Basic Information | |
---|---|
Family ID | F080301 |
Family Type | Metagenome / Metatranscriptome |
Number of Sequences | 115 |
Average Sequence Length | 41 residues |
Representative Sequence | VPRVYLAGPPFADEYRRRASALLREAGWEPVDPMRRDFR |
Number of Associated Samples | 108 |
Number of Associated Scaffolds | 115 |
Quality Assessment | |
---|---|
Transcriptomic Evidence | Yes |
Most common taxonomic group | Bacteria |
% of genes with valid RBS motifs | 34.78 % |
% of genes near scaffold ends (potentially truncated) | 99.13 % |
% of genes from short scaffolds (< 2000 bps) | 96.52 % |
Associated GOLD sequencing projects | 108 |
AlphaFold2 3D model prediction | Yes |
3D model pTM-score | 0.62 |
Hidden Markov Model |
---|
Powered by Skylign |
Most Common Taxonomy | |
---|---|
Group | Bacteria (100.000 % of family members) |
NCBI Taxonomy ID | 2 |
Taxonomy | All Organisms → cellular organisms → Bacteria |
Most Common Ecosystem | |
---|---|
GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil (14.783 % of family members) |
Environment Ontology (ENVO) | Unclassified (30.435 % of family members) |
Earth Microbiome Project Ontology (EMPO) | Host-associated → Plant → Plant rhizosphere (40.000 % of family members) |
⦗Top⦘ |
⦗Top⦘ |
Predicted Topology & Secondary Structure | |||||
---|---|---|---|---|---|
Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 19.40% β-sheet: 8.96% Coil/Unstructured: 71.64% | Feature Viewer |
|
|||||
Powered by Feature Viewer |
Structure Viewer | |
---|---|
| |
Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.62 |
Powered by PDBe Molstar |
⦗Top⦘ |
Pfam ID | Name | % Frequency in 115 Family Scaffolds |
---|---|---|
PF14489 | QueF | 82.61 |
PF00067 | p450 | 5.22 |
PF08327 | AHSA1 | 0.87 |
PF01227 | GTP_cyclohydroI | 0.87 |
PF13365 | Trypsin_2 | 0.87 |
PF01209 | Ubie_methyltran | 0.87 |
PF00144 | Beta-lactamase | 0.87 |
PF02746 | MR_MLE_N | 0.87 |
PF05014 | Nuc_deoxyrib_tr | 0.87 |
PF07883 | Cupin_2 | 0.87 |
PF08279 | HTH_11 | 0.87 |
PF12840 | HTH_20 | 0.87 |
COG ID | Name | Functional Category | % Frequency in 115 Family Scaffolds |
---|---|---|---|
COG2124 | Cytochrome P450 | Defense mechanisms [V] | 5.22 |
COG4948 | L-alanine-DL-glutamate epimerase or related enzyme of enolase superfamily | Cell wall/membrane/envelope biogenesis [M] | 1.74 |
COG1680 | CubicO group peptidase, beta-lactamase class C family | Defense mechanisms [V] | 0.87 |
COG1686 | D-alanyl-D-alanine carboxypeptidase | Cell wall/membrane/envelope biogenesis [M] | 0.87 |
COG2226 | Ubiquinone/menaquinone biosynthesis C-methylase UbiE/MenG | Coenzyme transport and metabolism [H] | 0.87 |
COG2227 | 2-polyprenyl-3-methyl-5-hydroxy-6-metoxy-1,4-benzoquinol methylase | Coenzyme transport and metabolism [H] | 0.87 |
COG2367 | Beta-lactamase class A | Defense mechanisms [V] | 0.87 |
COG3613 | Nucleoside 2-deoxyribosyltransferase | Nucleotide transport and metabolism [F] | 0.87 |
⦗Top⦘ |
Name | Rank | Taxonomy | Distribution |
All Organisms | root | All Organisms | 100.00 % |
Unclassified | root | N/A | 0.00 % |
Visualization |
---|
Powered by ApexCharts |
Scaffold | Taxonomy | Length | IMG/M Link |
---|---|---|---|
2170459017|G14TP7Y01BSJ6O | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 650 | Open in IMG/M |
3300000956|JGI10216J12902_112610273 | All Organisms → cellular organisms → Bacteria | 689 | Open in IMG/M |
3300000956|JGI10216J12902_115610911 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 587 | Open in IMG/M |
3300001534|A15PFW1_10723807 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 643 | Open in IMG/M |
3300005093|Ga0062594_101585748 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 677 | Open in IMG/M |
3300005334|Ga0068869_100356730 | All Organisms → cellular organisms → Bacteria | 1193 | Open in IMG/M |
3300005338|Ga0068868_102114643 | All Organisms → cellular organisms → Bacteria | 535 | Open in IMG/M |
3300005338|Ga0068868_102285694 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 516 | Open in IMG/M |
3300005343|Ga0070687_101127471 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 575 | Open in IMG/M |
3300005439|Ga0070711_100316169 | All Organisms → cellular organisms → Bacteria | 1246 | Open in IMG/M |
3300005440|Ga0070705_100089174 | All Organisms → cellular organisms → Bacteria | 1916 | Open in IMG/M |
3300005450|Ga0066682_10495674 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 774 | Open in IMG/M |
3300005456|Ga0070678_101951950 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 555 | Open in IMG/M |
3300005457|Ga0070662_101134714 | All Organisms → cellular organisms → Bacteria | 671 | Open in IMG/M |
3300005518|Ga0070699_100525596 | All Organisms → cellular organisms → Bacteria | 1076 | Open in IMG/M |
3300005526|Ga0073909_10513656 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 581 | Open in IMG/M |
3300005530|Ga0070679_100630553 | All Organisms → cellular organisms → Bacteria | 1015 | Open in IMG/M |
3300005542|Ga0070732_10314312 | All Organisms → cellular organisms → Bacteria | 941 | Open in IMG/M |
3300005549|Ga0070704_101076030 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 730 | Open in IMG/M |
3300005561|Ga0066699_10255719 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1237 | Open in IMG/M |
