


| Basic Information | |
|---|---|
| Family ID | F080349 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 115 |
| Average Sequence Length | 44 residues |
| Representative Sequence | FVFNFLNLLRGLVPAVTLFSSFIYAFGCFSVMVFFYVFHRAQS |
| Number of Associated Samples | 105 |
| Number of Associated Scaffolds | 115 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 12.28 % |
| % of genes near scaffold ends (potentially truncated) | 83.48 % |
| % of genes from short scaffolds (< 2000 bps) | 83.48 % |
| Associated GOLD sequencing projects | 100 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.57 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (81.739 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil (11.304 % of family members) |
| Environment Ontology (ENVO) | Unclassified (31.304 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (46.957 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Transmembrane (alpha-helical) | Signal Peptide: | Yes | Secondary Structure distribution: | α-helix: 57.75% β-sheet: 0.00% Coil/Unstructured: 42.25% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.57 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 115 Family Scaffolds |
|---|---|---|
| PF14310 | Fn3-like | 9.57 |
| PF13538 | UvrD_C_2 | 6.09 |
| PF00196 | GerE | 3.48 |
| PF13604 | AAA_30 | 2.61 |
| PF14520 | HHH_5 | 1.74 |
| PF14417 | MEDS | 1.74 |
| PF01738 | DLH | 1.74 |
| PF07366 | SnoaL | 1.74 |
| PF00072 | Response_reg | 0.87 |
| PF00582 | Usp | 0.87 |
| PF03551 | PadR | 0.87 |
| PF05598 | DUF772 | 0.87 |
| PF08818 | DUF1801 | 0.87 |
| PF13545 | HTH_Crp_2 | 0.87 |
| PF00665 | rve | 0.87 |
| PF15780 | ASH | 0.87 |
| PF13466 | STAS_2 | 0.87 |
| PF12811 | BaxI_1 | 0.87 |
| PF08388 | GIIM | 0.87 |
| PF12686 | DUF3800 | 0.87 |
| PF13643 | DUF4145 | 0.87 |
| PF14559 | TPR_19 | 0.87 |
| PF03695 | UPF0149 | 0.87 |
| PF02457 | DAC | 0.87 |
| PF03992 | ABM | 0.87 |
| PF00563 | EAL | 0.87 |
| PF11453 | DUF2950 | 0.87 |
| PF10067 | DUF2306 | 0.87 |
| PF16542 | PNKP_ligase | 0.87 |
| PF13650 | Asp_protease_2 | 0.87 |
| PF13187 | Fer4_9 | 0.87 |
| PF13520 | AA_permease_2 | 0.87 |
| PF00069 | Pkinase | 0.87 |
| PF02146 | SIR2 | 0.87 |
| PF03747 | ADP_ribosyl_GH | 0.87 |
| PF00702 | Hydrolase | 0.87 |
| COG ID | Name | Functional Category | % Frequency in 115 Family Scaffolds |
|---|---|---|---|
| COG0515 | Serine/threonine protein kinase | Signal transduction mechanisms [T] | 3.48 |
| COG0846 | NAD-dependent protein deacetylase, SIR2 family | Posttranslational modification, protein turnover, chaperones [O] | 0.87 |
| COG1397 | ADP-ribosylglycohydrolase | Posttranslational modification, protein turnover, chaperones [O] | 0.87 |
| COG1695 | DNA-binding transcriptional regulator, PadR family | Transcription [K] | 0.87 |
| COG1733 | DNA-binding transcriptional regulator, HxlR family | Transcription [K] | 0.87 |
| COG1846 | DNA-binding transcriptional regulator, MarR family | Transcription [K] | 0.87 |
| COG2200 | EAL domain, c-di-GMP-specific phosphodiesterase class I (or its enzymatically inactive variant) | Signal transduction mechanisms [T] | 0.87 |
| COG2801 | Transposase InsO and inactivated derivatives | Mobilome: prophages, transposons [X] | 0.87 |
| COG2826 | Transposase and inactivated derivatives, IS30 family | Mobilome: prophages, transposons [X] | 0.87 |
| COG3079 | Uncharacterized conserved protein YgfB, UPF0149 family | Function unknown [S] | 0.87 |
| COG3316 | Transposase (or an inactivated derivative), DDE domain | Mobilome: prophages, transposons [X] | 0.87 |
| COG3434 | c-di-GMP phosphodiesterase YuxH/PdeH, contains EAL and HDOD domains | Signal transduction mechanisms [T] | 0.87 |
| COG4430 | Uncharacterized conserved protein YdeI, YjbR/CyaY-like superfamily, DUF1801 family | Function unknown [S] | 0.87 |
| COG4584 | Transposase | Mobilome: prophages, transposons [X] | 0.87 |
| COG4943 | Redox-sensing c-di-GMP phosphodiesterase, contains CSS-motif and EAL domains | Signal transduction mechanisms [T] | 0.87 |
| COG5001 | Cyclic di-GMP metabolism protein, combines GGDEF and EAL domains with a 6TM membrane domain | Signal transduction mechanisms [T] | 0.87 |
| COG5646 | Iron-binding protein Fra/YdhG, frataxin family (Fe-S cluster biosynthesis) | Posttranslational modification, protein turnover, chaperones [O] | 0.87 |
| COG5649 | Uncharacterized conserved protein, DUF1801 domain | Function unknown [S] | 0.87 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 82.61 % |
| Unclassified | root | N/A | 17.39 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300002245|JGIcombinedJ26739_100002026 | All Organisms → cellular organisms → Bacteria | 13835 | Open in IMG/M |
| 3300002245|JGIcombinedJ26739_101333164 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 609 | Open in IMG/M |
| 3300002914|JGI25617J43924_10259450 | All Organisms → cellular organisms → Bacteria | 590 | Open in IMG/M |
| 3300004091|Ga0062387_100785471 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 708 | Open in IMG/M |
| 3300005177|Ga0066690_10032330 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 3053 | Open in IMG/M |
| 3300005445|Ga0070708_101034462 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 770 | Open in IMG/M |
| 3300005534|Ga0070735_10918200 | All Organisms → cellular organisms → Bacteria | 514 | Open in IMG/M |
| 3300006028|Ga0070717_11177748 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 697 | Open in IMG/M |
