


| Basic Information | |
|---|---|
| Family ID | F080313 |
| Family Type | Metagenome |
| Number of Sequences | 115 |
| Average Sequence Length | 44 residues |
| Representative Sequence | MAERPVIVIVDDEPDALAAMLDALTRRFGGDYRVVPHLSARA |
| Number of Associated Samples | 95 |
| Number of Associated Scaffolds | 115 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | No |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 98.26 % |
| % of genes near scaffold ends (potentially truncated) | 100.00 % |
| % of genes from short scaffolds (< 2000 bps) | 93.04 % |
| Associated GOLD sequencing projects | 90 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.61 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (63.478 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil (22.609 % of family members) |
| Environment Ontology (ENVO) | Unclassified (35.652 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Unclassified (31.304 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 21.43% β-sheet: 17.14% Coil/Unstructured: 61.43% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.61 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 115 Family Scaffolds |
|---|---|---|
| PF14499 | DUF4437 | 3.48 |
| PF00970 | FAD_binding_6 | 2.61 |
| PF12852 | Cupin_6 | 2.61 |
| PF07883 | Cupin_2 | 2.61 |
| PF05694 | SBP56 | 1.74 |
| PF08241 | Methyltransf_11 | 1.74 |
| PF07730 | HisKA_3 | 1.74 |
| PF03928 | HbpS-like | 1.74 |
| PF00873 | ACR_tran | 0.87 |
| PF05524 | PEP-utilisers_N | 0.87 |
| PF03795 | YCII | 0.87 |
| PF00571 | CBS | 0.87 |
| PF12536 | DUF3734 | 0.87 |
| PF11295 | DUF3096 | 0.87 |
| PF03992 | ABM | 0.87 |
| PF01565 | FAD_binding_4 | 0.87 |
| PF00691 | OmpA | 0.87 |
| PF13649 | Methyltransf_25 | 0.87 |
| PF10017 | Methyltransf_33 | 0.87 |
| PF00069 | Pkinase | 0.87 |
| PF04073 | tRNA_edit | 0.87 |
| PF03466 | LysR_substrate | 0.87 |
| COG ID | Name | Functional Category | % Frequency in 115 Family Scaffolds |
|---|---|---|---|
| COG0515 | Serine/threonine protein kinase | Signal transduction mechanisms [T] | 3.48 |
| COG3850 | Signal transduction histidine kinase NarQ, nitrate/nitrite-specific | Signal transduction mechanisms [T] | 1.74 |
| COG3851 | Signal transduction histidine kinase UhpB, glucose-6-phosphate specific | Signal transduction mechanisms [T] | 1.74 |
| COG4564 | Signal transduction histidine kinase | Signal transduction mechanisms [T] | 1.74 |
| COG4585 | Signal transduction histidine kinase ComP | Signal transduction mechanisms [T] | 1.74 |
| COG2350 | YciI superfamily enzyme, includes 5-CHQ dehydrochlorinase, contains active-site pHis | Secondary metabolites biosynthesis, transport and catabolism [Q] | 0.87 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 63.48 % |
| Unclassified | root | N/A | 36.52 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300000793|AF_2010_repII_A001DRAFT_10114522 | Not Available | 565 | Open in IMG/M |
| 3300000956|JGI10216J12902_122638814 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 2479 | Open in IMG/M |
| 3300002498|TOLCLC_10257908 | All Organisms → cellular organisms → Bacteria | 670 | Open in IMG/M |
| 3300003541|JGI20214J51650_10133423 | All Organisms → cellular organisms → Bacteria | 1701 | Open in IMG/M |
| 3300005093|Ga0062594_101697000 | All Organisms → cellular organisms → Bacteria | 660 | Open in IMG/M |
| 3300005337|Ga0070682_100259810 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1256 | Open in IMG/M |
| 3300005338|Ga0068868_101394004 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Phyllobacteriaceae → Oricola → Oricola cellulosilytica | 653 | Open in IMG/M |
| 3300005338|Ga0068868_101671243 | All Organisms → cellular organisms → Bacteria | 599 | Open in IMG/M |
| 3300005344|Ga0070661_100453217 | All Organisms → cellular organisms → Bacteria | 1021 | Open in IMG/M |
| 3300005436|Ga0070713_100347852 | All Organisms → cellular organisms → Bacteria | 1375 | Open in IMG/M |
| 3300005439|Ga0070711_101353721 | All Organisms → cellular organisms → Bacteria | 619 | Open in IMG/M |
| 3300005530|Ga0070679_100917146 | Not Available | 820 | Open in IMG/M |
| 3300005545|Ga0070695_101681013 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp. AUGA SZCCT0177 | 531 | Open in IMG/M |
| 3300005617|Ga0068859_102195952 | All Organisms → cellular organisms → Bacteria | 609 | Open in IMG/M |
| 3300005764|Ga0066903_108991574 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micrococcales → Intrasporangiaceae → Terracoccus → unclassified Terracoccus → Terracoccus sp. 273MFTsu3.1 | 506 | Open in IMG/M |
| 3300005842|Ga0068858_101938067 | Not Available | 582 | Open in IMG/M |
| 3300006059|Ga0075017_100931853 | Not Available | 675 | Open in IMG/M |
| 3300006086|Ga0075019_11043363 | All Organisms → cellular organisms → Bacteria | 529 | Open in IMG/M |
| 3300006175|Ga0070712_100553311 | All Organisms → cellular organisms → Bacteria | 970 | Open in IMG/M |
| 3300006224|Ga0079037_100214646 | All Organisms → cellular organisms → Bacteria | 1737 | Open in IMG/M |
| 3300006224|Ga0079037_102627085 | Not Available | 501 | Open in IMG/M |
| 3300006914|Ga0075436_101524262 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptomycetales → Streptomycetaceae → Streptomyces → Streptomyces griseus group → Streptomyces microflavus subgroup → Streptomyces microflavus | 508 | Open in IMG/M |