3300005574|Ga0066694_10513267 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 559 | Open in IMG/M |
3300005578|Ga0068854_101276726 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 660 | Open in IMG/M |
3300005618|Ga0068864_101510811 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 675 | Open in IMG/M |
3300005764|Ga0066903_106064372 | All Organisms → cellular organisms → Bacteria | 633 | Open in IMG/M |
3300005840|Ga0068870_10499795 | All Organisms → cellular organisms → Bacteria | 810 | Open in IMG/M |
3300005844|Ga0068862_100557485 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1095 | Open in IMG/M |
3300006028|Ga0070717_10414642 | All Organisms → cellular organisms → Bacteria | 1211 | Open in IMG/M |
3300006038|Ga0075365_11065807 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 569 | Open in IMG/M |
3300006046|Ga0066652_100242438 | All Organisms → cellular organisms → Bacteria | 1574 | Open in IMG/M |
3300006175|Ga0070712_101036454 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 711 | Open in IMG/M |
3300006358|Ga0068871_101300141 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 684 | Open in IMG/M |
3300006581|Ga0074048_12696343 | All Organisms → cellular organisms → Bacteria | 572 | Open in IMG/M |
3300006847|Ga0075431_101715285 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 585 | Open in IMG/M |
3300007004|Ga0079218_10741846 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 931 | Open in IMG/M |
3300009090|Ga0099827_11586701 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 570 | Open in IMG/M |
3300009100|Ga0075418_11704770 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 685 | Open in IMG/M |
3300009137|Ga0066709_103087294 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 609 | Open in IMG/M |
3300009147|Ga0114129_12991975 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 556 | Open in IMG/M |
3300009156|Ga0111538_11531269 | All Organisms → cellular organisms → Bacteria | 841 | Open in IMG/M |
3300009177|Ga0105248_10414359 | All Organisms → cellular organisms → Bacteria | 1517 | Open in IMG/M |
3300009789|Ga0126307_11407949 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 565 | Open in IMG/M |
3300009812|Ga0105067_1025491 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 842 | Open in IMG/M |
3300009812|Ga0105067_1069536 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 592 | Open in IMG/M |
3300010039|Ga0126309_10337353 | All Organisms → cellular organisms → Bacteria | 883 | Open in IMG/M |
3300010166|Ga0126306_10584160 | All Organisms → cellular organisms → Bacteria | 889 | Open in IMG/M |
3300010303|Ga0134082_10342247 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 632 | Open in IMG/M |
3300010359|Ga0126376_11606139 | All Organisms → cellular organisms → Bacteria | 682 | Open in IMG/M |
3300010399|Ga0134127_10202033 | All Organisms → cellular organisms → Bacteria | 1849 | Open in IMG/M |
3300010399|Ga0134127_10746977 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1023 | Open in IMG/M |
3300012199|Ga0137383_10670709 | All Organisms → cellular organisms → Bacteria | 758 | Open in IMG/M |
3300012210|Ga0137378_11129902 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 698 | Open in IMG/M |
3300012351|Ga0137386_10885154 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 640 | Open in IMG/M |
3300012356|Ga0137371_10817686 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 710 | Open in IMG/M |
3300012363|Ga0137390_10915416 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 831 | Open in IMG/M |
3300012668|Ga0157216_10094831 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1455 | Open in IMG/M |
3300012682|Ga0136611_10274655 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1121 | Open in IMG/M |
3300012913|Ga0157298_10281473 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 580 | Open in IMG/M |
3300012951|Ga0164300_10389329 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 762 | Open in IMG/M |
3300012951|Ga0164300_10494552 | All Organisms → cellular organisms → Bacteria | 697 | Open in IMG/M |
3300012955|Ga0164298_10751853 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 691 | Open in IMG/M |
3300012958|Ga0164299_10748248 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 690 | Open in IMG/M |
3300012960|Ga0164301_11856901 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 508 | Open in IMG/M |
3300012989|Ga0164305_12042495 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 524 | Open in IMG/M |
3300013102|Ga0157371_10454561 | All Organisms → cellular organisms → Bacteria | 942 | Open in IMG/M |
3300013306|Ga0163162_10443086 | All Organisms → cellular organisms → Bacteria | 1431 | Open in IMG/M |
3300013772|Ga0120158_10042519 | All Organisms → cellular organisms → Bacteria | 3265 | Open in IMG/M |
3300013772|Ga0120158_10485547 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 548 | Open in IMG/M |
3300015262|Ga0182007_10241580 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 645 | Open in IMG/M |
3300015373|Ga0132257_101858769 | All Organisms → cellular organisms → Bacteria | 774 | Open in IMG/M |