| 3300006057|Ga0075026_100790177 | All Organisms → cellular organisms → Bacteria | 575 | Open in IMG/M |
| 3300006059|Ga0075017_100325795 | Not Available | 1139 | Open in IMG/M |
| 3300006174|Ga0075014_100371130 | Not Available | 773 | Open in IMG/M |
| 3300006794|Ga0066658_10763499 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 541 | Open in IMG/M |
| 3300006893|Ga0073928_11131625 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 529 | Open in IMG/M |
| 3300006914|Ga0075436_101464317 | Not Available | 518 | Open in IMG/M |
| 3300007255|Ga0099791_10621188 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 529 | Open in IMG/M |
| 3300009029|Ga0066793_10770725 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 546 | Open in IMG/M |
| 3300009038|Ga0099829_11679060 | Not Available | 523 | Open in IMG/M |
| 3300009088|Ga0099830_11021285 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 685 | Open in IMG/M |
| 3300009090|Ga0099827_10954675 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Candidatus Acidoferrales → Candidatus Acidoferrum → Candidatus Acidoferrum panamensis | 743 | Open in IMG/M |
| 3300009137|Ga0066709_101797637 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae | 860 | Open in IMG/M |
| 3300009519|Ga0116108_1055147 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1253 | Open in IMG/M |
| 3300009524|Ga0116225_1421257 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 593 | Open in IMG/M |
| 3300009616|Ga0116111_1012395 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 3370 | Open in IMG/M |
| 3300009618|Ga0116127_1080917 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 877 | Open in IMG/M |
| 3300009623|Ga0116133_1168301 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 580 | Open in IMG/M |
| 3300009624|Ga0116105_1083394 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 779 | Open in IMG/M |
| 3300009628|Ga0116125_1248468 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 516 | Open in IMG/M |
| 3300009640|Ga0116126_1242755 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 567 | Open in IMG/M |
| 3300009698|Ga0116216_10878560 | Not Available | 537 | Open in IMG/M |
| 3300009700|Ga0116217_10128894 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis → Candidatus Koribacter versatilis Ellin345 | 1706 | Open in IMG/M |
| 3300009700|Ga0116217_10136071 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1651 | Open in IMG/M |
| 3300009762|Ga0116130_1146471 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 744 | Open in IMG/M |
| 3300009839|Ga0116223_10756976 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 556 | Open in IMG/M |
| 3300009839|Ga0116223_10892519 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 507 | Open in IMG/M |
| 3300010304|Ga0134088_10204114 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 947 | Open in IMG/M |
| 3300010341|Ga0074045_10103059 | All Organisms → cellular organisms → Bacteria | 1973 | Open in IMG/M |
| 3300010396|Ga0134126_11597686 | Not Available | 717 | Open in IMG/M |
| 3300010398|Ga0126383_13591894 | Not Available | 507 | Open in IMG/M |
| 3300011073|Ga0138584_1000086 | Not Available | 515 | Open in IMG/M |
| 3300012925|Ga0137419_11156476 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Candidatus Acidoferrales → Candidatus Acidoferrum → Candidatus Acidoferrum panamensis | 646 | Open in IMG/M |
| 3300012927|Ga0137416_10546896 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Candidatus Acidoferrales → Candidatus Acidoferrum → Candidatus Acidoferrum panamensis | 1002 | Open in IMG/M |
| 3300014164|Ga0181532_10481320 | All Organisms → cellular organisms → Bacteria | 682 | Open in IMG/M |
| 3300014201|Ga0181537_10362960 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 994 | Open in IMG/M |
| 3300014489|Ga0182018_10526284 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 624 | Open in IMG/M |
| 3300014495|Ga0182015_10413417 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 869 | Open in IMG/M |
| 3300014498|Ga0182019_10087986 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → unclassified Terriglobales → Terriglobales bacterium | 1879 | Open in IMG/M |
| 3300014839|Ga0182027_11945990 | Not Available | 564 | Open in IMG/M |
| 3300015053|Ga0137405_1027436 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 1077 | Open in IMG/M |
| 3300017942|Ga0187808_10192919 | Not Available | 904 | Open in IMG/M |
| 3300017943|Ga0187819_10351080 | All Organisms → cellular organisms → Bacteria | 852 | Open in IMG/M |
| 3300017946|Ga0187879_10131493 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1423 | Open in IMG/M |
| 3300017948|Ga0187847_10006897 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Solibacter → Candidatus Solibacter usitatus | 7944 | Open in IMG/M |
| 3300018008|Ga0187888_1079863 | All Organisms → cellular organisms → Bacteria | 1428 | Open in IMG/M |
| 3300018020|Ga0187861_10432718 | Not Available | 548 | Open in IMG/M |
| 3300018040|Ga0187862_10062609 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 2665 | Open in IMG/M |
| 3300018044|Ga0187890_10050498 | All Organisms → cellular organisms → Bacteria | 2478 | Open in IMG/M |
| 3300018044|Ga0187890_10830764 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 522 | Open in IMG/M |
| 3300018046|Ga0187851_10003229 | All Organisms → cellular organisms → Bacteria | 13831 | Open in IMG/M |
