


| Basic Information | |
|---|---|
| Family ID | F080317 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 115 |
| Average Sequence Length | 40 residues |
| Representative Sequence | LKKLPTWGVTIVPPVDEGEGPRLAPTAMLIDAVRPYVRRG |
| Number of Associated Samples | 100 |
| Number of Associated Scaffolds | 115 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 0.87 % |
| % of genes near scaffold ends (potentially truncated) | 99.13 % |
| % of genes from short scaffolds (< 2000 bps) | 90.43 % |
| Associated GOLD sequencing projects | 96 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.27 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (80.000 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil (26.956 % of family members) |
| Environment Ontology (ENVO) | Unclassified (29.565 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (43.478 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 22.06% β-sheet: 0.00% Coil/Unstructured: 77.94% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.27 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 115 Family Scaffolds |
|---|---|---|
| PF02826 | 2-Hacid_dh_C | 5.22 |
| PF06283 | ThuA | 3.48 |
| PF02566 | OsmC | 2.61 |
| PF00378 | ECH_1 | 2.61 |
| PF00296 | Bac_luciferase | 2.61 |
| PF03460 | NIR_SIR_ferr | 2.61 |
| PF00106 | adh_short | 1.74 |
| PF00756 | Esterase | 1.74 |
| PF07978 | NIPSNAP | 1.74 |
| PF16113 | ECH_2 | 1.74 |
| PF13683 | rve_3 | 1.74 |
| PF01266 | DAO | 1.74 |
| PF02148 | zf-UBP | 1.74 |
| PF03061 | 4HBT | 1.74 |
| PF04365 | BrnT_toxin | 0.87 |
| PF02624 | YcaO | 0.87 |
| PF12831 | FAD_oxidored | 0.87 |
| PF04392 | ABC_sub_bind | 0.87 |
| PF06186 | DUF992 | 0.87 |
| PF01979 | Amidohydro_1 | 0.87 |
| PF05598 | DUF772 | 0.87 |
| PF12902 | Ferritin-like | 0.87 |
| PF01741 | MscL | 0.87 |
| PF05721 | PhyH | 0.87 |
| PF00578 | AhpC-TSA | 0.87 |
| PF01738 | DLH | 0.87 |
| PF02441 | Flavoprotein | 0.87 |
| PF01223 | Endonuclease_NS | 0.87 |
| PF01627 | Hpt | 0.87 |
| PF04966 | OprB | 0.87 |
| PF07733 | DNA_pol3_alpha | 0.87 |
| PF01593 | Amino_oxidase | 0.87 |
| PF03729 | DUF308 | 0.87 |
| PF06750 | DiS_P_DiS | 0.87 |
| PF00043 | GST_C | 0.87 |
| PF02371 | Transposase_20 | 0.87 |
| PF00211 | Guanylate_cyc | 0.87 |
| PF13403 | Hint_2 | 0.87 |
| PF01048 | PNP_UDP_1 | 0.87 |
| PF12146 | Hydrolase_4 | 0.87 |
| PF02668 | TauD | 0.87 |
| PF02798 | GST_N | 0.87 |
| PF07995 | GSDH | 0.87 |
| PF04964 | Flp_Fap | 0.87 |
| PF07812 | TfuA | 0.87 |
| PF04909 | Amidohydro_2 | 0.87 |
| PF02796 | HTH_7 | 0.87 |
| PF01547 | SBP_bac_1 | 0.87 |
| PF03966 | Trm112p | 0.87 |
| PF02738 | MoCoBD_1 | 0.87 |
| PF07883 | Cupin_2 | 0.87 |
| PF00881 | Nitroreductase | 0.87 |
| PF00743 | FMO-like | 0.87 |
| PF03466 | LysR_substrate | 0.87 |
| PF00126 | HTH_1 | 0.87 |
| PF00561 | Abhydrolase_1 | 0.87 |
| COG ID | Name | Functional Category | % Frequency in 115 Family Scaffolds |
|---|---|---|---|
| COG4813 | Trehalose utilization protein | Carbohydrate transport and metabolism [G] | 3.48 |
| COG1764 | Organic hydroperoxide reductase OsmC/OhrA | Defense mechanisms [V] | 2.61 |
| COG1765 | Uncharacterized OsmC-related protein | General function prediction only [R] | 2.61 |
| COG1989 | Prepilin signal peptidase PulO (type II secretory pathway) or related peptidase | Cell motility [N] | 2.61 |
| COG2141 | Flavin-dependent oxidoreductase, luciferase family (includes alkanesulfonate monooxygenase SsuD and methylene tetrahydromethanopterin reductase) | Coenzyme transport and metabolism [H] | 2.61 |
| COG5207 | Uncharacterized Zn-finger protein, UBP-type | General function prediction only [R] | 1.74 |
| COG0435 | Glutathionyl-hydroquinone reductase | Energy production and conversion [C] | 0.87 |
| COG0587 | DNA polymerase III, alpha subunit | Replication, recombination and repair [L] | 0.87 |
| COG0625 | Glutathione S-transferase | Posttranslational modification, protein turnover, chaperones [O] | 0.87 |
| COG0775 | Nucleoside phosphorylase/nucleosidase, includes 5'-methylthioadenosine/S-adenosylhomocysteine nucleosidase MtnN and futalosine hydrolase MqnB | Nucleotide transport and metabolism [F] | 0.87 |
| COG0813 | Purine-nucleoside phosphorylase | Nucleotide transport and metabolism [F] | 0.87 |
| COG1864 | DNA/RNA endonuclease G, NUC1 | Nucleotide transport and metabolism [F] | 0.87 |
| COG1944 | Ribosomal protein S12 methylthiotransferase accessory factor YcaO | Translation, ribosomal structure and biogenesis [J] | 0.87 |
| COG1970 | Large-conductance mechanosensitive channel | Cell wall/membrane/envelope biogenesis [M] | 0.87 |
| COG2072 | Predicted flavoprotein CzcO associated with the cation diffusion facilitator CzcD | Inorganic ion transport and metabolism [P] | 0.87 |
| COG2114 | Adenylate cyclase, class 3 | Signal transduction mechanisms [T] | 0.87 |
| COG2133 | Glucose/arabinose dehydrogenase, beta-propeller fold | Carbohydrate transport and metabolism [G] | 0.87 |
| COG2175 | Taurine dioxygenase, alpha-ketoglutarate-dependent | Secondary metabolites biosynthesis, transport and catabolism [Q] | 0.87 |
| COG2176 | DNA polymerase III, alpha subunit (gram-positive type) | Replication, recombination and repair [L] | 0.87 |
| COG2820 | Uridine phosphorylase | Nucleotide transport and metabolism [F] | 0.87 |