| 3300006930|Ga0079303_10158576 | All Organisms → cellular organisms → Bacteria | 888 | Open in IMG/M |
| 3300006930|Ga0079303_10339155 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → Solirubrobacteraceae → Solirubrobacter → unclassified Solirubrobacter → Solirubrobacter sp. URHD0082 | 627 | Open in IMG/M |
| 3300009053|Ga0105095_10211358 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1063 | Open in IMG/M |
| 3300009053|Ga0105095_10414149 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 744 | Open in IMG/M |
| 3300009087|Ga0105107_10750720 | Not Available | 679 | Open in IMG/M |
| 3300009091|Ga0102851_12103957 | Not Available | 641 | Open in IMG/M |
| 3300009111|Ga0115026_11930048 | Not Available | 503 | Open in IMG/M |
| 3300009131|Ga0115027_10732652 | Not Available | 746 | Open in IMG/M |
| 3300009148|Ga0105243_12534574 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp. AUGA SZCCT0177 | 552 | Open in IMG/M |
| 3300009167|Ga0113563_12177389 | Not Available | 665 | Open in IMG/M |
| 3300009167|Ga0113563_13486155 | Not Available | 532 | Open in IMG/M |
| 3300009171|Ga0105101_10601802 | All Organisms → cellular organisms → Bacteria → FCB group → candidate division Zixibacteria → unclassified candidate division Zixibacteria → candidate division Zixibacteria bacterium RBG_16_53_22 | 546 | Open in IMG/M |
| 3300009176|Ga0105242_13098562 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp. 153 | 515 | Open in IMG/M |
| 3300009509|Ga0123573_11489057 | Not Available | 630 | Open in IMG/M |
| 3300010044|Ga0126310_10804758 | Not Available | 723 | Open in IMG/M |
| 3300010358|Ga0126370_11943722 | Not Available | 573 | Open in IMG/M |
| 3300010366|Ga0126379_13421487 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 531 | Open in IMG/M |
| 3300010376|Ga0126381_104630913 | Not Available | 530 | Open in IMG/M |
| 3300010398|Ga0126383_10307385 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp. | 1587 | Open in IMG/M |
| 3300011413|Ga0137333_1086100 | All Organisms → cellular organisms → Bacteria → FCB group → candidate division Zixibacteria → unclassified candidate division Zixibacteria → candidate division Zixibacteria bacterium RBG_16_53_22 | 725 | Open in IMG/M |
| 3300012174|Ga0137338_1073226 | All Organisms → cellular organisms → Bacteria → FCB group → candidate division Zixibacteria → unclassified candidate division Zixibacteria → candidate division Zixibacteria bacterium RBG_16_53_22 | 740 | Open in IMG/M |
| 3300012971|Ga0126369_10590872 | Not Available | 1179 | Open in IMG/M |
| 3300012988|Ga0164306_11979783 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 507 | Open in IMG/M |
| 3300013297|Ga0157378_11612668 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 695 | Open in IMG/M |
| 3300014266|Ga0075359_1147580 | Not Available | 525 | Open in IMG/M |
| 3300014867|Ga0180076_1065541 | Not Available | 664 | Open in IMG/M |
| 3300014884|Ga0180104_1146204 | Not Available | 695 | Open in IMG/M |
| 3300015372|Ga0132256_101586303 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 765 | Open in IMG/M |
| 3300016319|Ga0182033_10811283 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 825 | Open in IMG/M |
| 3300016357|Ga0182032_11394840 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 606 | Open in IMG/M |
| 3300016422|Ga0182039_12271432 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp. 153 | 501 | Open in IMG/M |
| 3300017974|Ga0187777_10080376 | Not Available | 2124 | Open in IMG/M |
| 3300018058|Ga0187766_10014484 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 4500 | Open in IMG/M |
| 3300018060|Ga0187765_10106642 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodobacterales | 1533 | Open in IMG/M |
| 3300018064|Ga0187773_10202735 | All Organisms → cellular organisms → Bacteria | 1057 | Open in IMG/M |
| 3300018090|Ga0187770_10891393 | All Organisms → cellular organisms → Bacteria | 714 | Open in IMG/M |
| 3300021081|Ga0210379_10081948 | All Organisms → cellular organisms → Bacteria | 1326 | Open in IMG/M |
| 3300021168|Ga0210406_10907186 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 662 | Open in IMG/M |
| 3300021171|Ga0210405_10819663 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 712 | Open in IMG/M |
| 3300021405|Ga0210387_11448774 | All Organisms → cellular organisms → Bacteria | 589 | Open in IMG/M |
| 3300021433|Ga0210391_11538044 | Not Available | 510 | Open in IMG/M |
| 3300025550|Ga0210098_1098655 | Not Available | 504 | Open in IMG/M |
| 3300026349|Ga0256811_1025687 | All Organisms → cellular organisms → Bacteria → FCB group → candidate division Zixibacteria → unclassified candidate division Zixibacteria → candidate division Zixibacteria bacterium RBG_16_53_22 | 614 | Open in IMG/M |
| 3300027726|Ga0209285_10059979 | All Organisms → cellular organisms → Bacteria → FCB group → candidate division Zixibacteria → unclassified candidate division Zixibacteria → candidate division Zixibacteria bacterium RBG_16_53_22 | 1134 | Open in IMG/M |
| 3300027871|Ga0209397_10001764 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Nitrosomonadales → Thiobacillaceae → Thiobacillus → Thiobacillus thioparus | 3982 | Open in IMG/M |