3300017654|Ga0134069_1325839 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 549 | Open in IMG/M |
3300017937|Ga0187809_10226575 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 670 | Open in IMG/M |
3300018031|Ga0184634_10474216 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 562 | Open in IMG/M |
3300018071|Ga0184618_10397555 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 584 | Open in IMG/M |
3300018073|Ga0184624_10481829 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 541 | Open in IMG/M |
3300018432|Ga0190275_13070703 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 540 | Open in IMG/M |
3300020070|Ga0206356_10500891 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 618 | Open in IMG/M |
3300020170|Ga0179594_10212753 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 726 | Open in IMG/M |
3300021968|Ga0193698_1050205 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 536 | Open in IMG/M |
3300022226|Ga0224512_10197583 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1039 | Open in IMG/M |
3300024177|Ga0247686_1049851 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 519 | Open in IMG/M |
3300024279|Ga0247692_1054113 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 623 | Open in IMG/M |
3300024331|Ga0247668_1120103 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 533 | Open in IMG/M |
3300025318|Ga0209519_10313226 | All Organisms → cellular organisms → Bacteria | 909 | Open in IMG/M |
3300025325|Ga0209341_10670938 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 802 | Open in IMG/M |
3300025912|Ga0207707_11006815 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 683 | Open in IMG/M |
3300025913|Ga0207695_10694401 | All Organisms → cellular organisms → Bacteria | 898 | Open in IMG/M |
3300025935|Ga0207709_11624227 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 537 | Open in IMG/M |
3300025945|Ga0207679_11427953 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 635 | Open in IMG/M |
3300025949|Ga0207667_10290060 | All Organisms → cellular organisms → Bacteria | 1672 | Open in IMG/M |
3300026067|Ga0207678_10352916 | All Organisms → cellular organisms → Bacteria | 1268 | Open in IMG/M |
3300026088|Ga0207641_10283960 | All Organisms → cellular organisms → Bacteria | 1558 | Open in IMG/M |
3300028138|Ga0247684_1018854 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1086 | Open in IMG/M |
3300028558|Ga0265326_10242235 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 521 | Open in IMG/M |
3300028587|Ga0247828_11172805 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 513 | Open in IMG/M |
3300028712|Ga0307285_10185570 | All Organisms → cellular organisms → Bacteria | 579 | Open in IMG/M |
3300028713|Ga0307303_10104440 | All Organisms → cellular organisms → Bacteria | 652 | Open in IMG/M |
3300028754|Ga0307297_10070915 | All Organisms → cellular organisms → Bacteria | 1107 | Open in IMG/M |
3300028800|Ga0265338_11201866 | All Organisms → cellular organisms → Bacteria | 508 | Open in IMG/M |
3300028807|Ga0307305_10043298 | All Organisms → cellular organisms → Bacteria | 2071 | Open in IMG/M |
3300028819|Ga0307296_10646332 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 579 | Open in IMG/M |
3300028881|Ga0307277_10358556 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 650 | Open in IMG/M |
3300031170|Ga0307498_10484745 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 503 | Open in IMG/M |
3300031249|Ga0265339_10155326 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptomycetales → Streptomycetaceae → Streptomyces | 1154 | Open in IMG/M |
3300031672|Ga0307373_10195425 | All Organisms → cellular organisms → Bacteria | 1463 | Open in IMG/M |
3300031680|Ga0318574_10927471 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 510 | Open in IMG/M |
3300031716|Ga0310813_10970343 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 774 | Open in IMG/M |
3300031720|Ga0307469_12073045 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 553 | Open in IMG/M |
3300031821|Ga0318567_10050402 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 2149 | Open in IMG/M |
3300031999|Ga0315274_11708707 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 584 | Open in IMG/M |
3300032009|Ga0318563_10223553 | All Organisms → cellular organisms → Bacteria | 1016 | Open in IMG/M |
3300032090|Ga0318518_10257873 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 895 | Open in IMG/M |
3300032164|Ga0315283_11052141 | All Organisms → cellular organisms → Bacteria | 858 | Open in IMG/M |
3300032397|Ga0315287_10063037 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 4114 | Open in IMG/M |
3300032397|Ga0315287_11703155 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 705 | Open in IMG/M |
3300033811|Ga0364924_031309 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1089 | Open in IMG/M |
⦗Top⦘ |
Habitat | Taxonomy | Distribution |
Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 14.78% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 6.96% |
Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 6.09% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 5.22% |
Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 5.22% |