| COG2929 | Ribonuclease BrnT, toxin component of the BrnT-BrnA toxin-antitoxin system | Defense mechanisms [V] | 0.87 |
| COG2984 | ABC-type uncharacterized transport system, periplasmic component | General function prediction only [R] | 0.87 |
| COG3247 | Acid resistance membrane protein HdeD, DUF308 family | General function prediction only [R] | 0.87 |
| COG3482 | Uncharacterized conserved protein | Function unknown [S] | 0.87 |
| COG3547 | Transposase | Mobilome: prophages, transposons [X] | 0.87 |
| COG3659 | Carbohydrate-selective porin OprB | Cell wall/membrane/envelope biogenesis [M] | 0.87 |
| COG3847 | Flp pilus assembly protein, pilin Flp | Extracellular structures [W] | 0.87 |
| COG5285 | Ectoine hydroxylase-related dioxygenase, phytanoyl-CoA dioxygenase (PhyH) family | Secondary metabolites biosynthesis, transport and catabolism [Q] | 0.87 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 80.00 % |
| Unclassified | root | N/A | 20.00 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300001686|C688J18823_11044603 | Not Available | 518 | Open in IMG/M |
| 3300005177|Ga0066690_10942216 | All Organisms → cellular organisms → Bacteria | 548 | Open in IMG/M |
| 3300005332|Ga0066388_104481389 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 711 | Open in IMG/M |
| 3300005436|Ga0070713_101050264 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 787 | Open in IMG/M |
| 3300005557|Ga0066704_10807788 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 583 | Open in IMG/M |
| 3300005561|Ga0066699_10416694 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 961 | Open in IMG/M |
| 3300005764|Ga0066903_101288469 | All Organisms → cellular organisms → Bacteria | 1364 | Open in IMG/M |
| 3300005764|Ga0066903_108480151 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 524 | Open in IMG/M |
| 3300006052|Ga0075029_101274586 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 515 | Open in IMG/M |
| 3300006175|Ga0070712_100484361 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1035 | Open in IMG/M |
| 3300006176|Ga0070765_101330169 | All Organisms → cellular organisms → Bacteria | 677 | Open in IMG/M |
| 3300006176|Ga0070765_101373400 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 666 | Open in IMG/M |
| 3300006893|Ga0073928_10592369 | All Organisms → cellular organisms → Bacteria | 784 | Open in IMG/M |
| 3300007265|Ga0099794_10466250 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 663 | Open in IMG/M |
| 3300009012|Ga0066710_101193255 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1179 | Open in IMG/M |
| 3300009012|Ga0066710_104671486 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 512 | Open in IMG/M |
| 3300009038|Ga0099829_10315518 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1283 | Open in IMG/M |
| 3300009143|Ga0099792_11149682 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Kineosporiales → Kineosporiaceae → Kineococcus | 525 | Open in IMG/M |
| 3300009650|Ga0105857_1084981 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales | 843 | Open in IMG/M |
| 3300009826|Ga0123355_10441915 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Acetobacteraceae → Acidocella → Acidocella aromatica | 1646 | Open in IMG/M |
| 3300010376|Ga0126381_101819301 | Not Available | 879 | Open in IMG/M |
| 3300010376|Ga0126381_103218951 | Not Available | 645 | Open in IMG/M |
| 3300010379|Ga0136449_103328055 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 617 | Open in IMG/M |
| 3300010379|Ga0136449_103991802 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Acetobacteraceae | 551 | Open in IMG/M |
| 3300012096|Ga0137389_10115011 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 2159 | Open in IMG/M |
| 3300012200|Ga0137382_11343428 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 503 | Open in IMG/M |
| 3300012205|Ga0137362_10274630 | All Organisms → cellular organisms → Bacteria | 1457 | Open in IMG/M |
| 3300012210|Ga0137378_10140919 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales | 2232 | Open in IMG/M |
| 3300012361|Ga0137360_11465270 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 586 | Open in IMG/M |
| 3300012362|Ga0137361_10217846 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1731 | Open in IMG/M |
| 3300012918|Ga0137396_10083986 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales | 2248 | Open in IMG/M |
| 3300012923|Ga0137359_10225854 | All Organisms → cellular organisms → Bacteria | 1672 | Open in IMG/M |
| 3300012923|Ga0137359_11736155 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 511 | Open in IMG/M |
| 3300012927|Ga0137416_11704546 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 575 | Open in IMG/M |
| 3300012944|Ga0137410_11562053 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Kineosporiales → Kineosporiaceae → Kineococcus | 577 | Open in IMG/M |
| 3300012948|Ga0126375_11497372 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Acetobacteraceae | 576 | Open in IMG/M |
| 3300014167|Ga0181528_10195334 | Not Available | 1093 | Open in IMG/M |
| 3300014838|Ga0182030_11350169 | Not Available | 598 | Open in IMG/M |
| 3300015054|Ga0137420_1498844 | All Organisms → cellular organisms → Bacteria | 1895 | Open in IMG/M |
| 3300016270|Ga0182036_10147389 | All Organisms → cellular organisms → Bacteria | 1671 | Open in IMG/M |