| 3300027875|Ga0209283_10074142 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 2196 | Open in IMG/M |
| 3300027877|Ga0209293_10557339 | Not Available | 604 | Open in IMG/M |
| 3300027877|Ga0209293_10757181 | Not Available | 515 | Open in IMG/M |
| 3300027890|Ga0209496_10255782 | Not Available | 860 | Open in IMG/M |
| 3300027890|Ga0209496_10613623 | Not Available | 589 | Open in IMG/M |
| 3300027894|Ga0209068_10887211 | Not Available | 527 | Open in IMG/M |
| 3300027899|Ga0209668_10072115 | All Organisms → cellular organisms → Bacteria | 1932 | Open in IMG/M |
| 3300027972|Ga0209079_10239764 | All Organisms → cellular organisms → Bacteria → FCB group → candidate division Zixibacteria → unclassified candidate division Zixibacteria → candidate division Zixibacteria bacterium RBG_16_53_22 | 618 | Open in IMG/M |
| 3300031564|Ga0318573_10614786 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → Cystobacterineae | 585 | Open in IMG/M |
| 3300031719|Ga0306917_10846873 | All Organisms → cellular organisms → Bacteria | 716 | Open in IMG/M |
| 3300031820|Ga0307473_10999479 | Not Available | 611 | Open in IMG/M |
| 3300031833|Ga0310917_10400008 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 934 | Open in IMG/M |
| 3300031912|Ga0306921_11587675 | Not Available | 712 | Open in IMG/M |
| 3300031941|Ga0310912_11001181 | All Organisms → cellular organisms → Bacteria | 641 | Open in IMG/M |
| 3300031949|Ga0214473_12292831 | Not Available | 517 | Open in IMG/M |
| 3300032059|Ga0318533_11270025 | Not Available | 538 | Open in IMG/M |
| 3300032076|Ga0306924_12557324 | Not Available | 511 | Open in IMG/M |
| 3300032090|Ga0318518_10553766 | Not Available | 588 | Open in IMG/M |
| 3300032144|Ga0315910_11534875 | Not Available | 519 | Open in IMG/M |
| 3300032261|Ga0306920_101578600 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 934 | Open in IMG/M |
| 3300032805|Ga0335078_11443410 | All Organisms → cellular organisms → Bacteria | 774 | Open in IMG/M |
| 3300032828|Ga0335080_11198756 | All Organisms → cellular organisms → Bacteria | 763 | Open in IMG/M |
| 3300032893|Ga0335069_10740648 | All Organisms → cellular organisms → Bacteria | 1113 | Open in IMG/M |
| 3300033289|Ga0310914_10909051 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 780 | Open in IMG/M |
| 3300033289|Ga0310914_11556639 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 565 | Open in IMG/M |
| 3300033406|Ga0316604_10748468 | Not Available | 537 | Open in IMG/M |
| 3300033408|Ga0316605_10092711 | All Organisms → cellular organisms → Bacteria | 2305 | Open in IMG/M |
| 3300033408|Ga0316605_10191206 | All Organisms → cellular organisms → Bacteria → FCB group → candidate division Zixibacteria → unclassified candidate division Zixibacteria → candidate division Zixibacteria bacterium RBG_16_53_22 | 1711 | Open in IMG/M |
| 3300033408|Ga0316605_10784935 | All Organisms → cellular organisms → Bacteria → FCB group → candidate division Zixibacteria → unclassified candidate division Zixibacteria → candidate division Zixibacteria bacterium RBG_16_53_22 | 904 | Open in IMG/M |
| 3300033408|Ga0316605_11492827 | Not Available | 656 | Open in IMG/M |
| 3300033413|Ga0316603_10055844 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Nitrosomonadales → Thiobacillaceae → Thiobacillus → Thiobacillus thioparus | 2910 | Open in IMG/M |
| 3300033413|Ga0316603_10087551 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 2418 | Open in IMG/M |
| 3300033413|Ga0316603_11401625 | Not Available | 662 | Open in IMG/M |
| 3300033413|Ga0316603_12180864 | All Organisms → cellular organisms → Bacteria → FCB group → candidate division Zixibacteria → unclassified candidate division Zixibacteria → candidate division Zixibacteria bacterium RBG_16_53_22 | 523 | Open in IMG/M |
| 3300033414|Ga0316619_10140770 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Nitrosomonadales → Thiobacillaceae → Thiobacillus | 1638 | Open in IMG/M |
| 3300033414|Ga0316619_10527050 | All Organisms → cellular organisms → Bacteria → FCB group → candidate division Zixibacteria → unclassified candidate division Zixibacteria → candidate division Zixibacteria bacterium RBG_16_53_22 | 968 | Open in IMG/M |
| 3300033414|Ga0316619_10537070 | Not Available | 960 | Open in IMG/M |
| 3300033480|Ga0316620_10393669 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1249 | Open in IMG/M |
| 3300033481|Ga0316600_10751073 | All Organisms → cellular organisms → Bacteria | 686 | Open in IMG/M |
| 3300033482|Ga0316627_101134897 | Not Available | 768 | Open in IMG/M |
| 3300033482|Ga0316627_102251574 | Not Available | 570 | Open in IMG/M |
| 3300033483|Ga0316629_10323636 | All Organisms → cellular organisms → Bacteria → FCB group → candidate division Zixibacteria → unclassified candidate division Zixibacteria → candidate division Zixibacteria bacterium RBG_16_53_22 | 1053 | Open in IMG/M |
| 3300033485|Ga0316626_10788983 | All Organisms → cellular organisms → Bacteria → FCB group → candidate division Zixibacteria → unclassified candidate division Zixibacteria → candidate division Zixibacteria bacterium RBG_16_53_22 | 832 | Open in IMG/M |
| 3300033513|Ga0316628_101322312 | All Organisms → cellular organisms → Bacteria | 960 | Open in IMG/M |