Sediment | Environmental → Aquatic → Freshwater → Lake → Sediment → Sediment | 3.48% |
Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere | 3.48% |
Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 3.48% |
Groundwater Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment | 2.61% |
Serpentine Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Serpentine Soil | 2.61% |
Permafrost | Environmental → Terrestrial → Soil → Unclassified → Permafrost → Permafrost | 2.61% |
Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 2.61% |
Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Rhizosphere | 2.61% |
Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere | 2.61% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 1.74% |
Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 1.74% |
Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 1.74% |
Surface Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil | 1.74% |
Corn Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere | 1.74% |
Groundwater Sand | Environmental → Terrestrial → Soil → Sand → Unclassified → Groundwater Sand | 1.74% |
Corn Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere | 1.74% |
Freshwater Sediment | Environmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment | 0.87% |
Polar Desert Sand | Environmental → Aquatic → Freshwater → Ice → Unclassified → Polar Desert Sand | 0.87% |
Sediment | Environmental → Aquatic → Marine → Sediment → Unclassified → Sediment | 0.87% |
Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 0.87% |
Glacier Forefield Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Glacier Forefield Soil | 0.87% |
Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Corn, Switchgrass And Miscanthus Rhizosphere | 0.87% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil | 0.87% |
Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 0.87% |
Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 0.87% |
Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 0.87% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural → Soil | 0.87% |
Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 0.87% |
Switchgrass Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Switchgrass Rhizosphere | 0.87% |
Soil | Environmental → Terrestrial → Soil → Loam → Unclassified → Soil | 0.87% |
Soil | Environmental → Terrestrial → Soil → Clay → Unclassified → Soil | 0.87% |
Sediment | Environmental → Terrestrial → Floodplain → Sediment → Unclassified → Sediment | 0.87% |
Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere | 0.87% |
Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 0.87% |
Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Soil → Unclassified → Miscanthus Rhizosphere | 0.87% |
Populus Endosphere | Host-Associated → Plants → Roots → Bulk Soil → Unclassified → Populus Endosphere | 0.87% |
Miscanthus Rhizosphere | Host-Associated → Plants → Roots → Rhizosphere → Soil → Miscanthus Rhizosphere | 0.87% |
Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 0.87% |
Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 0.87% |
Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 0.87% |
Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 0.87% |
Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere | 0.87% |
Switchgrass, Maize And Mischanthus Litter | Engineered → Solid Waste → Grass → Composting → Unclassified → Switchgrass, Maize And Mischanthus Litter | 0.87% |
Visualization |
---|
Powered by ApexCharts |
Taxon OID | Sample Name | Habitat Type | IMG/M Link |
---|---|---|---|
2170459017 | Litter degradation ZMR4 | Engineered | Open in IMG/M |
3300000956 | Soil microbial communities from Great Prairies - Kansas, Native Prairie soil | Environmental | Open in IMG/M |
3300001534 | Permafrost active layer microbial communities from McGill Arctic Research Station, Canada - (A15-PF-7A)- 1 week illumina | Environmental | Open in IMG/M |
3300005093 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of KBS All Blocks | Environmental | Open in IMG/M |
3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Host-Associated | Open in IMG/M |
3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Host-Associated | Open in IMG/M |
3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Environmental | Open in IMG/M |
3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Environmental | Open in IMG/M |
3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Environmental | Open in IMG/M |
3300005450 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_131 | Environmental | Open in IMG/M |
3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Host-Associated | Open in IMG/M |
3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Host-Associated | Open in IMG/M |
3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Environmental | Open in IMG/M |
3300005526 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire. - Coalmine Soil_Cen17_06102014_R1 | Environmental | Open in IMG/M |
3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Environmental | Open in IMG/M |
3300005542 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen04_05102014_R1 | Environmental | Open in IMG/M |
3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Environmental | Open in IMG/M |