| 3300016319|Ga0182033_10112997 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 2024 | Open in IMG/M |
| 3300016319|Ga0182033_11818234 | All Organisms → cellular organisms → Bacteria | 553 | Open in IMG/M |
| 3300016357|Ga0182032_10683757 | All Organisms → cellular organisms → Bacteria | 860 | Open in IMG/M |
| 3300016422|Ga0182039_12274891 | All Organisms → cellular organisms → Bacteria | 500 | Open in IMG/M |
| 3300016445|Ga0182038_10036713 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 3147 | Open in IMG/M |
| 3300017933|Ga0187801_10431999 | Not Available | 551 | Open in IMG/M |
| 3300017975|Ga0187782_10576399 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 864 | Open in IMG/M |
| 3300018034|Ga0187863_10225284 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1043 | Open in IMG/M |
| 3300018476|Ga0190274_11867818 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 696 | Open in IMG/M |
| 3300020068|Ga0184649_1064188 | Not Available | 506 | Open in IMG/M |
| 3300020199|Ga0179592_10457549 | Not Available | 551 | Open in IMG/M |
| 3300020579|Ga0210407_10742248 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 760 | Open in IMG/M |
| 3300020580|Ga0210403_10129388 | All Organisms → cellular organisms → Bacteria | 2058 | Open in IMG/M |
| 3300020583|Ga0210401_10614690 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 948 | Open in IMG/M |
| 3300021138|Ga0214164_1035381 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Acetobacteraceae | 1207 | Open in IMG/M |
| 3300021170|Ga0210400_10180754 | All Organisms → cellular organisms → Bacteria | 1710 | Open in IMG/M |
| 3300021171|Ga0210405_10173144 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales | 1710 | Open in IMG/M |
| 3300021181|Ga0210388_11142923 | Not Available | 663 | Open in IMG/M |
| 3300021384|Ga0213876_10489830 | Not Available | 654 | Open in IMG/M |
| 3300021405|Ga0210387_10172948 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales | 1861 | Open in IMG/M |
| 3300021420|Ga0210394_10565568 | Not Available | 1000 | Open in IMG/M |
| 3300022726|Ga0242654_10312358 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 581 | Open in IMG/M |
| 3300024288|Ga0179589_10579023 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 525 | Open in IMG/M |
| 3300025928|Ga0207700_10802031 | All Organisms → cellular organisms → Bacteria | 842 | Open in IMG/M |
| 3300025938|Ga0207704_11694019 | Not Available | 543 | Open in IMG/M |
| 3300026325|Ga0209152_10036628 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1692 | Open in IMG/M |
| 3300026332|Ga0209803_1163175 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 851 | Open in IMG/M |
| 3300026498|Ga0257156_1096685 | Not Available | 614 | Open in IMG/M |
| 3300027512|Ga0209179_1016323 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Acetobacteraceae | 1392 | Open in IMG/M |
| 3300027737|Ga0209038_10142515 | All Organisms → cellular organisms → Bacteria | 726 | Open in IMG/M |
| 3300027882|Ga0209590_10360451 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 937 | Open in IMG/M |
| 3300027911|Ga0209698_10113189 | All Organisms → cellular organisms → Bacteria | 2257 | Open in IMG/M |
| 3300028906|Ga0308309_11372585 | All Organisms → cellular organisms → Bacteria | 606 | Open in IMG/M |
| 3300029945|Ga0311330_11206645 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales | 547 | Open in IMG/M |
| 3300030225|Ga0302196_10423177 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 569 | Open in IMG/M |
| 3300030943|Ga0311366_10606535 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales | 952 | Open in IMG/M |
| 3300031234|Ga0302325_11131500 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1051 | Open in IMG/M |
| 3300031446|Ga0170820_13160803 | Not Available | 660 | Open in IMG/M |
| 3300031543|Ga0318516_10298865 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → unclassified Rhodospirillales → Rhodospirillales bacterium URHD0017 | 930 | Open in IMG/M |
| 3300031543|Ga0318516_10479414 | All Organisms → cellular organisms → Bacteria | 715 | Open in IMG/M |
| 3300031544|Ga0318534_10267994 | All Organisms → cellular organisms → Bacteria | 984 | Open in IMG/M |
| 3300031561|Ga0318528_10360791 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 780 | Open in IMG/M |
| 3300031708|Ga0310686_101475912 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Acetobacteraceae → Acidisphaera → unclassified Acidisphaera → Acidisphaera sp. S103 | 807 | Open in IMG/M |
| 3300031736|Ga0318501_10648056 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 581 | Open in IMG/M |
| 3300031744|Ga0306918_10699325 | Not Available | 793 | Open in IMG/M |
| 3300031753|Ga0307477_10431937 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 900 | Open in IMG/M |
| 3300031753|Ga0307477_10728679 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → unclassified Rhodospirillales → Rhodospirillales bacterium URHD0017 | 662 | Open in IMG/M |
| 3300031754|Ga0307475_11501770 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 517 | Open in IMG/M |
| 3300031792|Ga0318529_10338702 | Not Available | 700 | Open in IMG/M |
| 3300031796|Ga0318576_10062493 | All Organisms → cellular organisms → Bacteria | 1639 | Open in IMG/M |