| 3300033521|Ga0316616_100688674 | All Organisms → cellular organisms → Bacteria | 1221 | Open in IMG/M |
| 3300033521|Ga0316616_101127458 | Not Available | 990 | Open in IMG/M |
| 3300033521|Ga0316616_101538278 | All Organisms → cellular organisms → Bacteria | 864 | Open in IMG/M |
| 3300033521|Ga0316616_102095457 | Not Available | 751 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 22.61% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 9.57% |
| Wetland | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Wetland | 6.09% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 6.09% |
| Freshwater Sediment | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Freshwater Sediment | 5.22% |
| Freshwater Wetlands | Environmental → Aquatic → Freshwater → Wetlands → Unclassified → Freshwater Wetlands | 4.35% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 4.35% |
| Tropical Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland | 4.35% |
| Soil | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Soil | 3.48% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 3.48% |
| Watersheds | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds | 2.61% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 1.74% |
| Corn Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere | 1.74% |
| Deep Subsurface | Environmental → Terrestrial → Deep Subsurface → Unclassified → Unclassified → Deep Subsurface | 1.74% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 1.74% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere | 1.74% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 1.74% |
| Groundwater Sediment | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Groundwater Sediment | 0.87% |
| Freshwater Lake Sediment | Environmental → Aquatic → Freshwater → Lentic → Sediment → Freshwater Lake Sediment | 0.87% |
| Sediment | Environmental → Aquatic → Freshwater → Wetlands → Sediment → Sediment | 0.87% |
| Natural And Restored Wetlands | Environmental → Aquatic → Marine → Wetlands → Unclassified → Natural And Restored Wetlands | 0.87% |
| Wetland | Environmental → Aquatic → Marine → Wetlands → Sediment → Wetland | 0.87% |
| Mangrove Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Mangrove Sediment | 0.87% |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 0.87% |
| Serpentine Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Serpentine Soil | 0.87% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil | 0.87% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 0.87% |
| Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil | 0.87% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 0.87% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Uranium Contaminated → Soil | 0.87% |
| Natural And Restored Wetlands | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Natural And Restored Wetlands | 0.87% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 0.87% |
| Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 0.87% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 0.87% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere | 0.87% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Arabidopsis Rhizosphere | 0.87% |
| Hydrocarbon Resource Environments | Engineered → Wastewater → Industrial Wastewater → Petrochemical → Unclassified → Hydrocarbon Resource Environments | 0.87% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300000793 | Forest soil microbial communities from Amazon forest - 2010 replicate II A001 | Environmental | Open in IMG/M |
| 3300000956 | Soil microbial communities from Great Prairies - Kansas, Native Prairie soil | Environmental | Open in IMG/M |
| 3300002498 | Hydrocarbon resource environments microbial communities from Canada and USA - Toluene degrading community from Alberta, Canada | Engineered | Open in IMG/M |
| 3300003541 | Wetland sediment microbial communities from Twitchell Island in the Sacramento Delta, sample from surface sediment Aug2011 Site B2 Bulk | Environmental | Open in IMG/M |
| 3300005093 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of KBS All Blocks | Environmental | Open in IMG/M |
| 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Environmental | Open in IMG/M |
| 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Host-Associated | Open in IMG/M |
| 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Host-Associated | Open in IMG/M |
| 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Environmental | Open in IMG/M |
| 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Environmental | Open in IMG/M |
| 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Environmental | Open in IMG/M |
| 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Environmental | Open in IMG/M |
| 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Host-Associated | Open in IMG/M |
| 3300005764 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2) | Environmental | Open in IMG/M |
| 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Host-Associated | Open in IMG/M |
| 3300006059 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Alex Branch Run_MetaG_ABR_2012 | Environmental | Open in IMG/M |
| 3300006086 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Cold Stream Run_MetaG_CSR_2013 | Environmental | Open in IMG/M |