3300005561 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_148 | Environmental | Open in IMG/M |
3300005574 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_143 | Environmental | Open in IMG/M |
3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Host-Associated | Open in IMG/M |
3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Host-Associated | Open in IMG/M |
3300005764 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2) | Environmental | Open in IMG/M |
3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Host-Associated | Open in IMG/M |
3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Host-Associated | Open in IMG/M |
3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Environmental | Open in IMG/M |
3300006038 | Populus root and rhizosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Host-Associated | Open in IMG/M |
3300006046 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_101 | Environmental | Open in IMG/M |
3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Environmental | Open in IMG/M |
3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Host-Associated | Open in IMG/M |
3300006581 | Soil and rhizosphere microbial communities from Centre INRS-Institut Armand-Frappier, Laval, Canada - Soil microcosm metaTmtLPB (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300006847 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Host-Associated | Open in IMG/M |
3300007004 | Agricultural soil microbial communities from Utah to study Nitrogen management - NC Compost | Environmental | Open in IMG/M |
3300009090 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con1.8 metaG | Environmental | Open in IMG/M |
3300009100 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD2 | Host-Associated | Open in IMG/M |
3300009137 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_158 | Environmental | Open in IMG/M |
3300009147 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) | Host-Associated | Open in IMG/M |
3300009156 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD1 (version 2) | Host-Associated | Open in IMG/M |
3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Host-Associated | Open in IMG/M |
3300009789 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot28 | Environmental | Open in IMG/M |
3300009812 | Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW N2_50_60 | Environmental | Open in IMG/M |
3300010039 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot56 | Environmental | Open in IMG/M |
3300010166 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot27 | Environmental | Open in IMG/M |
3300010303 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_5_09182015 | Environmental | Open in IMG/M |
3300010359 | Tropical forest soil microbial communities from Panama - MetaG Plot_15 | Environmental | Open in IMG/M |
3300010399 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-3 | Environmental | Open in IMG/M |
3300012199 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_40_16 metaG | Environmental | Open in IMG/M |
3300012210 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_60_16 metaG | Environmental | Open in IMG/M |
3300012351 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_100_16 metaG | Environmental | Open in IMG/M |
3300012356 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_40_16 metaG | Environmental | Open in IMG/M |
3300012363 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h2.4A metaG | Environmental | Open in IMG/M |
3300012668 | Arctic soils microbial communities. Combined Assembly of 23 SPs | Environmental | Open in IMG/M |
3300012682 | Polar desert sand microbial communities from Dry Valleys, Antarctica - metaG UQ223 (23.06) | Environmental | Open in IMG/M |
3300012913 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S043-104R-2 | Environmental | Open in IMG/M |
3300012951 | Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_226_MG | Environmental | Open in IMG/M |
3300012955 | Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_216_MG | Environmental | Open in IMG/M |
3300012958 | Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_221_MG | Environmental | Open in IMG/M |
3300012960 | Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_231_MG | Environmental | Open in IMG/M |
3300012989 | Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_237_MG | Environmental | Open in IMG/M |
3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Host-Associated | Open in IMG/M |
3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Host-Associated | Open in IMG/M |
3300013772 | Permafrost microbial communities from Nunavut, Canada - A10_80_0.25M | Environmental | Open in IMG/M |
3300015262 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG | Host-Associated | Open in IMG/M |
3300015373 | Combined assembly of cpr5 rhizosphere | Host-Associated | Open in IMG/M |
3300017654 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_40cm_2_24_1 metaG | Environmental | Open in IMG/M |
3300017937 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - ASW_4 | Environmental | Open in IMG/M |
3300018031 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3-1_200_b1 | Environmental | Open in IMG/M |