| 3300031845|Ga0318511_10378820 | All Organisms → cellular organisms → Bacteria | 647 | Open in IMG/M |
| 3300031880|Ga0318544_10427652 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 515 | Open in IMG/M |
| 3300031897|Ga0318520_10697616 | Not Available | 634 | Open in IMG/M |
| 3300031918|Ga0311367_12356773 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales | 508 | Open in IMG/M |
| 3300031946|Ga0310910_10052199 | All Organisms → cellular organisms → Bacteria | 2887 | Open in IMG/M |
| 3300031947|Ga0310909_10749747 | All Organisms → cellular organisms → Bacteria | 809 | Open in IMG/M |
| 3300031954|Ga0306926_10056351 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 4716 | Open in IMG/M |
| 3300031954|Ga0306926_11563458 | All Organisms → cellular organisms → Bacteria | 758 | Open in IMG/M |
| 3300031954|Ga0306926_11696472 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 721 | Open in IMG/M |
| 3300032001|Ga0306922_12412218 | Not Available | 502 | Open in IMG/M |
| 3300032009|Ga0318563_10628477 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 578 | Open in IMG/M |
| 3300032035|Ga0310911_10002455 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 7552 | Open in IMG/M |
| 3300032035|Ga0310911_10612488 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 632 | Open in IMG/M |
| 3300032041|Ga0318549_10074001 | All Organisms → cellular organisms → Bacteria | 1450 | Open in IMG/M |
| 3300032059|Ga0318533_10836526 | All Organisms → cellular organisms → Bacteria | 675 | Open in IMG/M |
| 3300032059|Ga0318533_10953475 | All Organisms → cellular organisms → Bacteria | 629 | Open in IMG/M |
| 3300032059|Ga0318533_11174679 | Not Available | 562 | Open in IMG/M |
| 3300032076|Ga0306924_10207214 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 2251 | Open in IMG/M |
| 3300032076|Ga0306924_10990543 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 923 | Open in IMG/M |
| 3300032090|Ga0318518_10267605 | Not Available | 877 | Open in IMG/M |
| 3300032091|Ga0318577_10174015 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1028 | Open in IMG/M |
| 3300032898|Ga0335072_10918995 | Not Available | 816 | Open in IMG/M |
| 3300032954|Ga0335083_10564800 | Not Available | 943 | Open in IMG/M |
| 3300033134|Ga0335073_10666916 | Not Available | 1145 | Open in IMG/M |
| 3300033158|Ga0335077_11385094 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → unclassified Rhodospirillales → Rhodospirillales bacterium | 679 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 26.96% |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 16.52% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 11.30% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 4.35% |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 3.48% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 2.61% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 2.61% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 2.61% |
| Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Soil | 2.61% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 2.61% |
| Watersheds | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds | 1.74% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 1.74% |
| Peatlands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil | 1.74% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 1.74% |
| Fen | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Fen | 1.74% |
| Bog | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Bog | 1.74% |
| Groundwater Sediment | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Groundwater Sediment | 0.87% |
| Freshwater | Environmental → Aquatic → Freshwater → Lentic → Epilimnion → Freshwater | 0.87% |
| Peatland | Environmental → Aquatic → Freshwater → Wetlands → Bog → Peatland | 0.87% |
| Bog Forest Soil | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog Forest Soil | 0.87% |
| Bog | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog | 0.87% |
| Freshwater Sediment | Environmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment | 0.87% |
| Iron-Sulfur Acid Spring | Environmental → Aquatic → Thermal Springs → Hot (42-90C) → Acidic → Iron-Sulfur Acid Spring | 0.87% |
| Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil | 0.87% |
| Tropical Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland | 0.87% |
| Permafrost Soil | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Permafrost Soil | 0.87% |
| Bog | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Bog | 0.87% |
| Soil | Environmental → Terrestrial → Soil → Loam → Grasslands → Soil | 0.87% |
| Palsa | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Palsa | 0.87% |
| Termite Gut | Host-Associated → Arthropoda → Digestive System → Gut → Unclassified → Termite Gut | 0.87% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere | 0.87% |
| Plant Roots | Host-Associated → Plants → Roots → Unclassified → Unclassified → Plant Roots | 0.87% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300001686 | Grasslands soil microbial communities from Hopland, California, USA | Environmental | Open in IMG/M |
| 3300005177 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_139 | Environmental | Open in IMG/M |
| 3300005332 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Environmental | Open in IMG/M |