| 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Environmental | Open in IMG/M |
| 3300006224 | Freshwater wetland microbial communities from Ohio, USA, analyzing the effect of biotic and abiotic controls - Mud 3 Core 4 Depth 4 metaG | Environmental | Open in IMG/M |
| 3300006914 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Host-Associated | Open in IMG/M |
| 3300006930 | Deep subsurface shale carbon reservoir microbial communities from Ohio, USA - Methanogen_OWC | Environmental | Open in IMG/M |
| 3300009053 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P8 Core (3) Depth 19-21cm March2015 | Environmental | Open in IMG/M |
| 3300009087 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P8 Core (1) Depth 19-21cm September2015 | Environmental | Open in IMG/M |
| 3300009091 | Freshwater wetland microbial communities from Ohio, USA, analyzing the effect of biotic and abiotic controls - Mud 3 Core 4 Depth 3 metaG (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300009111 | Wetland microbial communities from Old Woman Creek Reserve in Ohio, USA - Mud_0915_D1 | Environmental | Open in IMG/M |
| 3300009131 | Wetland microbial communities from Old Woman Creek Reserve in Ohio, USA - Open_0915_D1 | Environmental | Open in IMG/M |
| 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Host-Associated | Open in IMG/M |
| 3300009167 | Freshwater wetland microbial communities from Ohio, USA, analyzing the effect of biotic and abiotic controls - Mud 3 Core 4 Depth 3 metaG - Illumina Assembly (version 2) | Environmental | Open in IMG/M |
| 3300009171 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P8 Core (1) Depth 19-21cm May2015 | Environmental | Open in IMG/M |
| 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Host-Associated | Open in IMG/M |
| 3300009509 | Mangrove sediment microbial communities from Mai Po Nature Reserve Marshes in Hong Kong, China - Maipo_11 | Environmental | Open in IMG/M |
| 3300010044 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot60 | Environmental | Open in IMG/M |
| 3300010358 | Tropical forest soil microbial communities from Panama - MetaG Plot_3 | Environmental | Open in IMG/M |
| 3300010366 | Tropical forest soil microbial communities from Panama - MetaG Plot_24 | Environmental | Open in IMG/M |
| 3300010376 | Tropical forest soil microbial communities from Panama - MetaG Plot_28 | Environmental | Open in IMG/M |
| 3300010398 | Tropical forest soil microbial communities from Panama - MetaG Plot_35 | Environmental | Open in IMG/M |
| 3300011413 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMLT231_2 | Environmental | Open in IMG/M |
| 3300012174 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMLT366_2 | Environmental | Open in IMG/M |
| 3300012971 | Tropical forest soil microbial communities from Panama - MetaG Plot_1 | Environmental | Open in IMG/M |
| 3300012988 | Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_242_MG | Environmental | Open in IMG/M |
| 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Host-Associated | Open in IMG/M |
| 3300014266 | Natural and restored wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - WestPond_TuleB_D1 | Environmental | Open in IMG/M |
| 3300014867 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River metaG ERMLT433_16_10D | Environmental | Open in IMG/M |
| 3300014884 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River metaG ERMLT730_16_1Da | Environmental | Open in IMG/M |
| 3300015372 | Soil combined assembly | Host-Associated | Open in IMG/M |
| 3300016319 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.00H | Environmental | Open in IMG/M |
| 3300016357 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.000 | Environmental | Open in IMG/M |
| 3300016422 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.111 | Environmental | Open in IMG/M |
| 3300017974 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_Q2_SP5_10_MG | Environmental | Open in IMG/M |
| 3300018058 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_QUI02_MP05_20_MG | Environmental | Open in IMG/M |
| 3300018060 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_QUI02_MP05_10_MG | Environmental | Open in IMG/M |
| 3300018064 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_BV02_MP05_10_MG | Environmental | Open in IMG/M |
| 3300018090 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP02_20_MG | Environmental | Open in IMG/M |
| 3300021081 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM4_32_coex redo | Environmental | Open in IMG/M |
| 3300021168 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-30-M | Environmental | Open in IMG/M |
| 3300021171 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-11-M | Environmental | Open in IMG/M |
| 3300021405 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-7-O | Environmental | Open in IMG/M |
| 3300021433 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-12-O | Environmental | Open in IMG/M |
| 3300025550 | Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - Joice_ThreeSqA_D1 (SPAdes) | Environmental | Open in IMG/M |
| 3300026349 | Sediment microbial communities from tidal freshwater marsh on Altamaha River, Georgia, United States - 10-16 PU6 | Environmental | Open in IMG/M |