3300018071 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM0_30_b1 | Environmental | Open in IMG/M |
3300018073 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3_5_b1 | Environmental | Open in IMG/M |
3300018432 | Populus adjacent soil microbial communities from riparian zone of Yellowstone River, Montana, USA - 550 T | Environmental | Open in IMG/M |
3300020070 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
3300020170 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad1_1_08_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
3300021968 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? L3c1 | Environmental | Open in IMG/M |
3300022226 | Sediment microbial communities from San Francisco Bay, California, United States - SF_May12_sed_USGS_13 | Environmental | Open in IMG/M |
3300024177 | Soil microbial communities from Purdue University Martell Research Forest, Indiana, United States - CNK27 | Environmental | Open in IMG/M |
3300024279 | Soil microbial communities from Purdue University Martell Research Forest, Indiana, United States - CNK33 | Environmental | Open in IMG/M |
3300024331 | Soil microbial communities from Purdue University Martell Research Forest, Indiana, United States - CNK09 | Environmental | Open in IMG/M |
3300025318 | Soil microbial communities from Rifle, Colorado, USA - sediment 13ft 1 | Environmental | Open in IMG/M |
3300025325 | Soil microbial communities from Rifle, Colorado - Rifle CSP2_sed 13_2 (SPAdes) | Environmental | Open in IMG/M |
3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) | Environmental | Open in IMG/M |
3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) | Host-Associated | Open in IMG/M |
3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) | Host-Associated | Open in IMG/M |
3300028138 | Soil microbial communities from Purdue University Martell Research Forest, Indiana, United States - CNK25 | Environmental | Open in IMG/M |
3300028558 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG | Host-Associated | Open in IMG/M |
3300028587 | Soil microbial communities from agricultural site in Penn Yan, New York, United States - 12C_Control_Day3 | Environmental | Open in IMG/M |
3300028712 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_139 | Environmental | Open in IMG/M |
3300028713 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_184 | Environmental | Open in IMG/M |
3300028754 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_157 | Environmental | Open in IMG/M |
3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Host-Associated | Open in IMG/M |
3300028807 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_186 | Environmental | Open in IMG/M |
3300028819 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_153 | Environmental | Open in IMG/M |
3300028881 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_116 | Environmental | Open in IMG/M |
3300031170 | Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 12_S | Environmental | Open in IMG/M |
3300031249 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG | Host-Associated | Open in IMG/M |
3300031672 | Soil microbial communities from Risofladan, Vaasa, Finland - OX-2 | Environmental | Open in IMG/M |
3300031680 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f22 | Environmental | Open in IMG/M |
3300031716 | Soil microbial communities from experimental microcosm in Duke University, North Carolina, United States - YN3 | Environmental | Open in IMG/M |
3300031720 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM2C_515 | Environmental | Open in IMG/M |
3300031821 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.088b5f20 | Environmental | Open in IMG/M |
3300031999 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G02_20 | Environmental | Open in IMG/M |
3300032009 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.066b5f19 | Environmental | Open in IMG/M |
3300032090 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f22 | Environmental | Open in IMG/M |
3300032164 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G09_0 | Environmental | Open in IMG/M |
3300032397 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G11_0 | Environmental | Open in IMG/M |
3300033811 | Sediment microbial communities from East River floodplain, Colorado, United States - 28_j17 | Environmental | Open in IMG/M |
Geographical Distribution | |
---|---|
Zoom: | Powered by OpenStreetMap |
⦗Top⦘ |
Protein ID | Sample Taxon ID | Habitat | Sequence |
4ZMR_03192830 | 2170459017 | Switchgrass, Maize And Mischanthus Litter | MTEARGRVYLAGPPYAEEYRRRAEALVRELGWEPVDPMRRD |
JGI10216J12902_1126102733 | 3300000956 | Soil | VPRVYLAGPPFADDYRRRAETLVREAGWEPVDPMRRDFRG |
JGI10216J12902_1156109112 | 3300000956 | Soil | MRIYLAGPPFAEEYRRRASALVRAAGWEPVDPMRR |
A15PFW1_107238071 | 3300001534 | Permafrost | VPRVYLAGPPFADEYRVRASELARAAGWEPVDPMRRDFRGGAESH |
Ga0062594_1015857481 | 3300005093 | Soil | VRRIYLAGPPFAEEYRRRAAALVTAHGCEPVDPMRRDFRGRTEGNE |
Ga0068869_1003567303 | 3300005334 | Miscanthus Rhizosphere | VRRIYLAGPPFAEEYRRRAAALVTAHGCEPVDPMRRDFRGRTE |
Ga0068868_1021146432 | 3300005338 | Miscanthus Rhizosphere | VRRVYLAGPPFAEEYRRRAAELLAAAGCEPVDPMRRDFRGNTVGHEA |