| 3300005557 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_153 | Environmental | Open in IMG/M |
| 3300005561 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_148 | Environmental | Open in IMG/M |
| 3300005764 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2) | Environmental | Open in IMG/M |
| 3300006052 | Freshwater sediment microbial communities from North America - Little Laurel Run_MetaG_LLR_2013 | Environmental | Open in IMG/M |
| 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Environmental | Open in IMG/M |
| 3300006176 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 5 | Environmental | Open in IMG/M |
| 3300006893 | Iron sulfur acid spring bacterial and archeal communities from Banff, Canada, to study Microbial Dark Matter (Phase II) - Paint Pots PPA 5.5 metaG | Environmental | Open in IMG/M |
| 3300007265 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 | Environmental | Open in IMG/M |
| 3300009012 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_159 | Environmental | Open in IMG/M |
| 3300009038 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H2.8 metaG | Environmental | Open in IMG/M |
| 3300009143 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_2 | Environmental | Open in IMG/M |
| 3300009650 | Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Organic soil DNA_2013-061 | Environmental | Open in IMG/M |
| 3300009826 | Embiratermes neotenicus P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P1 | Host-Associated | Open in IMG/M |
| 3300010376 | Tropical forest soil microbial communities from Panama - MetaG Plot_28 | Environmental | Open in IMG/M |
| 3300010379 | Sb_50d combined assembly | Environmental | Open in IMG/M |
| 3300012096 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h1.4B metaG | Environmental | Open in IMG/M |
| 3300012200 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_20_16 metaG | Environmental | Open in IMG/M |
| 3300012205 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_100_16 metaG | Environmental | Open in IMG/M |
| 3300012210 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_60_16 metaG | Environmental | Open in IMG/M |
| 3300012361 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_60_16 metaG | Environmental | Open in IMG/M |
| 3300012362 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_80_16 metaG | Environmental | Open in IMG/M |
| 3300012918 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czcobulk3.16 metaG | Environmental | Open in IMG/M |
| 3300012923 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_40_16 metaG | Environmental | Open in IMG/M |
| 3300012927 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012944 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012948 | Tropical forest soil microbial communities from Panama - MetaG Plot_14 | Environmental | Open in IMG/M |
| 3300014167 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin10_10_metaG | Environmental | Open in IMG/M |
| 3300014838 | Permafrost microbial communities from Stordalen Mire, Sweden - 812S3M metaG (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300015054 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_2_16fungal (PacBio error correction) | Environmental | Open in IMG/M |
| 3300016270 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.080 | Environmental | Open in IMG/M |
| 3300016319 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.00H | Environmental | Open in IMG/M |
| 3300016357 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.000 | Environmental | Open in IMG/M |
| 3300016422 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.111 | Environmental | Open in IMG/M |
| 3300016445 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.108 | Environmental | Open in IMG/M |
| 3300017933 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - Control_1 | Environmental | Open in IMG/M |
| 3300017975 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0715_SJ02_MP15_20_MG | Environmental | Open in IMG/M |
| 3300018034 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_11_10 | Environmental | Open in IMG/M |
| 3300018476 | Populus adjacent soil microbial communities from riparian zone of Yellowstone River, Montana, USA - 531 T | Environmental | Open in IMG/M |
| 3300020068 | Metatranscriptome of groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM4_65 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300020199 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_08_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300020579 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-27-M | Environmental | Open in IMG/M |
| 3300020580 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-19-M | Environmental | Open in IMG/M |
| 3300020583 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-32-M | Environmental | Open in IMG/M |
| 3300021138 | Freshwater microbial communities from Trout Bog Lake, WI - Practice 03JUN2009 epilimnion | Environmental | Open in IMG/M |
| 3300021170 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-26-M | Environmental | Open in IMG/M |
| 3300021171 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-11-M | Environmental | Open in IMG/M |