| 3300018047|Ga0187859_10184002 | All Organisms → cellular organisms → Bacteria | 1113 | Open in IMG/M |
| 3300018057|Ga0187858_10623653 | Not Available | 648 | Open in IMG/M |
| 3300019082|Ga0187852_1367563 | Not Available | 564 | Open in IMG/M |
| 3300019786|Ga0182025_1354068 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2190 | Open in IMG/M |
| 3300019787|Ga0182031_1265269 | Not Available | 1409 | Open in IMG/M |
| 3300020579|Ga0210407_11310608 | All Organisms → cellular organisms → Bacteria | 540 | Open in IMG/M |
| 3300021170|Ga0210400_10642465 | All Organisms → cellular organisms → Bacteria | 874 | Open in IMG/M |
| 3300021178|Ga0210408_10580966 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 888 | Open in IMG/M |
| 3300021433|Ga0210391_10000346 | All Organisms → cellular organisms → Bacteria | 51998 | Open in IMG/M |
| 3300021474|Ga0210390_11253049 | Not Available | 597 | Open in IMG/M |
| 3300021477|Ga0210398_10251624 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1440 | Open in IMG/M |
| 3300021479|Ga0210410_10781514 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 839 | Open in IMG/M |
| 3300022557|Ga0212123_10410448 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 905 | Open in IMG/M |
| 3300023259|Ga0224551_1006056 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Granulicella → Granulicella sibirica | 2016 | Open in IMG/M |
| 3300025412|Ga0208194_1053355 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 622 | Open in IMG/M |
| 3300026271|Ga0209880_1004142 | All Organisms → cellular organisms → Bacteria | 4114 | Open in IMG/M |
| 3300026318|Ga0209471_1256402 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 596 | Open in IMG/M |
| 3300026552|Ga0209577_10213858 | All Organisms → cellular organisms → Bacteria | 1473 | Open in IMG/M |
| 3300027610|Ga0209528_1003800 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 3162 | Open in IMG/M |
| 3300027633|Ga0208988_1102118 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Candidatus Acidoferrales → Candidatus Acidoferrum → Candidatus Acidoferrum panamensis | 710 | Open in IMG/M |
| 3300027795|Ga0209139_10094266 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1053 | Open in IMG/M |
| 3300027842|Ga0209580_10359276 | All Organisms → cellular organisms → Bacteria | 726 | Open in IMG/M |
| 3300027846|Ga0209180_10587728 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Candidatus Acidoferrales → Candidatus Acidoferrum → Candidatus Acidoferrum panamensis | 616 | Open in IMG/M |
| 3300027854|Ga0209517_10178622 | All Organisms → cellular organisms → Bacteria | 1330 | Open in IMG/M |
| 3300027854|Ga0209517_10599730 | All Organisms → cellular organisms → Bacteria | 583 | Open in IMG/M |
| 3300027867|Ga0209167_10015469 | All Organisms → cellular organisms → Bacteria | 3612 | Open in IMG/M |
| 3300027884|Ga0209275_10719854 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Verrucomicrobiae → Verrucomicrobiales → Verrucomicrobiaceae → Luteolibacter → Luteolibacter marinus | 575 | Open in IMG/M |
| 3300028828|Ga0307312_11185635 | All Organisms → cellular organisms → Bacteria | 505 | Open in IMG/M |
| 3300028863|Ga0302218_10265293 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 554 | Open in IMG/M |
| 3300028906|Ga0308309_10774517 | All Organisms → cellular organisms → Bacteria | 834 | Open in IMG/M |
| 3300029943|Ga0311340_10078961 | All Organisms → cellular organisms → Bacteria | 3723 | Open in IMG/M |
| 3300029999|Ga0311339_10117055 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 3231 | Open in IMG/M |
| 3300030054|Ga0302182_10218665 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 812 | Open in IMG/M |
| 3300030057|Ga0302176_10039543 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1800 | Open in IMG/M |
| 3300030057|Ga0302176_10242407 | Not Available | 721 | Open in IMG/M |
| 3300030494|Ga0310037_10306592 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 675 | Open in IMG/M |
| 3300030506|Ga0302194_10047809 | All Organisms → cellular organisms → Bacteria | 2110 | Open in IMG/M |
| 3300030659|Ga0316363_10406442 | Not Available | 528 | Open in IMG/M |
| 3300030706|Ga0310039_10125525 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1054 | Open in IMG/M |
| 3300030738|Ga0265462_12038193 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 559 | Open in IMG/M |
| 3300030814|Ga0265741_100990 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1639 | Open in IMG/M |
| 3300030847|Ga0075405_11898615 | All Organisms → cellular organisms → Bacteria | 735 | Open in IMG/M |
| 3300030940|Ga0265740_1011151 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatomonas → Candidatus Sulfotelmatomonas gaucii | 822 | Open in IMG/M |
| 3300031231|Ga0170824_102562081 | All Organisms → cellular organisms → Bacteria | 589 | Open in IMG/M |
| 3300031231|Ga0170824_107666178 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Candidatus Acidoferrales → Candidatus Acidoferrum → Candidatus Acidoferrum panamensis | 877 | Open in IMG/M |
| 3300031231|Ga0170824_109810432 | Not Available | 559 | Open in IMG/M |
| 3300031525|Ga0302326_10915850 | All Organisms → Viruses → Predicted Viral | 1244 | Open in IMG/M |
| 3300031708|Ga0310686_115927011 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 523 | Open in IMG/M |
| 3300031962|Ga0307479_11262977 | All Organisms → cellular organisms → Bacteria | 700 | Open in IMG/M |