| 3300027726 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P8 Core (3) Depth 1-3cm March2015 (SPAdes) | Environmental | Open in IMG/M |
| 3300027871 | Wetland microbial communities from Old Woman Creek Reserve in Ohio, USA - Open_0915_D1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027875 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H1.8 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027877 | Wetland microbial communities from Old Woman Creek Reserve in Ohio, USA - Mud_0915_D1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027890 | Wetland microbial communities from Old Woman Creek Reserve in Ohio, USA - Plant_0915_D1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027894 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Cold Stream Run_MetaG_CSR_2012 (SPAdes) | Environmental | Open in IMG/M |
| 3300027899 | Freshwater lake sediment microbial communities from the University of Notre Dame, USA, for methane emissions studies - PLP11 PL (SPAdes) | Environmental | Open in IMG/M |
| 3300027972 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (6) Depth 10-12cm September2015 (SPAdes) | Environmental | Open in IMG/M |
| 3300031564 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f21 | Environmental | Open in IMG/M |
| 3300031719 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.000 (v2) | Environmental | Open in IMG/M |
| 3300031820 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_515 | Environmental | Open in IMG/M |
| 3300031833 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.LF178 | Environmental | Open in IMG/M |
| 3300031912 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.080 (v2) | Environmental | Open in IMG/M |
| 3300031941 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.OX080 | Environmental | Open in IMG/M |
| 3300031949 | Soil microbial communities from uranium-contaminated site in the Upper Colorado River Basin, Wyoming, United States - RVT98D197 | Environmental | Open in IMG/M |
| 3300032059 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.053b4f27 | Environmental | Open in IMG/M |
| 3300032076 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.111 (v2) | Environmental | Open in IMG/M |
| 3300032090 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f22 | Environmental | Open in IMG/M |
| 3300032144 | Garden soil microbial communities collected in Santa Monica, California, United States - Edamame soil | Environmental | Open in IMG/M |
| 3300032261 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170 (v2) | Environmental | Open in IMG/M |
| 3300032805 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.2 | Environmental | Open in IMG/M |
| 3300032828 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.4 | Environmental | Open in IMG/M |
| 3300032893 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_1.1 | Environmental | Open in IMG/M |
| 3300033289 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.AN108 | Environmental | Open in IMG/M |
| 3300033406 | Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_soil_day20_CT | Environmental | Open in IMG/M |
| 3300033408 | Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_soil_day20_noCT | Environmental | Open in IMG/M |
| 3300033413 | Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_soil_day10_noCT | Environmental | Open in IMG/M |
| 3300033414 | Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_Aug_M1_C1_D4_B | Environmental | Open in IMG/M |
| 3300033480 | Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_Aug_M1_C1_D5_B | Environmental | Open in IMG/M |
| 3300033481 | Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_soil_day5_CT | Environmental | Open in IMG/M |
| 3300033482 | Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_Aug_M2_C1_D1_C | Environmental | Open in IMG/M |
| 3300033483 | Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_May_M1_C1_D1_A | Environmental | Open in IMG/M |
| 3300033485 | Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_Aug_T1_C1_D5_A | Environmental | Open in IMG/M |
| 3300033513 | Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_Aug_M2_C1_D5_C | Environmental | Open in IMG/M |
| 3300033521 | Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_Aug_M1_C1_D1_B | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| AF_2010_repII_A001DRAFT_101145222 | 3300000793 | Forest Soil | MAERAQIIVVDDQSDALAAMLDALTRRFGADYRVVPYLSPCSALAGVRKSKEENEDIALVIANQ |
| JGI10216J12902_1226388144 | 3300000956 | Soil | VRIYPRPAIVIVDDEPSQLAAMLDALVRRFGGDYRIVPHLSGNAALE |
| TOLCLC_102579082 | 3300002498 | Hydrocarbon Resource Environments | MLDRPTIMVVDDEPTALASMLDALTRRFGGDYRIEPHLSPP |
| JGI20214J51650_101334231 | 3300003541 | Wetland | MAERPLILIVDDEPTALASMLDALMRRFGGDYRVEPHLSARSALDAVSRHKADGEE |
| Ga0062594_1016970001 | 3300005093 | Soil | MEGDASVEEKPVIVAVDDETDELSTMRDALTRRFATDYRIA |
| Ga0070682_1002598103 | 3300005337 | Corn Rhizosphere | MVERPAIVIVDDQPDALTAMLDALTRRFGTDYRVVPHLSPSAALKAI |
| Ga0068868_1013940041 | 3300005338 | Miscanthus Rhizosphere | MAERPVILVVDDEPDALSTMVDALSRRFGRDYRVIPHLSARAALDAA |
| Ga0068868_1016712431 | 3300005338 | Miscanthus Rhizosphere | VEERPVIVAVDDETDALSTMRDALTRRFATDYRIASHLSARAALD |
| Ga0070661_1004532172 | 3300005344 | Corn Rhizosphere | VEEKPVIVAVDDETDELSTMRDALTRRFATDYRIASHLSARAALDEVCA |