| 3300021181 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-19-O | Environmental | Open in IMG/M |
| 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Host-Associated | Open in IMG/M |
| 3300021405 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-7-O | Environmental | Open in IMG/M |
| 3300021420 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-12-M | Environmental | Open in IMG/M |
| 3300022726 | Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-C-30-M (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300024288 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_08_16fungal | Environmental | Open in IMG/M |
| 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026325 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_107 (SPAdes) | Environmental | Open in IMG/M |
| 3300026332 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_138 (SPAdes) | Environmental | Open in IMG/M |
| 3300026498 | Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - NI-49-A | Environmental | Open in IMG/M |
| 3300027512 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027737 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP03_OM3 (SPAdes) | Environmental | Open in IMG/M |
| 3300027882 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con1.8 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027911 | Freshwater sediment microbial communities from Pennsylvania, USA - Little Laurel Run_MetaG_LLR_2012 (SPAdes) | Environmental | Open in IMG/M |
| 3300028906 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 5 (v2) | Environmental | Open in IMG/M |
| 3300029945 | I_Bog_N2 coassembly | Environmental | Open in IMG/M |
| 3300030225 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Bog_N1_3 | Environmental | Open in IMG/M |
| 3300030943 | III_Fen_N2 coassembly | Environmental | Open in IMG/M |
| 3300031234 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Palsa_T0_2 | Environmental | Open in IMG/M |
| 3300031446 | Fir Summer Coassembly Site 11 - Champenoux / Amance forest | Environmental | Open in IMG/M |
| 3300031543 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f20 | Environmental | Open in IMG/M |
| 3300031544 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.117b4f26 | Environmental | Open in IMG/M |
| 3300031561 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.052b4f26 | Environmental | Open in IMG/M |
| 3300031708 | FICUS49499 Metagenome Czech Republic combined assembly | Environmental | Open in IMG/M |
| 3300031736 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.174b1f21 | Environmental | Open in IMG/M |
| 3300031744 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.00H (v2) | Environmental | Open in IMG/M |
| 3300031753 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM2C_515 | Environmental | Open in IMG/M |
| 3300031754 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM1C_515 | Environmental | Open in IMG/M |
| 3300031792 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.053b4f23 | Environmental | Open in IMG/M |
| 3300031796 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f24 | Environmental | Open in IMG/M |
| 3300031845 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.171b2f18 | Environmental | Open in IMG/M |
| 3300031880 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.168b4f25 | Environmental | Open in IMG/M |
| 3300031897 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f16 | Environmental | Open in IMG/M |
| 3300031918 | III_Fen_N3 coassembly | Environmental | Open in IMG/M |
| 3300031946 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.HF172 | Environmental | Open in IMG/M |
| 3300031947 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.T000H | Environmental | Open in IMG/M |
| 3300031954 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.178 (v2) | Environmental | Open in IMG/M |
| 3300032001 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.082 (v2) | Environmental | Open in IMG/M |
| 3300032009 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.066b5f19 | Environmental | Open in IMG/M |
| 3300032035 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.HF170 | Environmental | Open in IMG/M |
| 3300032041 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f22 | Environmental | Open in IMG/M |
| 3300032059 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.053b4f27 | Environmental | Open in IMG/M |
| 3300032076 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.111 (v2) | Environmental | Open in IMG/M |
| 3300032090 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f22 | Environmental | Open in IMG/M |
| 3300032091 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f25 | Environmental | Open in IMG/M |
| 3300032898 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_2.1 | Environmental | Open in IMG/M |
| 3300032954 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.2 | Environmental | Open in IMG/M |
| 3300033134 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_2.2 | Environmental | Open in IMG/M |
| 3300033158 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.1 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| C688J18823_110446032 | 3300001686 | Soil | GWRVTIVPPVDEGEGPRLAPTEQLLNAVRPYVRPA* |
| Ga0066690_109422161 | 3300005177 | Soil | PEAQASLTKLRRWGVAIVPPVDEGEGPRLAPSTVLIDAVRHYVRRG* |