| 3300032160|Ga0311301_10214274 | All Organisms → cellular organisms → Bacteria | 3265 | Open in IMG/M |
| 3300032174|Ga0307470_10233165 | All Organisms → cellular organisms → Bacteria | 1202 | Open in IMG/M |
| 3300032180|Ga0307471_100117205 | All Organisms → cellular organisms → Bacteria | 2469 | Open in IMG/M |
| 3300032180|Ga0307471_100997855 | All Organisms → cellular organisms → Bacteria | 1004 | Open in IMG/M |
| 3300032180|Ga0307471_103393478 | All Organisms → cellular organisms → Bacteria | 564 | Open in IMG/M |
| 3300032205|Ga0307472_101285492 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Candidatus Acidoferrales → Candidatus Acidoferrum → Candidatus Acidoferrum panamensis | 704 | Open in IMG/M |
| 3300033433|Ga0326726_12027440 | Not Available | 560 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Peatlands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil | 11.30% |
| Peatland | Environmental → Aquatic → Freshwater → Wetlands → Bog → Peatland | 9.57% |
| Peatland | Environmental → Aquatic → Freshwater → Wetlands → Unclassified → Peatland | 7.83% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 7.83% |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 6.96% |
| Palsa | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Palsa | 6.09% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 5.22% |
| Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 4.35% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 3.48% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 3.48% |
| Watersheds | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds | 2.61% |
| Surface Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil | 2.61% |
| Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil | 2.61% |
| Bog Forest Soil | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog Forest Soil | 1.74% |
| Bog | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog | 1.74% |
| Freshwater Sediment | Environmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment | 1.74% |
| Iron-Sulfur Acid Spring | Environmental → Aquatic → Thermal Springs → Hot (42-90C) → Acidic → Iron-Sulfur Acid Spring | 1.74% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 1.74% |
| Fen | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Fen | 1.74% |
| Palsa | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Palsa | 1.74% |
| Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Soil | 1.74% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 1.74% |
| Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 0.87% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 0.87% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 0.87% |
| Bog Forest Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Bog Forest Soil | 0.87% |
| Bog | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Bog | 0.87% |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Soil | 0.87% |
| Prmafrost Soil | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Prmafrost Soil | 0.87% |
| Permafrost | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Permafrost | 0.87% |
| Soil | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Soil | 0.87% |
| Bog | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Bog | 0.87% |
| Peat Soil | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Peat Soil | 0.87% |
| Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 0.87% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300002245 | Jack Pine, Ontario site 1_JW_OM2H0_M3 (Jack Pine, Ontario combined, ASSEMBLY_DATE=20131027) | Environmental | Open in IMG/M |
| 3300002914 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_115cm | Environmental | Open in IMG/M |
| 3300004091 | Coassembly of ECP14_OM1, ECP14_OM2, ECP14_OM3 | Environmental | Open in IMG/M |
| 3300005177 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_139 | Environmental | Open in IMG/M |
| 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Environmental | Open in IMG/M |
| 3300005534 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen07_05102014_R1 | Environmental | Open in IMG/M |
| 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Environmental | Open in IMG/M |
| 3300006057 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Straight Creek_MetaG_SC_2012 | Environmental | Open in IMG/M |
| 3300006059 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Alex Branch Run_MetaG_ABR_2012 | Environmental | Open in IMG/M |
| 3300006174 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Alex Branch Run_MetaG_ABR_2014 | Environmental | Open in IMG/M |
| 3300006794 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_107 | Environmental | Open in IMG/M |
| 3300006893 | Iron sulfur acid spring bacterial and archeal communities from Banff, Canada, to study Microbial Dark Matter (Phase II) - Paint Pots PPA 5.5 metaG | Environmental | Open in IMG/M |
| 3300006914 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Host-Associated | Open in IMG/M |
| 3300007255 | Vadose zone soil and rhizosphere microbial communities from the Eel River Critical Zone Observatory, Northern California to study diel carbon cycling - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_1 | Environmental | Open in IMG/M |
| 3300009029 | Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Permafrost soil replicate 1 DNA2013-189 | Environmental | Open in IMG/M |