| Ga0070713_1003478523 | 3300005436 | Corn, Switchgrass And Miscanthus Rhizosphere | MAERPIIAVVDDEPDALAAMLDALSRRFGGDYRVIAHSSARAALEAITKI |
| Ga0070711_1013537212 | 3300005439 | Corn, Switchgrass And Miscanthus Rhizosphere | VDERPVIVAVDDESDALSTMLDALTRRFATDYRIASHLSARAALDEVCAIKEKGGEI |
| Ga0070679_1009171463 | 3300005530 | Corn Rhizosphere | MTERPAIIIVDDQPDALAAMLDALTRRFGTDYRVIPHLSPPAALASIAKIKEE |
| Ga0070695_1016810132 | 3300005545 | Corn, Switchgrass And Miscanthus Rhizosphere | MAERALIIVVDDESDALAAMLDALTRRFGADYRVVPYLSSCAALAGVRKSKEENEEIAL |
| Ga0068859_1021959521 | 3300005617 | Switchgrass Rhizosphere | VEERPVIVAVDDETDALSTMRDALTRRFATDYRIASHLSARAALDEVCA |
| Ga0066903_1089915741 | 3300005764 | Tropical Forest Soil | MAERALIIVVDNESDALAAMLDALSRRFGADYRVVPYPSSCAALAGVRKSKEENEEIALVIAA |
| Ga0068858_1019380671 | 3300005842 | Switchgrass Rhizosphere | MAERPVIMVVDDEPAALAAILDALTRRFGGDYRIV |
| Ga0075017_1009318532 | 3300006059 | Watersheds | MAERASIIVVDDESDALAAMLDALTRRFGADYRVVPYLSPGSAL |
| Ga0075019_110433633 | 3300006086 | Watersheds | VDDRPVIVVVDDEADALSAILHTLTRRFGGDYRVVSHRSARTALDDI |
| Ga0070712_1005533111 | 3300006175 | Corn, Switchgrass And Miscanthus Rhizosphere | VDERPVIVAVDDESDALSTMLDALTRRFATDYRIASHLSARA |
| Ga0079037_1002146464 | 3300006224 | Freshwater Wetlands | MPERPTILVVDDEPAALASMLDALTRRFGGDYRVEP |
| Ga0079037_1026270852 | 3300006224 | Freshwater Wetlands | MEEILNGRPNIIVVDDEPSSLASLLDALTRRYGGDY |
| Ga0075436_1015242621 | 3300006914 | Populus Rhizosphere | MAERPIIAVVDDEPDALAAMLDALSRRFGGDYRVIAHSSARAALEAITKIKE |
| Ga0079303_101585761 | 3300006930 | Deep Subsurface | MAERPLILIVDDEPTALASMLDALTRRFGGDYRVEPHLSAHSALD |
| Ga0079303_103391551 | 3300006930 | Deep Subsurface | MNARPNIIVVDDEPAALASLLDALTRRYGGDYRVI |
| Ga0105095_102113581 | 3300009053 | Freshwater Sediment | MPERPTILIVDDEPAALASMLDALTRRFGGDYRIEPHLSAHTALDAVSRLKADGE |
| Ga0105095_104141492 | 3300009053 | Freshwater Sediment | MLERPTILVVDDEPAALASMLDALTRRFGGDYRVEPHLSAHTALDAVSRLKADGE |
| Ga0105107_107507202 | 3300009087 | Freshwater Sediment | MLERPVILVVDDEPTALASMLDALTRRFGGDYRVEPHLSAHTALDAVPRL |
| Ga0102851_121039572 | 3300009091 | Freshwater Wetlands | MTARPNIIVVDDEPTALASLLDALTRRYGGDYRVIPHLSA |
| Ga0115026_119300481 | 3300009111 | Wetland | VLERPTILIVDDEPTALASMLDALTRRFGGDYRVEPHLSAHSALDA |
| Ga0115027_107326522 | 3300009131 | Wetland | MDGRPNIIIVDDEPTELASLLDALTRRYGGDYRVI |
| Ga0105243_125345742 | 3300009148 | Miscanthus Rhizosphere | MAERALIIVVDDESDALAAMLDALTRRFGADYRVVPYLSSCAALAGVRK |
| Ga0113563_121773892 | 3300009167 | Freshwater Wetlands | MNDRPNIIVVDDEPAALASLLDALTRRYSVDYRVIPHLSA |
| Ga0113563_134861551 | 3300009167 | Freshwater Wetlands | MNTRPNIIVVDDEPTALASLLDALTRRYGGDYRVIPHLSALGA |
| Ga0105101_106018021 | 3300009171 | Freshwater Sediment | MEEILNARPNIIVVDDEPTALASLLDALTRRYSADYR |
| Ga0105242_130985621 | 3300009176 | Miscanthus Rhizosphere | VIVAVDDETDALSTMRDALTRRFATDYRIASHLSARAALDEVCAIKEKGGEIA |
| Ga0123573_114890571 | 3300009509 | Mangrove Sediment | MPERPFILVVDDEPAALAAMLDALTRRFGSDYRVEPHL |
| Ga0126310_108047582 | 3300010044 | Serpentine Soil | MLARPVITVVDDEPRALAGLLDALARRFGGDYRIVS |
| Ga0126370_119437221 | 3300010358 | Tropical Forest Soil | MAERATIIVVDDESEILTAMLDALTRRYGADYRVVPYLSPCSAL |
| Ga0126379_134214872 | 3300010366 | Tropical Forest Soil | MAERPVIMVVDDEPGALAAMLDALTRRFGADYRVVPHLSA |
| Ga0126381_1046309132 | 3300010376 | Tropical Forest Soil | MAERVQIIVVDDQSDALAAMLDALTRRFGADYRVVPYLSPCSALAGV |
| Ga0126383_103073853 | 3300010398 | Tropical Forest Soil | MAERAQIIVVDDQSDALAAMLDALTRRFGADYRVVPYLSPCSALAGVRKSK |
| Ga0137333_10861001 | 3300011413 | Soil | MEEILNARPNIIVVDDEPIALASLLDALTRRYGGDYRVI |
| Ga0137338_10732261 | 3300012174 | Soil | MNARPNIIVVDDEPAALASLLDALTRRYGGDYRVIPHLS |
| Ga0126369_105908722 | 3300012971 | Tropical Forest Soil | MAERATIIVVDDESDTLAALLYALTRRYGADYRVVPYL |
| Ga0164306_119797831 | 3300012988 | Soil | VIVAVDDETDALSTMRDALTRRFATDYRIASHLSARAALDEVCAIK |
| Ga0157378_116126682 | 3300013297 | Miscanthus Rhizosphere | VEERPVIVAVDDETDALSTMRDALTRRFATDYRIAS |
| Ga0075359_11475801 | 3300014266 | Natural And Restored Wetlands | MAERPLILIVDDEPTALASMLDALMRRFGGDYRVEPHLSARSALDAVSRHKADGEET |
| Ga0180076_10655411 | 3300014867 | Soil | MEEILNARPNIIVVDDEPSSLASLRDALTRRYGGDYRVIPHLSA |
| Ga0180104_11462041 | 3300014884 | Soil | MDARPNIIVVDDEPTALASLLDALTRRYSADYRVI |
| Ga0132256_1015863031 | 3300015372 | Arabidopsis Rhizosphere | VDERPVIVAVDDESDALSTMLDALTRRFATDYRIASHLSARAAL |
| Ga0182033_108112832 | 3300016319 | Soil | MAEIAQIIVVDDQSDALAAMLDALTRRFGADYRVVPYLSPCSALAGVRKSKEENEEIALVIA |
| Ga0182032_113948403 | 3300016357 | Soil | MAERAVIIVVDDESDVLGAMLDALTRRFGADYRVVPYLSPCSALA |
| Ga0182039_122714322 | 3300016422 | Soil | MDEKSAIIVVDDESDALAAIRDALTRRFGGDYRILPHASACAALEGV |
| Ga0187777_100803761 | 3300017974 | Tropical Peatland | MAERPAIVVVDDEPDELAAMLDALTRRVWGDYRVVPHLSA |
| Ga0187766_100144846 | 3300018058 | Tropical Peatland | MAERPAIVVVDDEPDELAAMLDALTRRFGGDYRVVPHLSARAALEAV |
| Ga0187765_101066422 | 3300018060 | Tropical Peatland | MPERPVIVVVDDEPDALAAMLDALTRRFGGDYRVVPHLSARAALVAVTKMKEEKEE |
| Ga0187773_102027351 | 3300018064 | Tropical Peatland | MAERPVIVVVDDEPDALSEMLDALTRRFGGDYRVVSHLSARAALDAICA |
| Ga0187770_108913931 | 3300018090 | Tropical Peatland | MAERPVIVIVDDEPDALAAMLDALTRRFGGDYRVVPHLSARA |
| Ga0210379_100819483 | 3300021081 | Groundwater Sediment | MEEILNARPNIIVVDDEPTALASLLDALTRRYGGDYRVIPHL |
