAAIERYRVGNEIRFGADIVLASGKA

 ⦗Top⦘


Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.