| 3300009038 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H2.8 metaG | Environmental | Open in IMG/M |
| 3300009088 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H3.8 metaG | Environmental | Open in IMG/M |
| 3300009090 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con1.8 metaG | Environmental | Open in IMG/M |
| 3300009137 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_158 | Environmental | Open in IMG/M |
| 3300009519 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_6_150 | Environmental | Open in IMG/M |
| 3300009524 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_c_BC metaG | Environmental | Open in IMG/M |
| 3300009616 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_8_100 | Environmental | Open in IMG/M |
| 3300009618 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_16_100 | Environmental | Open in IMG/M |
| 3300009623 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_19_10 | Environmental | Open in IMG/M |
| 3300009624 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_6_10 | Environmental | Open in IMG/M |
| 3300009628 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_16_10 | Environmental | Open in IMG/M |
| 3300009640 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_16_40 | Environmental | Open in IMG/M |
| 3300009698 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_3_AS metaG | Environmental | Open in IMG/M |
| 3300009700 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_4_PS metaG | Environmental | Open in IMG/M |
| 3300009762 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_17_40 | Environmental | Open in IMG/M |
| 3300009839 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_a_PC metaG | Environmental | Open in IMG/M |
| 3300010304 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_5_09182015 | Environmental | Open in IMG/M |
| 3300010341 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - Bog Forest MetaG ECP23OM2 | Environmental | Open in IMG/M |
| 3300010396 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-2 | Environmental | Open in IMG/M |
| 3300010398 | Tropical forest soil microbial communities from Panama - MetaG Plot_35 | Environmental | Open in IMG/M |
| 3300011073 | Peat soil microbial communities from Weissenstadt, Germany - Metatranscriptome 74 (Metagenome Metatranscriptome) (version 2) | Environmental | Open in IMG/M |
| 3300012925 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_2_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012927 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300014164 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin11_30_metaG | Environmental | Open in IMG/M |
| 3300014201 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin23_10_metaG | Environmental | Open in IMG/M |
| 3300014489 | Permafrost microbial communities from Stordalen Mire, Sweden - 812P2M metaG | Environmental | Open in IMG/M |
| 3300014495 | Permafrost microbial communities from Stordalen Mire, Sweden - 712P3M metaG | Environmental | Open in IMG/M |
| 3300014498 | Permafrost microbial communities from Stordalen Mire, Sweden - 812E2M metaG | Environmental | Open in IMG/M |
| 3300014839 | Permafrost microbial communities from Stordalen Mire, Sweden - 712E1D metaG (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300015053 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_16fungal (PacBio error correction) | Environmental | Open in IMG/M |
| 3300017942 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - ASW_3 | Environmental | Open in IMG/M |
| 3300017943 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_4 | Environmental | Open in IMG/M |
| 3300017946 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_19_10 | Environmental | Open in IMG/M |
| 3300017948 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_4_10 | Environmental | Open in IMG/M |
| 3300018008 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_7_40 | Environmental | Open in IMG/M |
| 3300018020 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_10_100 | Environmental | Open in IMG/M |
| 3300018040 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_10_150 | Environmental | Open in IMG/M |
| 3300018044 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_21_10 | Environmental | Open in IMG/M |
| 3300018046 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_6_10 | Environmental | Open in IMG/M |
| 3300018047 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_10_10 | Environmental | Open in IMG/M |
| 3300018057 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_8_150 | Environmental | Open in IMG/M |
| 3300019082 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_6_40 | Environmental | Open in IMG/M |
| 3300019786 | Permafrost microbial communities from Stordalen Mire, Sweden - P3-2 metaG (PacBio error correction) | Environmental | Open in IMG/M |
| 3300019787 | Permafrost microbial communities from Stordalen Mire, Sweden - 812S3M metaG (PacBio error correction) | Environmental | Open in IMG/M |
| 3300020579 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-27-M | Environmental | Open in IMG/M |
| 3300021170 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-26-M | Environmental | Open in IMG/M |
| 3300021178 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-4-M | Environmental | Open in IMG/M |
| 3300021433 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-12-O | Environmental | Open in IMG/M |