| Ga0210406_109071861 | 3300021168 | Soil | MDEKPAIIVVDDEADALAGIREALTRRFGGDYRILPHLAARTALEAVCSIKEKEE |
| Ga0210405_108196632 | 3300021171 | Soil | MDEKPAIIVVDDEADALAGIREALTRRFGGDYRILPHLAARTA |
| Ga0210387_114487742 | 3300021405 | Soil | MAERAAIVVVDDEPAALADMLDALTRRFGADYRVLPYLAPSTA |
| Ga0210391_115380441 | 3300021433 | Soil | MAERAAIVVVDDEPAALADMLDALTRRFGADYRVLPYLGPSTALDGI |
| Ga0210098_10986551 | 3300025550 | Natural And Restored Wetlands | MISRPNIIVVDDEPTALASLLDALTRRYSADYRVIPHL |
| Ga0256811_10256872 | 3300026349 | Sediment | METRPLILVVDDEPAALASMLDALTRRFGGDYRIEPHLS |
| Ga0209285_100599791 | 3300027726 | Freshwater Sediment | MAERPLILIVDDEPTALASMLDALTRRFGGDYRVEPHLSARSALDAV |
| Ga0209397_100017647 | 3300027871 | Wetland | MHERPTILIVDDEPTALASMLDALTRRFGGDYRIEPHLSAHAALDAVSRIKADGD |
| Ga0209283_100741423 | 3300027875 | Vadose Zone Soil | MAERPIIMVVDDEPDALAAMLDALARRFGGDYRVIPHLSP |
| Ga0209293_105573391 | 3300027877 | Wetland | MTARPNIIVVDDEPTALASLLDALTRRYGGDYRVIPHLS |
| Ga0209293_107571811 | 3300027877 | Wetland | MPERPTILVVDDEPAALASMLDALTRRFGGDYRVEPHLSPH |
| Ga0209496_102557821 | 3300027890 | Wetland | VLERPTILIVDDEPTALASMLDALTRRFGGDYRVEPHLSAR |
| Ga0209496_106136231 | 3300027890 | Wetland | MHERPTILIVDDEPTALASMLDALTRRFGGDYRIEPHLSAHAA |
| Ga0209068_108872112 | 3300027894 | Watersheds | MAERALIIVVDDESDALAAMLDALTRRFGADYRVVPYLSPCCALAGVCKSKEENEEITLV |
| Ga0209668_100721151 | 3300027899 | Freshwater Lake Sediment | MAERPLILTVDDEPTALASMLDALTRRFGGDYRVEPHLLA |
| Ga0209079_102397642 | 3300027972 | Freshwater Sediment | MAERPLILIVDDEPTALASMLDALTRRFGGDYRVEPHLSARSALDA |
| Ga0318573_106147862 | 3300031564 | Soil | MAERPAIVILDDDPVALSALLDALARRFGADYRVVSQL |
| Ga0306917_108468731 | 3300031719 | Soil | MAERPVIMVVDDEPDALAAMLDALTRRFGGDYRVIPDLSARAALDAVAKIKEE |
| Ga0307473_109994792 | 3300031820 | Hardwood Forest Soil | MLQRPVILIVDDEPRAVAELLDALARRFGADYRVIP |
| Ga0310917_104000081 | 3300031833 | Soil | MAERAVIIVVDDESDVLGAMLDALTRRFGADYRVVPYLSPCSALAGVCKSKEANEEIALV |
| Ga0306921_115876751 | 3300031912 | Soil | MTERPLIFIVDDESEALAGMLDALTRRFGDDYRVVPHLSARAALDAVSKSAKDRDEI |
| Ga0310912_110011811 | 3300031941 | Soil | MAERPVIMVVDDEPDALAAMLDALTRRFGGDYRVIPDL |
| Ga0214473_122928311 | 3300031949 | Soil | MNARPNIIVVDDEPAALASLLDALTRRYGGDYRVIPH |
| Ga0318533_112700251 | 3300032059 | Soil | MVERAQIIVVDDQSDALAAMLDALTRRFGADYRVVPYLSPCSALAGVRKSK |
| Ga0306924_125573241 | 3300032076 | Soil | MAERAQIIVVDDQSDALAAMLDALTRRFGADYRVVPYLSPCSALA |
| Ga0318518_105537661 | 3300032090 | Soil | MAERAQIIVVDDQSDALAALLDALTRRFGADYRVVPYLSPCSALAGVRKGK |
| Ga0315910_115348751 | 3300032144 | Soil | MMTRPVIALVDDDPRALTAMLDALVRRFGADYRVVS |
| Ga0306920_1015786002 | 3300032261 | Soil | MAERAVIIVVDDESSVLAAMLDALTRRFGADYRVAPYLSPCSALAGVCKS |
| Ga0335078_114434102 | 3300032805 | Soil | MRERPLIIVVDDESEPLAAMLEALTRRFGGDYQVVSYLSARAALDMVIKCKQENAEIA |
| Ga0335080_111987561 | 3300032828 | Soil | MRERPLIIVVDDESDELAAILDALTRRFGGDYRIVPHLS |
| Ga0335069_107406482 | 3300032893 | Soil | MPDRPAIVIVDDEPRALTAMLDALTRRFGADYRVAPHLSPGEALESLE |
| Ga0310914_109090512 | 3300033289 | Soil | MAERAVIIIVDDESDALAAMLDALTRRFGADYRVLPYLSP |
| Ga0310914_115566392 | 3300033289 | Soil | MAERAVIIIVDDESDALAAMLDILTRRFGADYRVVPYLSPCSALAGVCKSK |
| Ga0316604_107484682 | 3300033406 | Soil | MNARPNIIVVDDEPAALASLLDALTRRFGGDYRVIPHLSAL |
| Ga0316605_100927111 | 3300033408 | Soil | MNARPNILVVDDEPAALASLLDALTRRFGGDYRVIPHLSA |
| Ga0316605_101912064 | 3300033408 | Soil | MNAHPNIIVVDDEPTALASLLDALTRRYGGDYRVIP |
| Ga0316605_107849351 | 3300033408 | Soil | MEEILNARPNIIVVDDEPSSLASLLDALTRRYGGDY |
| Ga0316605_114928272 | 3300033408 | Soil | VLERPTILIVDDEPTALASMLDALTRRFGGDYRVEP |
| Ga0316603_100558441 | 3300033413 | Soil | MHERPTILIVDDEPTALASMLDALTRRFGGDYRIEPHLS |
| Ga0316603_100875514 | 3300033413 | Soil | MPERPTILVVDDEPAALASMLDALTRRFGGDYRVEPHLSAPSALDAFS |
| Ga0316603_114016253 | 3300033413 | Soil | MNAHPNIIVVDDEPTDLASLLDALTRRYGGDYRVIPHLS |
| Ga0316603_121808642 | 3300033413 | Soil | MNARPIILVVEDEPAALASLLDDLTRRYGGHYRVIPHL |
| Ga0316619_101407701 | 3300033414 | Soil | MHERPTILIVDDEPTALASMLDALTRRFGGDYRIEPH |
| Ga0316619_105270501 | 3300033414 | Soil | MAERPLILIVDDEPTALASMLDALTRRFGGDYRVEPHLSARSALDAISRHK |
| Ga0316619_105370701 | 3300033414 | Soil | MPERPTILVVDDEPAALASMLDALTRRFGGDYRVEPHLSAPSALDAVAR |
| Ga0316620_103936693 | 3300033480 | Soil | VQSRPVIAVVDDEPVALAALLDALARRFGADYRVELSR |
| Ga0316600_107510732 | 3300033481 | Soil | MTARPNIIVVDDEPTALASLLDALTRRYGGDYRVIP |
| Ga0316627_1011348972 | 3300033482 | Soil | MPERPVILIVDDEPAALASMLDALTRRFGADYRVEPHLS |
| Ga0316627_1022515741 | 3300033482 | Soil | MNARPNIIVVDDEPAALASLLDALARRYGGDYRVIPHLSAL |
| Ga0316629_103236361 | 3300033483 | Soil | MTERPMILIVDDEPTALASMLDALTRRFGGDYRVEPHLSARAALDAVS |
| Ga0316626_107889832 | 3300033485 | Soil | MNARPNIIVVDDEPTALASLLDALTRRYGGDYRVIPY |
| Ga0316628_1013223122 | 3300033513 | Soil | MHERPTILIVDDEPTALASMLDALTRRFGGDYRIEPHLSAHAALDTVSRIKADGDEL |
| Ga0316616_1006886741 | 3300033521 | Soil | MGERPLILIVDDEPTALASMLDALTRRFGGDYRVEPHLSARSALDAVSSHKAD |
| Ga0316616_1011274582 | 3300033521 | Soil | MADRPVIVIVDDEPTALAGMLDALNRRFGADYRVVPY |
| Ga0316616_1015382783 | 3300033521 | Soil | MNAHPNIIVVDDEPAALASLLDALTRRYGGDYRVIPH |
| Ga0316616_1020954571 | 3300033521 | Soil | MNARPNIIVVDDEPAALASLLDALTRRYGGDYRVIPHLSALG |
| ⦗Top⦘ |