Ga0068868_1022856942 | 3300005338 | Miscanthus Rhizosphere | VPRVYLAGPPFAEEYRRRAVALAEAAGWEPVDPMRRDFRGHTQGH |
Ga0070687_1011274711 | 3300005343 | Switchgrass Rhizosphere | VRRIYLAGPPFAEEYRRRASALVSARGCEPVDPMRRDFRGRTE |
Ga0070711_1003161694 | 3300005439 | Corn, Switchgrass And Miscanthus Rhizosphere | VPRVYLAGPPFSDEYRKRAVALCREHGWETVDPMRRDFRGAT |
Ga0070705_1000891741 | 3300005440 | Corn, Switchgrass And Miscanthus Rhizosphere | VRRVYLAGPPFAEEYRRRASELLVAAGCEPVDPMRRDFRGRTE |
Ga0066682_104956741 | 3300005450 | Soil | VLRVYVAGPPFAEEYRRRASTLLRAAGLEPVDPMRRDFRGR |
Ga0070678_1019519501 | 3300005456 | Miscanthus Rhizosphere | MPTYSRRVPRVYLAGPPFAEEYRRRAVALAEAAGWEPVDPMRRDFRG |
Ga0070662_1011347141 | 3300005457 | Corn Rhizosphere | MTGKRVYLAGPPFADEYRRRASALLEAASCMPVDPMRRDFRGRT |
Ga0070699_1005255963 | 3300005518 | Corn, Switchgrass And Miscanthus Rhizosphere | MLRVYLAGPPRADEYRRQATELVRARGWEPVDPMRRDFRGRTEGN |
Ga0073909_105136561 | 3300005526 | Surface Soil | VSRVYLAGPPFADEYRRRAAALAEAAGWEPVDPMRRDF |
Ga0070679_1006305531 | 3300005530 | Corn Rhizosphere | VPRVYLAGPPFADEYRLRASALALAAGWEPVDPMRRDFRG |
Ga0070732_103143121 | 3300005542 | Surface Soil | VKRVYLAGPPDADDYRRRASELVRTRGWEPVDPMRRDFRGRTEGNER |
Ga0070704_1010760303 | 3300005549 | Corn, Switchgrass And Miscanthus Rhizosphere | MAGRVYLAGPPFAEEYRRRAAALLREAGVEPVDPMRRDFRGNTTGHES |
Ga0066699_102557194 | 3300005561 | Soil | MPQQPKERRVYLAGPPYAEEYRRRAEGLVRALGWEPVD |
Ga0066694_105132671 | 3300005574 | Soil | VPRVYLAGPPFADEYRRRASALLREAGWEPVDPMRRDFR |
Ga0068854_1012767261 | 3300005578 | Corn Rhizosphere | VPRVYLAGPPFAEEYRRRAVALAKAAGWEPVDPMRRDFRG |
Ga0068864_1015108113 | 3300005618 | Switchgrass Rhizosphere | MRVYLAGPPFADEYRSRADALVRAAGWEPVDPMRRD |
Ga0066903_1060643721 | 3300005764 | Tropical Forest Soil | VTRVYLAGPPFAEEYRRRAAVLLADAGLEPVDPMRR |
Ga0068870_104997951 | 3300005840 | Miscanthus Rhizosphere | VTRVYLAGPPFADEYRRRASELLLAAGCEPVDPMRRDFR |
Ga0068862_1005574854 | 3300005844 | Switchgrass Rhizosphere | MRIYLAGPPFADEYRRRADALVRAAGWEPVDPMRRD |
Ga0070717_104146423 | 3300006028 | Corn, Switchgrass And Miscanthus Rhizosphere | MTAYCSRVRRVYLAGPPFADEYRRRAVRLAHDAGWEPVDPMRRDFRGAT |
Ga0075365_110658072 | 3300006038 | Populus Endosphere | MKRAYLAGPPYAEEYRRRADSLLRAAGWEPVDPLRRDFRGRTEG |
Ga0066652_1002424381 | 3300006046 | Soil | VPRVYLAGPPFADEYRRRARELVRELGWEPVDPMRRDFR |
Ga0070712_1010364541 | 3300006175 | Corn, Switchgrass And Miscanthus Rhizosphere | VKRIYLAGPPFAEEYRRRASALIAARGCEPVDPMRRDFRGGTEG |
Ga0068871_1013001412 | 3300006358 | Miscanthus Rhizosphere | VKRIYLAGPPFAEEYRRRASALIAARGCEPVDPMRRDFR |
Ga0074048_126963431 | 3300006581 | Soil | MAGRRVYLAGPPYADEYQRRAAELAAARGWEPVDPMRRD |
Ga0075431_1017152852 | 3300006847 | Populus Rhizosphere | VRVYLAGPPYAEEYRRRAAQLLDAAGIEAVDPMRRDFRGAT |
Ga0079218_107418464 | 3300007004 | Agricultural Soil | VRIYLAGPPFADEYRRRAAELVRGRGWEPIDPMRRDFRGRTA |
Ga0099827_115867011 | 3300009090 | Vadose Zone Soil | MMDAGGSGGRPLRRVYLAGPPYAEEYRRRAAALVRRSGWEPVDPMRRD |
Ga0075418_117047701 | 3300009100 | Populus Rhizosphere | MMEARGRVYLAGPPYAEEYRRRADALVRRLGWEPVDPMRRDF |
Ga0066709_1030872941 | 3300009137 | Grasslands Soil | VARVYLAGPPFADEYRRRASRLLEEAGQQPVDPMRRDFR |
Ga0114129_129919752 | 3300009147 | Populus Rhizosphere | MRVYLAGPPFAEEYRRRAAELLRERGHEPVDPMRRDFRGRTAGNEVE |
Ga0111538_115312691 | 3300009156 | Populus Rhizosphere | MGLLYAAMRVYLAGPPASDEYRRRADELVRAAGWEPVDPFRRDFR |
Ga0105248_104143591 | 3300009177 | Switchgrass Rhizosphere | VKRVYLAGPPFAEEYRRRAAALVTAHGCEPVDPMRRDFRGRTEGNE |
Ga0126307_114079491 | 3300009789 | Serpentine Soil | MARTLRPVKRVYLAGPPYAEEYRRRAGELVRAAGLEPVDPMRRDYR |
Ga0105067_10254913 | 3300009812 | Groundwater Sand | MGDGVRRVYLAGPPYADEYRRRADRLVRQAGWEPVDPMRRDFRGRTQ |
Ga0105067_10695362 | 3300009812 | Groundwater Sand | VRRVYLAGPPYADEYRRRAAALVREIGWEPVDPMR |
Ga0126309_103373533 | 3300010039 | Serpentine Soil | VRRVYLAGPPWAEEFRRRATELVRGRGWEPVDPMR |
Ga0126306_105841603 | 3300010166 | Serpentine Soil | VYLAGPPWAEEYRRRATELVRARGWEPVDPMRRDFRGNT |
Ga0134082_103422471 | 3300010303 | Grasslands Soil | MKRVYLAGPPFADEYRRSAIALVRELGWEPVDPMRRDF |
Ga0126376_116061391 | 3300010359 | Tropical Forest Soil | VRRVYLAGPPFADEYRRRAAALVQELGWEAVDPMRRDFRG |
Ga0134127_102020331 | 3300010399 | Terrestrial Soil | VRRIYLAGPPFAEEYRRRAAELLAAAGCEPVDPMRRDFRGHT |
Ga0134127_107469773 | 3300010399 | Terrestrial Soil | VPVTGPYSRPVQRVYLAGPPFAEEYRRRAEQLLRERGLEPVDPM |
Ga0137383_106707093 | 3300012199 | Vadose Zone Soil | MPQQQEARRVYLAGPPYAEEYRRRAETLVRALGWEPIDPMRRDYRGRT |
Ga0137378_111299022 | 3300012210 | Vadose Zone Soil | VPRVYLAGPPFADDYRRRATQLVRELEWEPVDPMRRDFRG |
Ga0137386_108851541 | 3300012351 | Vadose Zone Soil | MTRRVYLAGQSYADNYRRRAQALVRAAGWEPVDPM |
Ga0137371_108176863 | 3300012356 | Vadose Zone Soil | MLKLYAEMRVYLAGPPFAEEYRRRAAELIREAGWEPV |
Ga0137390_109154163 | 3300012363 | Vadose Zone Soil | MPRVYLAGPPFADEYRVRASALALAAGWEPVDPMRR |
Ga0157216_100948314 | 3300012668 | Glacier Forefield Soil | MRVYLAGPPYAEEYRRRADALVRAAGWEPVDPMRRDFRGRTEGH |
Ga0136611_102746551 | 3300012682 | Polar Desert Sand | MRVYLAGPPFAEEYRRRAEALVRAAGWEPVDPMRRDFRGRTE |
Ga0157298_102814732 | 3300012913 | Soil | MPSVYLAGPPFAEEYRRRATVLVEALGWEPIDPMRRDFRGRTQ |
Ga0164300_103893293 | 3300012951 | Soil | VKRIYLAGPPFAEEYRRRASALIAARGCEPVDPMR |
Ga0164300_104945521 | 3300012951 | Soil | VRRIYLAGPPFAEEYRRRAAELVGARGCEPVDPMRRDFRGN |