| 3300021474 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-11-O | Environmental | Open in IMG/M |
| 3300021477 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-4-O | Environmental | Open in IMG/M |
| 3300021479 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-4-M | Environmental | Open in IMG/M |
| 3300022557 | Paint Pots_combined assembly | Environmental | Open in IMG/M |
| 3300023259 | Peat soil microbial communities from Stordalen Mire, Sweden - 717 P3 20-24 | Environmental | Open in IMG/M |
| 3300025412 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_19_10 (SPAdes) | Environmental | Open in IMG/M |
| 3300026271 | Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Permafrost soil replicate 2 DNA2013-191 (SPAdes) | Environmental | Open in IMG/M |
| 3300026318 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_128 (SPAdes) | Environmental | Open in IMG/M |
| 3300026552 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_109 (SPAdes) | Environmental | Open in IMG/M |
| 3300027610 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM2H0_M3 (SPAdes) | Environmental | Open in IMG/M |
| 3300027633 | Forest soil microbial communities from El Dorado National Forest, California, USA - Mediterranean Blodgett CA Ref_M1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027795 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP14_OM3 (SPAdes) | Environmental | Open in IMG/M |
| 3300027842 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen04_05102014_R1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027846 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H2.8 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027854 | Peat soil microbial communities from Weissenstadt, Germany - SII-2010 (SPAdes) | Environmental | Open in IMG/M |
| 3300027867 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen05_05102014_R1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027884 | Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027908 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_Ref_O2 (SPAdes) | Environmental | Open in IMG/M |
| 3300028828 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_202 | Environmental | Open in IMG/M |
| 3300028863 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Palsa_E1_1 | Environmental | Open in IMG/M |
| 3300028906 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 5 (v2) | Environmental | Open in IMG/M |
| 3300029943 | I_Palsa_N3 coassembly | Environmental | Open in IMG/M |
| 3300029999 | I_Palsa_E3 coassembly | Environmental | Open in IMG/M |
| 3300030054 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Palsa_N3_1 | Environmental | Open in IMG/M |
| 3300030057 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Palsa_E1_1 | Environmental | Open in IMG/M |
| 3300030494 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_3_AS metaG (v2) | Environmental | Open in IMG/M |
| 3300030506 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Bog_N1_1 | Environmental | Open in IMG/M |
| 3300030659 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_a_PC metaG (v2) | Environmental | Open in IMG/M |
| 3300030706 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_6_BS metaG (v2) | Environmental | Open in IMG/M |
| 3300030738 | Forest Soil Metatranscriptomes Boreal Montmorency Forest, Quebec, Canada VDE Co-assembly | Environmental | Open in IMG/M |
| 3300030814 | Metatranscriptome of soil microbial communities from Maridalen valley, Oslo, Norway - NSI2 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300030847 | Forest soil microbial communities from France for metatranscriptomics studies - Site 11 - Champenoux / Amance forest - FA10 SO (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
| 3300030940 | Metatranscriptome of soil microbial communities from Maridalen valley, Oslo, Norway - NSI1 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300031231 | Coassembly Site 11 (all samples) - Champenoux / Amance forest | Environmental | Open in IMG/M |
| 3300031525 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Palsa_T0_3 | Environmental | Open in IMG/M |
| 3300031708 | FICUS49499 Metagenome Czech Republic combined assembly | Environmental | Open in IMG/M |
| 3300031962 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM4C_515 | Environmental | Open in IMG/M |
| 3300032160 | Sb_50d combined assembly (MetaSPAdes) | Environmental | Open in IMG/M |
| 3300032174 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_05 | Environmental | Open in IMG/M |
| 3300032180 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_515 | Environmental | Open in IMG/M |
| 3300032205 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_05 | Environmental | Open in IMG/M |
| 3300033433 | Lab enriched peat soil microbial communities from Michigan Hollow, Ithaca, NY, United States - MHF15MN | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| JGIcombinedJ26739_10000202611 | 3300002245 | Forest Soil | MFILPDNVPRDLVPAVTVFQSFIYAFGCFSVMVFFYVCHRAQKS* |
| JGIcombinedJ26739_1013331642 | 3300002245 | Forest Soil | FLNVLRDLVPAVTLFSSFIYAFGCFSVMLFFYVFHGAQQ* |
| JGI25617J43924_102594502 | 3300002914 | Grasslands Soil | LWTFLFTVLNVLRGMVPAVTLFQSLVYAFGSFSMMVFFYVFHRAQ* |
| Ga0062387_1007854711 | 3300004091 | Bog Forest Soil | VWNFVLTLLNVLRDLVPAVTLLSSLIYAFGAFCVVVFFFVFHRTQP* |
| Ga0066690_100323301 | 3300005177 | Soil | FVLTFLNVLRDLVPAVTLFSSFIHAFGCFSVAVFFYVFHRAQS* |