| Ga0066388_1044813891 | 3300005332 | Tropical Forest Soil | SLKTLPSWGVTVIPPVDEGEGPRLAPSAVLLDAVRPFVRRG* |
| Ga0070713_1010502643 | 3300005436 | Corn, Switchgrass And Miscanthus Rhizosphere | ARASLRKLPTWGVTIVPPVDEGEGPRLAPSELLINAVRPHVRQS* |
| Ga0066704_108077881 | 3300005557 | Soil | RLPEWGVRIVPPVDEGEGPRLAPTATLLDAVRPFVQHS* |
| Ga0066699_104166942 | 3300005561 | Soil | QVSLRKLPAWHVTVVPPVDEGEGPRLAPSELLLDAVRPYVRRG* |
| Ga0066903_1012884692 | 3300005764 | Tropical Forest Soil | LKKLPTWGVTIVPPVDEGEGPRLAPTAMLIDAVRPYVRRG* |
| Ga0066903_1084801512 | 3300005764 | Tropical Forest Soil | LLPRWGVVIVPPVDEGEGPRLAPTEALLAAVRPYMKRR* |
| Ga0075029_1012745861 | 3300006052 | Watersheds | HVTVVPPVDEGEGPRLAPTAQLLDAAGQYIRRGS* |
| Ga0070712_1004843611 | 3300006175 | Corn, Switchgrass And Miscanthus Rhizosphere | KLPGWGVRIVPPVDAGDGPRLAPTKVLLDAVRRYAHRS* |
| Ga0070765_1013301691 | 3300006176 | Soil | KKLPAWGVAIVPPVDEGEGPRLAPSAVLVEAVRPYVRRG* |
| Ga0070765_1013734001 | 3300006176 | Soil | GSLRRLPNWGVTIVPPVDDGAGPRLAPTQQLMDAVRPFVRRP* |
| Ga0073928_105923691 | 3300006893 | Iron-Sulfur Acid Spring | TWGVTIVPQVNQGEGPRLAPSAQLLDAVRPYARRS* |
| Ga0099794_104662501 | 3300007265 | Vadose Zone Soil | QASLKQLTSWGVTIVPPVDEGEGPRLAPTGVLIDAVRPYVRRD* |
| Ga0066710_1011932553 | 3300009012 | Grasslands Soil | LLGWGVRIVPPVDEGEGPRLASTAVLLDAVRLYVRRG |
| Ga0066710_1046714862 | 3300009012 | Grasslands Soil | QAQASLKTLPKWGVTIVPQIDAGEGPRLAPTETLLVALRPHVKRG |
| Ga0099829_103155181 | 3300009038 | Vadose Zone Soil | LPTWHVTIVPPVDEGEGPRLAPSAQLLDAVRPYVRRG* |
| Ga0099792_111496821 | 3300009143 | Vadose Zone Soil | SWGVTIVAPVDDGEGPRLAPSVVLLDAVRRFVRRG* |
| Ga0105857_10849811 | 3300009650 | Permafrost Soil | AAWGVAIVPPADEAEGPRLAASARLLDAVRPYASKQK* |
| Ga0123355_104419151 | 3300009826 | Termite Gut | SLRALPGWGVTIVPPVDAGEGPRLAPTKQLLNAVRPYVRTR* |
| Ga0126381_1018193011 | 3300010376 | Tropical Forest Soil | AEWGVHLVPPVDAGEGPRLAPTTALLDAVRPHVRSGG* |
| Ga0126381_1032189511 | 3300010376 | Tropical Forest Soil | WGVTIVPPVDEGEGPRLARSALLLDVVRRHVRLG* |
| Ga0136449_1033280551 | 3300010379 | Peatlands Soil | QVSLRTLQAWQVMIVPPVDDGEGPRLAPSAQLLDAVRPYVVQS* |
| Ga0136449_1039918021 | 3300010379 | Peatlands Soil | LRTLPGWGVTVVPPVDEGEGPRLAPTAQVLDAVRPFVRRG* |
| Ga0137389_101150117 | 3300012096 | Vadose Zone Soil | LSWGVRIVPPVDEGEGPRLAPSAQLLDAVRPYVRRG* |
| Ga0137382_113434281 | 3300012200 | Vadose Zone Soil | SWGVTIVPPVDEGEGPRLAPTGVLIDAVRPYVRRG* |
| Ga0137362_102746301 | 3300012205 | Vadose Zone Soil | LPVWGVIIVPPVDEGEGPRLAPTAVLIDAVRPYVR |
| Ga0137378_101409191 | 3300012210 | Vadose Zone Soil | KLPTWGVTIVPPVDDGDGPRLAASAVLVDAVRPYVRRG* |
| Ga0137360_114652702 | 3300012361 | Vadose Zone Soil | PEAQTSLERLPRWGVTIVPPVDEGEGPRLAPTAQLLDAVRPYTRRR* |
| Ga0137361_102178461 | 3300012362 | Vadose Zone Soil | LPVWGVIIVPPVDEGEGPRLAPTAVLIDAVRPYVRRR |
| Ga0137396_100839861 | 3300012918 | Vadose Zone Soil | TLPGWGVIIVPPVDEGEGPRLAPTAALIDTVRPYVRRR* |
| Ga0137359_102258541 | 3300012923 | Vadose Zone Soil | QASLRTLPTWGVTIVPPIYEGEGPRLAPTAVLIDAVRPYVRG* |
| Ga0137359_117361552 | 3300012923 | Vadose Zone Soil | ASLKKLPEWGVIMVPPVDEGEGPRLAPTAALIDAVRPYVRRG* |
| Ga0137416_117045462 | 3300012927 | Vadose Zone Soil | SLRRLPEWGVRIVPPVDEGEGPRLAPTATLLDAVRPFVQHS* |
| Ga0137410_115620531 | 3300012944 | Vadose Zone Soil | SWGVTIVAPVDDGEGPRLAPSAVLLDAVRPYVRRG* |
| Ga0126375_114973721 | 3300012948 | Tropical Forest Soil | EKLSRWGVVIVGPVDDGEGPRLAPTAALLDAVRLYVR* |
| Ga0181528_101953342 | 3300014167 | Bog | RTLPAWGVTIVPPVDLGDGPRLAPTEALLDAARPFVRAQG* |
| Ga0182030_113501691 | 3300014838 | Bog | SLRTLSNWKVTIVPPVDAGEGPRLAPTTKLLDAARPHVRRA* |
| Ga0137420_14988444 | 3300015054 | Vadose Zone Soil | LPGWGIRIVPQVDQGEGPRLAPTEALLDAVRPYVRRG* |
| Ga0182036_101473892 | 3300016270 | Soil | VAQASLKTLPSWGVVIVPPVDEGEGPRLAPSAMLLDAVRPFVDRA |
| Ga0182033_101129973 | 3300016319 | Soil | ERLPSWGVTIVPPVDEGEGPRLAPTAVLIDAVRPYVRRS |
| Ga0182033_118182341 | 3300016319 | Soil | TLPSWGATIVPPVDDGEGPRLAPTGVLLGAVRPHAGRG |
| Ga0182032_106837572 | 3300016357 | Soil | SWGATIVPPVDDGEGPRLAPTGVLLGAVRPPAGRG |
| Ga0182039_122748912 | 3300016422 | Soil | LPTWGVTIIPPVDEGEGPRLAPTAVLVDAVRPYVRRG |
| Ga0182038_100367135 | 3300016445 | Soil | ERLPSWGVTIVPPVDEDEGPRLAPTAVLVDAVRPYVRHS |
| Ga0187801_104319991 | 3300017933 | Freshwater Sediment | LPAWGVTIVPPVDEGEGPRLAATATLLDAVRPYVRRG |
| Ga0187782_105763992 | 3300017975 | Tropical Peatland | LPQWGVTIVPPVDFGEGPRLAPTEDLLASLRPYVRLQKTAAIG |
| Ga0187863_102252841 | 3300018034 | Peatland | VAQASLKRLPTWNVIVVPPVDDGEGPRLAPNERLLDAVRPFVRHG |
| Ga0190274_118678182 | 3300018476 | Soil | WGVTIVPPVDEGQGPRLAPTEALLTEVRPHLRRQPGVPS |
| Ga0184649_10641881 | 3300020068 | Groundwater Sediment | LQRLPNWGVTIVPPVDEGEGPRLAPTDQLIDAVRPYVAGR |
| Ga0179592_104575492 | 3300020199 | Vadose Zone Soil | QGSLRKLPGWGIRIVPQVDQGEGPRLAPTEALLDAVRPYVRRG |
| Ga0210407_107422481 | 3300020579 | Soil | AQASLKTLPSWGVVIVPPVDEGEGPRLAPSAVLLDVVRPFVRRG |
| Ga0210403_101293883 | 3300020580 | Soil | PPEARASLKKLRAWGVTIVAPVDEGEGPRLAPSAVLVDAARPHVRRG |
| Ga0210401_106146901 | 3300020583 | Soil | KLPAWGVAIVPPVDEGEGPRLAPSAVLVEAVRPYVRRG |
| Ga0214164_10353811 | 3300021138 | Freshwater | SLATLASWGVVVVPQVNAGDGPRLAPAEHLLDAVRPFAG |
| Ga0210400_101807541 | 3300021170 | Soil | ASLRLLPEWGVTIVPPVDEGEGPRLAPSALLLDAVRPYARR |
| Ga0210405_101731443 | 3300021171 | Soil | LNRLPAWGVTIVPPVDEGEGPRLAPSAVLVDAVRPYVRR |