Ga0164298_107518532 | 3300012955 | Soil | VRRIYLAGPPFAEEYRRRAAELLSAQGCEPVDPMRRDFRG |
Ga0164299_107482482 | 3300012958 | Soil | LRVYLAGPPFADEYRRRAVDLLLAAGCEPVDPMRRDF |
Ga0164301_118569011 | 3300012960 | Soil | MPTYSRRVPRVYLAGPPFADEYRRRAVALAEAAGWEPVDPMRRDFR |
Ga0164305_120424951 | 3300012989 | Soil | MAGRRIYLAGPPYAEEYRRRAAGLVATRGWEPVDPMRRD |
Ga0157371_104545611 | 3300013102 | Corn Rhizosphere | VRRIYLAGPPFAEEYRRRAAALVTAHGCEPVDPMRRD |
Ga0163162_104430861 | 3300013306 | Switchgrass Rhizosphere | VRRIYLAGPPFAEEYRRRATELLIGAGCEPVDPMCRDFRGRTEGHEA |
Ga0120158_100425196 | 3300013772 | Permafrost | VYLAGPPFAEEYRRRADALVRAIGWEPVDPMRRDFRGMTVGNEHE |
Ga0120158_104855472 | 3300013772 | Permafrost | VRRVYLAGPPFADEYRRRADALARAAGWEPVDPMRRDFRGATVGHE |
Ga0182007_102415801 | 3300015262 | Rhizosphere | VKRVYLAGPPFADEYRVRASALLEAAGLEAVDPMR |
Ga0132257_1018587692 | 3300015373 | Arabidopsis Rhizosphere | MAGRKIYLAGPPYAEEYRRRAAELVATRGWEPVDPMRRDFRGSTQDK |
Ga0134069_13258392 | 3300017654 | Grasslands Soil | MRVYLAGPPSADDYRRRAIELVRELGWEPVDPFRRDFRGR |
Ga0187809_102265753 | 3300017937 | Freshwater Sediment | VPRVYLAGPPFADEYRRRADELVRMRGWEPVDPMRRDFRGATE |
Ga0184634_104742161 | 3300018031 | Groundwater Sediment | VKRVYLAGPPYADEYRRRADALVRRIGWEPIDPMRRDFR |
Ga0184618_103975551 | 3300018071 | Groundwater Sediment | VKRVYLAGPPFAEEYRRRAEELLREAGLEPVDPMRRDYRGRTE |
Ga0184624_104818292 | 3300018073 | Groundwater Sediment | VRRVYLAGPPFADEYRRRATVLVREHGAEPVDPMRRDFRGG |
Ga0190275_130707032 | 3300018432 | Soil | VRRVYLAGPPYADEYRRRATRLLEQRGLEPLDPMRRDFRGRTEGHE |
Ga0206356_105008912 | 3300020070 | Corn, Switchgrass And Miscanthus Rhizosphere | VKRIYLAGPPFAEEYRRRASALIAARGCEPVDPMRRDFRGG |
Ga0179594_102127533 | 3300020170 | Vadose Zone Soil | MSRVYLAGPPYAEEYRRRADALVRELGWEPVDPMRR |
Ga0193698_10502051 | 3300021968 | Soil | LRRIYLAGPPFAEEYRRRASELVSARGCEPVDPMRRDFRGRTE |
Ga0224512_101975831 | 3300022226 | Sediment | MKRVYLAGPPYAEEYRRRATALARNANWEAVDPMRRDFRGRTSGH |
Ga0247686_10498511 | 3300024177 | Soil | VTRVYLAGPPFAEEYRRRASELLVAAGCEPVDPMRRDF |
Ga0247692_10541133 | 3300024279 | Soil | VPRVYLAGPPFADEYRVRASALAAAAGWEPVDPMRRDFRGGTQ |
Ga0247668_11201031 | 3300024331 | Soil | MGQTLRVKRVYLAGPPFADDYRRRAMELLRARGYEPID |
Ga0209519_103132261 | 3300025318 | Soil | MRRVYLAGPPYAEEYRRRAEALLREAGCEPVDPMRRD |
Ga0209341_106709381 | 3300025325 | Soil | MSQSSKRGAVRSVYLAGPPYADEYRSRAAKLVREIGWEPVDPMRHDYR |
Ga0207707_110068151 | 3300025912 | Corn Rhizosphere | VKRVYLAGPPFAEEYRRRASELLVAAGCEPVDPMRRDFRGRTE |
Ga0207695_106944013 | 3300025913 | Corn Rhizosphere | MPRVYLAGPPFADEYRVRAAALAVAAGWEPVDPMRRDFRSGT |
Ga0207709_116242272 | 3300025935 | Miscanthus Rhizosphere | VRRIYLAGPPFAEEYRRRAAALVTAQGCEPVDPMCRDFRGR |
Ga0207679_114279531 | 3300025945 | Corn Rhizosphere | VKRIYLAGPPFAEEYRRRASALIAARGCEPVDPMRRDF |
Ga0207667_102900604 | 3300025949 | Corn Rhizosphere | VPRVYLAGPPFADDYRRRATALVTELGWEPVDPMRRDYRGRTEGNEA |
Ga0207678_103529163 | 3300026067 | Corn Rhizosphere | VRRIYLAGPPFAEEYRRRASALVSARGCEPVDPMRRDFR |
Ga0207641_102839601 | 3300026088 | Switchgrass Rhizosphere | VRRIYLAGPPFAEEYRRRASSLVSARGCEPVDPMRRDFRGR |
Ga0247684_10188541 | 3300028138 | Soil | VTRVYLAGPPFADEYRRRASELLLSAGCEPVDPMRRDFRGGTEGHE |
Ga0265326_102422352 | 3300028558 | Rhizosphere | VTVALRVYVAGPPFAEEYRRRATELVRERGWEPVDPMRRDFR |
Ga0247828_111728051 | 3300028587 | Soil | MRVYLAGPPFAEEYRRRAAAQMRAAGWEPVDPMRRDFRGAT |
Ga0307285_101855702 | 3300028712 | Soil | VKRVYLAGPPFADEYRRRAAELLLARGCEPVDPMRRDFRGRTEGNEA |
Ga0307303_101044401 | 3300028713 | Soil | VRRVYLAGPPFADEYRVRATALVQEHGGEPVDPMRR |
Ga0307297_100709153 | 3300028754 | Soil | VRRIYLAGPPFAEEYRRRASELVSAHGCEPVDPMRRDYRGNTVGTE |
Ga0265338_112018662 | 3300028800 | Rhizosphere | MQRIYLAGPPYANEYRRRASELLRERGLEPVDPMRRDFRGRTEGNER |
Ga0307305_100432984 | 3300028807 | Soil | VPRVYLAGPPFADDYRRRAAELVRELGWEPVDPMRRDFRGRTEG |
Ga0307296_106463322 | 3300028819 | Soil | VYLAGPPYAEEYRRRATELCEAAGWEVVDPMRRDFRG |
Ga0307277_103585561 | 3300028881 | Soil | VPRVYLAGPPFADEYRIRASALALAAGWEPVNPMRRDFRA |
Ga0307498_104847451 | 3300031170 | Soil | VRRVYLAGPPFADEYRRRATALVQERGGEPIDPMRRDFRGG |
Ga0265339_101553263 | 3300031249 | Rhizosphere | MQRIYLAGPPYADEYRRRASELLLKRGLKPVDPMRR |
Ga0307373_101954253 | 3300031672 | Soil | VSRVYLAGPPFADEYRRRAAALVREAGWEPVDPMRRDYRGRTQG |
Ga0318574_109274712 | 3300031680 | Soil | VTRIYLAGPPSADEYRRRATELIRARGFEPVNPMRRDFRGRTE |
Ga0310813_109703432 | 3300031716 | Soil | VKRIYLAGPPFAEEYRRRAVALVGERGCEPVDPMRRDFRGR |
Ga0307469_120730452 | 3300031720 | Hardwood Forest Soil | MRVYLAGPPFAEEYRRRAAELLRERGHEPVDPMRRDFRGRTVGN |
Ga0318567_100504024 | 3300031821 | Soil | MRVYLAGPPYADEYRARATELLLAAGHEPVDPMRRDFRGGTQGHEA |
Ga0315274_117087071 | 3300031999 | Sediment | VNRVYLAGPPFADEYRRRAAALVRERGWEPIDPMRRDFRGG |
Ga0318563_102235533 | 3300032009 | Soil | VSSRRVYLAGPPFADEYRRRAAELVRAHGWEPVDPMRRDFRGR |
Ga0318518_102578733 | 3300032090 | Soil | MKRVYLAGPPFAEEYRRRASALLAEAGFDPVDPMRRDF |
Ga0315283_110521413 | 3300032164 | Sediment | VNRVYLAGPPFADEYRRRAAALVRERGWEPIDPMRRDFRG |
Ga0315287_100630375 | 3300032397 | Sediment | VNRVYLAGPPFADEYRRRAAALVRERGWEPIDPMRRDFRGATQG |
Ga0315287_117031551 | 3300032397 | Sediment | VNRVYLAGPPFADEYRRRAAALVRERGWEPVDPMRRDFRGGT |
Ga0364924_031309_1_108 | 3300033811 | Sediment | MRSVYLAGPPYADEYRTRAAALVRAIGWEPVAPMRR |
⦗Top⦘ |