| Ga0070708_1010344622 | 3300005445 | Corn, Switchgrass And Miscanthus Rhizosphere | TFLNVVRDLVPAVTLFSSFIYAFGCFSVAVFFYIFHRAQ* |
| Ga0070735_109182002 | 3300005534 | Surface Soil | VFNLLNLLRGLVPAVMVFESLIYAFGCFSVMVFFFVFHRAQS* |
| Ga0070717_111777482 | 3300006028 | Corn, Switchgrass And Miscanthus Rhizosphere | TFLNVLRDLVPAVTLFSSFIHAFGCFTVAVFFYAFHRAQ* |
| Ga0075026_1007901772 | 3300006057 | Watersheds | LLVWNFVFTFLNVLRDLVPVVTLFSSVIYTFGCFSVAVFFYAFHRAQS* |
| Ga0075017_1003257952 | 3300006059 | Watersheds | VGNFVFTLLNVLRDLVPAVTLLSSFIYAFGSLSVMVFFFVFHRAQRQS* |
| Ga0075014_1003711301 | 3300006174 | Watersheds | TFLNVLRDLVPAVTLFSSLIYAFGCFTVMVFFYVFHRVQQ* |
| Ga0066658_107634993 | 3300006794 | Soil | LRDLVPAMTLFPSFIYAFGAFSVMVFFYVFRRGQ* |
| Ga0073928_111316252 | 3300006893 | Iron-Sulfur Acid Spring | FVLTFLNVLRDLVPAITLFPSFIYGFGCFSVMVFFYVFHRAQ* |
| Ga0075436_1014643171 | 3300006914 | Populus Rhizosphere | CTFVFSFVNVLRGLAPPLMLFPWFVYSFACFSVAVFFYVFHRAQS* |
| Ga0099791_106211881 | 3300007255 | Vadose Zone Soil | NVVNVLRDLVPALTLFSSFIYAFACLSVAVFFYAFHRAQS* |
| Ga0066793_107707251 | 3300009029 | Prmafrost Soil | LLVCTFVFNFLNLLRGLVPAVTLFSSFIYAFGCFSVAVFFYVFHRAQS* |
| Ga0099829_116790602 | 3300009038 | Vadose Zone Soil | WTFVSTFVNVLRGLAPPAMLFPWFVYAFACFSTAVFFCAFYKAHS* |
| Ga0099830_110212851 | 3300009088 | Vadose Zone Soil | ILITVLLVWTFVFNVVNVLRSLVPALTLFSSFIYAFACLSVAVFFYVFHRTQS* |
| Ga0099827_109546751 | 3300009090 | Vadose Zone Soil | LATVLLVWTFVFNVVNVLRGLVPALTLFSSFIYAFACLSVAVFFYAFHRAQS* |
| Ga0066709_1017976372 | 3300009137 | Grasslands Soil | LNALRGLVPAVTLFSSFIYVFGCFSVAVFFYVFHRAQS* |
| Ga0116108_10551472 | 3300009519 | Peatland | FVFNFLNLLRGLVPAVTLFQSFIYAFGCFSVAVFFFVFHRTQS* |
| Ga0116225_14212571 | 3300009524 | Peatlands Soil | FLNVLRDLVPAVTLFSSFIYAFGSFSVMVFFYVFHRAQR* |
| Ga0116111_10123958 | 3300009616 | Peatland | FNFLNLLRGLVPAVTLFSSFIYAFGCFSVMVFFFVFHRTQS* |
| Ga0116127_10809171 | 3300009618 | Peatland | NVLRGLVPPVMLFSSFIYAFGCFSVMVFFFVFHRAQKA* |
| Ga0116133_11683012 | 3300009623 | Peatland | FALTLLNVLRDLVPAVTLFSSLVHAFGCFSVMVFFIVFHRAQS* |
| Ga0116105_10833943 | 3300009624 | Peatland | LRDLVPAVTLFSSLIYAFGCLTVTVFFFVFHRAQS* |
| Ga0116125_12484682 | 3300009628 | Peatland | WDFVFTVLNVLRGVIPAVMLFHSFIYAFGCFSVMVFFFVFHRAQ* |
| Ga0116126_12427551 | 3300009640 | Peatland | FLNFLRGLVPAVSLFSSFIYAFGCFSVMAFFFVFHRAQS* |
| Ga0116216_108785602 | 3300009698 | Peatlands Soil | LLRGVVLAVMVFESFIYAFGCFTVMVFFLVFHRAQQS* |
| Ga0116217_101288941 | 3300009700 | Peatlands Soil | VLRDLVPAVVLFSSFIEAFGCFCVAVFFYVFHRAQS* |
| Ga0116217_101360711 | 3300009700 | Peatlands Soil | LNVLRDLVPAVALFSSFIYAIGCFSVMVFFFVFHRAQR* |
| Ga0116130_11464712 | 3300009762 | Peatland | FTFLNVLRDLVPAVSLFSSLIYAFGAFSVMVFFFVFHRAQKA* |
| Ga0116223_107569761 | 3300009839 | Peatlands Soil | ILMTVLLVWNFVFTFLNVLRDLVPAVALFSSFIYAFGCFSVMVFFFVFHRAQR* |
| Ga0116223_108925192 | 3300009839 | Peatlands Soil | LLVWNFVFTFLNVLRDLVPAVALFSSLIYAFGSFSVMVFFFVFHRAQR* |
| Ga0134088_102041142 | 3300010304 | Grasslands Soil | WTFVFNVLNAVRGLVPAVTLLSSFIYSFGCFSVAVFFYVFHRAQ* |
| Ga0074045_101030593 | 3300010341 | Bog Forest Soil | MVWNFVFTFLNVLRDLIPAVSLFSSFTYAFGCLTVMVFFFVFHRAQR* |
| Ga0134126_115976861 | 3300010396 | Terrestrial Soil | IVGVLRGLIPALTLFSSVVYAFAGLSAAMFFYVFHVKQP* |
| Ga0126383_135918941 | 3300010398 | Tropical Forest Soil | VLNLLNVLRELVPAVTLFSSFIHAFGAFSVAVFFYTFHRAQ* |
| Ga0138584_10000861 | 3300011073 | Peatlands Soil | RDLVPAVVLFSSFIEAFGCFCVAVFFYVFHRAQS* |
| Ga0137419_111564761 | 3300012925 | Vadose Zone Soil | ITVLLVWTFFFNVVNVLRGLVPALTLFSSFIYAFAWLSVAVFLYVFHRAQS* |
| Ga0137416_105468962 | 3300012927 | Vadose Zone Soil | VFNVVNVLRGLVPALTLFSSFIYAFACLSVAVFFYVFHRTQS* |
| Ga0181532_104813202 | 3300014164 | Bog | FVFNFLNLLRGLVPAVTLFSSFIYAFGCFSVMVFFYVFHRAQS* |
| Ga0181537_103629601 | 3300014201 | Bog | TWTFIFNFLNVLRGLVPAVAVFSTFIYAFACFTVAVFFFVFHRAQ* |
| Ga0182018_105262842 | 3300014489 | Palsa | ALLVWTFVFNFLNVLRGLVPAAMLFSSIIYAFGCFSVAVFFYVFHRAQSL* |
| Ga0182015_104134173 | 3300014495 | Palsa | VLTFLNVLRDLVPAVTLFPSFIYAFGCFSVMVFF* |
| Ga0182019_100879862 | 3300014498 | Fen | MTALLVWTFVFNFLNLLRGLVPAVTLFSSFIYAFGCFSVMVFFFVFHRTQS* |
| Ga0182027_119459901 | 3300014839 | Fen | VLNVVRGLVPAVTLFSSLIFAFGAFSVAAFFFVFHKAQR* |
| Ga0137405_10274364 | 3300015053 | Vadose Zone Soil | LRGLTPPVMLFSWFIYAFACFSVAVFFYVFHRAQS* |
| Ga0187808_101929193 | 3300017942 | Freshwater Sediment | INALRGLIPALTLFSSFIYAFGCFSVAVFFYVFHRAQS |
| Ga0187819_103510803 | 3300017943 | Freshwater Sediment | ALLVWNFVFTFLNVLRDLVPAVSLFSSLIYAFGSFSVMVFFSVFHRTQS |
| Ga0187879_101314932 | 3300017946 | Peatland | NFLNVLRGLVPAVMLFSSFIYAFACLSVMVFFFVFHRAQS |
| Ga0187847_100068973 | 3300017948 | Peatland | MVMTILLVWNFVVTLLNVLRDLVPAVSLLSTFIYAFGSFSVMVFFFVFYRKQS |
| Ga0187888_10798633 | 3300018008 | Peatland | WNFVFTFLNVLRDLVPAVSLFSSLIYAFGAFSVMVFFFVFHRAQKA |
| Ga0187861_104327182 | 3300018020 | Peatland | WTFVFNVLNVLRGLAPPVVLFSSFIYAFACFALAVFFFVFHRAQP |
| Ga0187862_100626094 | 3300018040 | Peatland | NFVSNVLNVLRGVEAPIALFASFIYAFGCFSVMVFFFVFHRAQS |
| Ga0187890_100504981 | 3300018044 | Peatland | VFTFLNVLRDLVPAVSLFSSLIYAFGAFSVMVFFFVFHRAQKA |
| Ga0187890_108307641 | 3300018044 | Peatland | MTALLVWQFVFNLLNLLRGLVPAVTLFSSFIYAFGCFSVMVFFYVFHRAQS |
| Ga0187851_1000322910 | 3300018046 | Peatland | MTALLLWNFVLAFLHVVRDLVPAVTLFSSLLYAFGCFTVMVFFFVFHRRQS |
| Ga0187859_101840022 | 3300018047 | Peatland | MTALLAWNFVFTVLNVLRGVVTAVTLFSSFLYAFGCFTTAVFFYVFHRTQS |
| Ga0187858_106236531 | 3300018057 | Peatland | NLLRGLVPAVTLFSSFIYAFGCFSVMVFFFVFHRAQS |