| Ga0210388_111429231 | 3300021181 | Soil | NRLPAWGVTIVPPVDEGEGPRLAPSAVLVDAVRPYVRR |
| Ga0213876_104898301 | 3300021384 | Plant Roots | PVAQASLKKLPEWGVAIVPPVDAGEGPRLAPTDQLMDAVRPYVLRR |
| Ga0210387_101729481 | 3300021405 | Soil | LPAWGVTIVPPVDEGEGPRLAPSAVLVDAVRPYVRR |
| Ga0210394_105655681 | 3300021420 | Soil | SLIKLPGWGVTIVPPVDVGDGPRLAPTAALIDAVRPHVRRG |
| Ga0242654_103123581 | 3300022726 | Soil | PEWGVTIVPPVDEGEGPRLAPTAALIDAVRPHATRG |
| Ga0179589_105790231 | 3300024288 | Vadose Zone Soil | EAQASLRKLPTWGVIIVPPVDEGEGPRLAPSELLMHAVRPYVRRG |
| Ga0207700_108020311 | 3300025928 | Corn, Switchgrass And Miscanthus Rhizosphere | LRLLPKWGVTIVPPVDEGEGPRLAPSALLLDAVRPYARR |
| Ga0207704_116940192 | 3300025938 | Miscanthus Rhizosphere | RTLPEWGIVIVPPVDLGEGPRLAPTDTLLAAVRPYVRCA |
| Ga0209152_100366283 | 3300026325 | Soil | LRRLPEWGVRIVPPVDEGEGPRLAPTATLLDAVRPFVQHS |
| Ga0209803_11631752 | 3300026332 | Soil | KKFPERGVIIVPPVDAGEGPRLAPTAVLIDAVRPYAPK |
| Ga0257156_10966852 | 3300026498 | Soil | ARASLNRLPAWGVTIVPPVDEGEGPRLAPSAALVDAVRPYVRR |
| Ga0209179_10163233 | 3300027512 | Vadose Zone Soil | LHSWGVTIVAPVDDGEGPRLAPSAVLLDAVRPYVRRG |
| Ga0209038_101425151 | 3300027737 | Bog Forest Soil | AQASLKTLPSWGVAIVPPVDEGEGPRLAPSTVLLDAVRPYVRRG |
| Ga0209590_103604511 | 3300027882 | Vadose Zone Soil | AQASLKKLPSWGVTIVPPVDEGEGPRLAPTGVLIDAVRPHVRRGR |
| Ga0209698_101131893 | 3300027911 | Watersheds | LRTLPEWGVTVVPPVEDGSGPRLAPDEQLLTAVRLYVA |
| Ga0308309_113725851 | 3300028906 | Soil | KKLPAWGVAIVPPVDEGEGPRLAPSAVLVEAVRPYVRRG |
| Ga0311330_112066451 | 3300029945 | Bog | TLPGWGVIVVPPIDDGNGPRLAPTAALLDAVRPYVSRG |
| Ga0302196_104231771 | 3300030225 | Bog | DSLRTLPTWGVTIVPPVDDGGGPRLAPTERLLDAVRRFARKD |
| Ga0311366_106065351 | 3300030943 | Fen | LASWGVIIVPPADDGAGPRLAPTARLLDAVRPFVRRG |
| Ga0302325_111315002 | 3300031234 | Palsa | SLKILPSWGVTIVPPVDTGEGPRLAPSELLLDAVRPYVRR |
| Ga0170820_131608031 | 3300031446 | Forest Soil | ASLNRLPAWGVTIVPPADEGEGPRLAPSAALVDAVRPYVRR |
| Ga0318516_102988651 | 3300031543 | Soil | SLGKLPGWGVTIVPPVDEGEGPRLAPSAALLDAVRPYVRRG |
| Ga0318516_104794141 | 3300031543 | Soil | LAQASLKTLPSWGVTMVPPVDDGEGPRLAPTATLLAAVRPYLRRG |
| Ga0318534_102679942 | 3300031544 | Soil | GAGVAPILPQWGVTIVSPVDDGDGPRLAPTAALLDAVRPYVRRG |
| Ga0318528_103607912 | 3300031561 | Soil | LERLPSWGVTIVPPVDEGEGPRLAPTAVLIDAVRPYVRRS |
| Ga0310686_1014759122 | 3300031708 | Soil | LAEWGVTMVPPIDDGNGPRLAPTAQLLDAVRPYVRRADATTA |
| Ga0318501_106480561 | 3300031736 | Soil | SWGVTILPPVDDGEGPRLARTATLLAAVRPYLRRG |
| Ga0306918_106993251 | 3300031744 | Soil | PTWGVTIVPPVDEGEGPRLAPSAVLVDAVRLHVRRG |
| Ga0307477_104319373 | 3300031753 | Hardwood Forest Soil | AQASLKKLPAWGVAIVAPVDEGEGPRLAPSAVLVEAVRPYVRRG |
| Ga0307477_107286793 | 3300031753 | Hardwood Forest Soil | RASLKKLPTWGVTIVPPVDEGEGPRLAPSAALLDAVRPYVRRG |
| Ga0307475_115017701 | 3300031754 | Hardwood Forest Soil | KLPTWGVTIVPPVDEGEGPRLAPSELLIDAVRPHVPRR |
| Ga0318529_103387021 | 3300031792 | Soil | LKRLPTWGVTIVPPVEEGEGPRLAPSAVLVDAVRLHVRRG |
| Ga0318576_100624931 | 3300031796 | Soil | ASLDRLPSWGVTIIPPVDEGEGPRLAPTAVLVDAVRPYVRHS |
| Ga0318511_103788202 | 3300031845 | Soil | AQASLKRLPTWGVTIIPPVDEGEGPRLAPTAVLVDAVRPYVRRG |
| Ga0318544_104276522 | 3300031880 | Soil | TWGVTIVPPVDEGEGPRLAPSAALLDAVRPYVRRG |
| Ga0318520_106976162 | 3300031897 | Soil | PQAQASLRLLPQWGVTIVPPVDEGEGPRLAPSGLLIDAVRPYVRRG |
| Ga0311367_123567731 | 3300031918 | Fen | LASWNVTIVPPLDDGQGPRLAPTAQLLAAVRPHVRPG |
| Ga0310910_100521991 | 3300031946 | Soil | RASLKRLPTWGVTIVPPVDEGEGPRLAPSAVLVDAVRLHVRRG |
| Ga0310909_107497472 | 3300031947 | Soil | LKKLRNWGVIIVPPVDEGEGPRLAPSAVLIDAVRPYVRPS |
| Ga0306926_100563517 | 3300031954 | Soil | SLARLPGWGVRIVQPIDEGEGPGLAPTAVLLDAVRSYVRRD |
| Ga0306926_115634581 | 3300031954 | Soil | NHPEAQTSLKKLRNWGVIIVPPVDEGEGPRLAPSAVLIDAVRTYVRPS |
| Ga0306926_116964722 | 3300031954 | Soil | PEAQASLKRLPSWGVTIVPPVDEGAGPRLAPTASLLEAARPYVRGS |
| Ga0306922_124122181 | 3300032001 | Soil | KLGRWGVAIVPPVDLGEGPRLAPSAALFEPVRIHLRRG |
| Ga0318563_106284771 | 3300032009 | Soil | PAARASLATLAEWGVHLVPPVDAGEGPRLAPTTALLDAVRPHVRSGG |
| Ga0310911_100024551 | 3300032035 | Soil | QWGVTIVPPVDEGEGPRLAPSAALLDAVRPYVRRG |
| Ga0310911_106124881 | 3300032035 | Soil | AQASLKTLPSWGVTMVPPVDDGEGPRLAPTATLLAAVRPYLRRG |
| Ga0318549_100740011 | 3300032041 | Soil | SWGVTIVPPVDEDEGPRLAPTAVLVDAVRPYVRHS |
| Ga0318533_108365261 | 3300032059 | Soil | PEAQTSLKKLRNWGVIIVPPVDEGEGPRLAPSAVLIDAVRPYVRPS |
| Ga0318533_109534751 | 3300032059 | Soil | SLEKLPAWGVTIVPPVDEGQGPRLAPTDMLVNAVRPHVRRG |
| Ga0318533_111746792 | 3300032059 | Soil | DKLGRWGVAIVPPVDLGEGPRLAPSAALFEPVRIHLRRG |
| Ga0306924_102072143 | 3300032076 | Soil | AQASLKKLPSWGVTVIPPVDEGEGPRLAPSAMLLDAVRPFVDRG |
| Ga0306924_109905431 | 3300032076 | Soil | EAQSSLKRLPIWGVTIVPPVDDGEGPRLAPSALLIDAVRPYARRG |
| Ga0318518_102676052 | 3300032090 | Soil | PTWGVTIVPPVDTGEGPRLAPSSQLLKAVRPYVRP |
| Ga0318577_101740152 | 3300032091 | Soil | AQASLKRLPSWGVTIVPPVDEGAGPRLAPTAALLEAARPYVRGS |
| Ga0335072_109189951 | 3300032898 | Soil | WGVRIIPPVDTGEGPRLAPTAQLLDAVRPFLRRAADGGAP |
| Ga0335083_105648002 | 3300032954 | Soil | RWGVRVVPPVDDGGGPRLAPTEALMDAVRPFVQAG |
| Ga0335073_106669162 | 3300033134 | Soil | MARASLRTLPTWNVTIIPPVDEGDGPRLAPTVSLLDAVRPFVKQG |
| Ga0335077_113850941 | 3300033158 | Soil | QAQASLRRLPEWGVTIVPPVDEGDGPRLAPTEQLLAAVRPYARR |
| ⦗Top⦘ |