| Ga0187852_13675632 | 3300019082 | Peatland | LWRFVFNFLNVLRDLVPAVVLFSSFIEAFGCFCVAVFFYVFHRAQS |
| Ga0182025_13540681 | 3300019786 | Permafrost | MTALLVWNFVLTLLNVLRDLVPAVTLSPRIYAFGCFSVMVFFYVFHRDQV |
| Ga0182031_12652691 | 3300019787 | Bog | MTILLLWNFVFTFLNVLRDLVPAVTLFSTFIYAFGSFSVMVFFFVFHRTQS |
| Ga0210407_113106082 | 3300020579 | Soil | VLRGLAPPVMLFSWFIYAFASFSVAVFFYVFHRAQS |
| Ga0210400_106424653 | 3300021170 | Soil | VWDFVFNVLNVLRGLIPAAMLFSSFIYAFACFSVAVFFYVFHREQS |
| Ga0210408_105809662 | 3300021178 | Soil | ATVLLVWTFVFNFVNVLRGLAPPVMLFSWFIYAFACFSLAVFFYVFHRAQS |
| Ga0210391_100003467 | 3300021433 | Soil | MTVLLMWNFVFNFLDLLRGLVPAAIVFSSLIYAFGAFSVMVFFYVFHRGQS |
| Ga0210390_112530491 | 3300021474 | Soil | LNVLRGVVPAVMLFQSFIYAFGSFSVMVFFYVFHRAQQS |
| Ga0210398_102516241 | 3300021477 | Soil | TALLVWSFVFTFLNVLRDLVPAVTLFQSFIYAAGCFSVAVFFYVFYRGQ |
| Ga0210410_107815142 | 3300021479 | Soil | TFLNVMRDLVPAVTLFSSFIYAFGCFSVMVFFFVFHRAQLS |
| Ga0212123_104104481 | 3300022557 | Iron-Sulfur Acid Spring | VPAVTLFTSFIYAFGCFSVMVFFYVFHRAQKSWFWR |
| Ga0224551_10060562 | 3300023259 | Soil | MKYALVNVLRDLVPAVTLFSSLIYAFGCFTLTIFFFVFQRAQG |
| Ga0208194_10533551 | 3300025412 | Peatland | TVFLVWNFVFTFLNVLRDLVPAVSLFSSLIYAFGAFSVMVFFFVFHRAQKA |
| Ga0209880_10041421 | 3300026271 | Soil | MTVLLVWNFVFNFLNLLRGLVPAVMLFSSFIYAFGCFSVMVFFYVFHRAQS |
| Ga0209471_12564021 | 3300026318 | Soil | VLLVWTFFFNVVNVLRGLVPALTLFSSFIYAFACLSVAVFFYAFHRAQS |
| Ga0209577_102138582 | 3300026552 | Soil | VLRDLVPTVTLFQSFIYAFGCFSVAVFFYVFRRAQ |
| Ga0209528_10038003 | 3300027610 | Forest Soil | FDVVNVLRGLVPLLTLFSSFIYAFACLSVAVFFYVFHRTQS |
| Ga0208988_11021182 | 3300027633 | Forest Soil | FNFVNVLRGLAPPVMLFSWFIHAFASFSVAVFFYVFHRAQS |
| Ga0209139_100942661 | 3300027795 | Bog Forest Soil | VWNFVLTLLNVLRDLVPAVTLLSSLIYAFGAFCVVVFFFVFHRTQP |
| Ga0209580_103592761 | 3300027842 | Surface Soil | LNVLNVLRDLVPAVTVFSSFIYAFGCFSVAVFFYIFHRAQ |
| Ga0209180_105877282 | 3300027846 | Vadose Zone Soil | LLVWTFVFNVVNVLRGLVPALTLFSSFIYAFAGLSVAVFFYVFHRAQS |
| Ga0209517_101786223 | 3300027854 | Peatlands Soil | NFLNLLRGLVPAVTLFSSFIYAFGCFSVMVFFFVFHRTQS |
| Ga0209517_105997302 | 3300027854 | Peatlands Soil | MTALLVWQFVFNFLNLLRGLVPAVTLFSSFIYAFGCFSVMVFFFVFHRTQS |
| Ga0209167_100154697 | 3300027867 | Surface Soil | MTILLVWAFVSNVVNASHGLVPGVRLFTSFIYAFGCLSVAVFFFVFYRGQS |
| Ga0209275_107198541 | 3300027884 | Soil | CMTALLLWSFVLTFLNLLRDLVPAVTLFQSFVYAFGCFSVAVFFYVFQRAQ |
| Ga0209006_111604041 | 3300027908 | Forest Soil | DFVFTVLNVVRGVIPPVMLFHSFIYAFGCFGVMMFFFVFHRAQS |
| Ga0307312_111856352 | 3300028828 | Soil | TVLNVLRGLAPPVMLFPWFVYAFACFSVAVFFYVFQKAQS |
| Ga0302218_102652931 | 3300028863 | Palsa | VTALLTWTFIFNFLNVLRGLVPAVAVFSTFIYAFACFTVAVFFFVFHRAQ |
| Ga0308309_107745173 | 3300028906 | Soil | SLVFTFLNVLRGVVPAVMLFQSFIYAFGSFSGMVFFYVFHKGQQS |
| Ga0311340_100789615 | 3300029943 | Palsa | VWNFVFNLLNLLRGLVPAVTLFSSFIYAFGCFGVMVFFFVFHRTQS |
| Ga0311339_101170553 | 3300029999 | Palsa | MTALLVWTFVLTFLNVLRDLVPALTLFQSFIYAFGAFSVTVFFYVFHKAQQS |
| Ga0302182_102186651 | 3300030054 | Palsa | TLLTALLVWNFLIACLNVMRDLIPPVALFSSLIYAFGSLCVMVFFLVFHRAQR |
| Ga0302176_100395431 | 3300030057 | Palsa | LLVWTFVLTFLNVLRDLVPAVTLFQSFIYAFGSFSVALFFYVFHRAQ |
| Ga0302176_102424071 | 3300030057 | Palsa | AFLVLTFVFTILNVLRGVVPPVALFSSFIYAFACLTVAVFFFVFHRAQS |
| Ga0310037_103065921 | 3300030494 | Peatlands Soil | FVSNVLNVLRGLVPAVTLFSSFIYAFGCFSVAVFLYVFYRTQASGRRVSG |
| Ga0302194_100478093 | 3300030506 | Bog | TALLLWNFLFTLLNVLHGIVPPVALFSSIIYAFGSLTVAIFFFVFHRAQS |
| Ga0316363_104064421 | 3300030659 | Peatlands Soil | LITALLLWRFVFNFLNVLRDLVPAVVLFSSFIEAFGCFCVAVFFYVFHRAQS |
| Ga0310039_101255251 | 3300030706 | Peatlands Soil | LRGVVPAVMLFSSFIYAFACFTAAVFFYVFHRAQS |
| Ga0265462_120381931 | 3300030738 | Soil | WDFVFTVLNDLRGVVPAVMLFSSFIYAIGCFSVMVFFFVFNRTQS |
| Ga0265741_1009901 | 3300030814 | Soil | TALLVWDFVFTVLNVLRGAVPAVMLFHSLIYAFGCFCVMVFFFVFHRTQS |
| Ga0075405_118986152 | 3300030847 | Soil | MTALLLWTFVLTFLNVLRDLVPAVTLFSSFIYAFGCFSVMLFFYVFHRAQQ |
| Ga0265740_10111512 | 3300030940 | Soil | VFNVLNVLRGLIPAIMLLSSFIYAFACFSIAVFFYVFHRAQQV |
| Ga0170824_1025620811 | 3300031231 | Forest Soil | LNVLRDLVPAVTLFSSFIYAFGCFSVMLFFYVFHRAQQ |
| Ga0170824_1076661782 | 3300031231 | Forest Soil | VLNVLRGAVPAVILLSSFIYAFACFSVAVFFYVFHRAQS |
| Ga0170824_1098104322 | 3300031231 | Forest Soil | TILMTALLVWNFVFTLLNVLRDLVPAVSLFSSLIYAFGSLTVMVFFFVFHRAQQ |
| Ga0302326_109158501 | 3300031525 | Palsa | LNVLRDLVPAATLFQSFIYAFGAFSVMVFFYVFHRAQQS |
| Ga0310686_1159270111 | 3300031708 | Soil | MTALLLWSFVLTFLNVLRDLVPAVTLFQSFVYAFGCFSVAVFFYVFQRAQ |
| Ga0307479_112629773 | 3300031962 | Hardwood Forest Soil | ILATVLLVWTFVSIALNVLRGLAPPVMLFPWFVYAFACFSVAVFFYVFHRAQS |
| Ga0311301_102142746 | 3300032160 | Peatlands Soil | MTALLVWNFVFTFLNLLRGLVPAVTLFTSFIYAFGSFSVMVFFFVFHRAQR |
| Ga0307470_102331652 | 3300032174 | Hardwood Forest Soil | TFLNVLRDLVPAVTLLQSFVYVFGCFSVTVFFYVFHRAQ |
| Ga0307471_1001172051 | 3300032180 | Hardwood Forest Soil | MTALLLWTFVLTFLNVLRDLVPAVTLLQSFVYVFGCFSVAVFFYVFHRAQ |
| Ga0307471_1009978551 | 3300032180 | Hardwood Forest Soil | ALLMWTFVLTFLNVLRHLVPAVTLFQSFIYAFGCFSVAVFFYVFRRAQ |
| Ga0307471_1033934781 | 3300032180 | Hardwood Forest Soil | VLRGLAPPVMLFPWFVYAFACFSVAVFFYVFHRAQS |
| Ga0307472_1012854922 | 3300032205 | Hardwood Forest Soil | FNVVNVLRGLVPALTLFSSFIYAFACLSVAVVFYVFHRTQS |
| Ga0326726_120274402 | 3300033433 | Peat Soil | LRDLVPAVSLFSSLIYAFGCFTVMAFFFVFHRAQQ |
| ⦗Top⦘ |