NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome / Metatranscriptome Family F080301

Metagenome / Metatranscriptome Family F080301

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F080301
Family Type Metagenome / Metatranscriptome
Number of Sequences 115
Average Sequence Length 41 residues
Representative Sequence VPRVYLAGPPFADEYRRRASALLREAGWEPVDPMRRDFR
Number of Associated Samples 108
Number of Associated Scaffolds 115

Quality Assessment
Transcriptomic Evidence Yes
Most common taxonomic group Bacteria
% of genes with valid RBS motifs 34.78 %
% of genes near scaffold ends (potentially truncated) 99.13 %
% of genes from short scaffolds (< 2000 bps) 96.52 %
Associated GOLD sequencing projects 108
AlphaFold2 3D model prediction Yes
3D model pTM-score0.62

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Bacteria (100.000 % of family members)
NCBI Taxonomy ID 2
Taxonomy All Organisms → cellular organisms → Bacteria

Most Common Ecosystem
GOLD Ecosystem Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil
(14.783 % of family members)
Environment Ontology (ENVO) Unclassified
(30.435 % of family members)
Earth Microbiome Project Ontology (EMPO) Host-associated → Plant → Plant rhizosphere
(40.000 % of family members)



 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      


 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Globular Signal Peptide: No Secondary Structure distribution: α-helix: 19.40%    β-sheet: 8.96%    Coil/Unstructured: 71.64%
Feature Viewer
Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer
Per-residue confidence (pLDDT):
  0-50   51-70   71-90   91-100  
pTM-score: 0.62
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.


 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 115 Family Scaffolds
PF14489QueF 82.61
PF00067p450 5.22
PF08327AHSA1 0.87
PF01227GTP_cyclohydroI 0.87
PF13365Trypsin_2 0.87
PF01209Ubie_methyltran 0.87
PF00144Beta-lactamase 0.87
PF02746MR_MLE_N 0.87
PF05014Nuc_deoxyrib_tr 0.87
PF07883Cupin_2 0.87
PF08279HTH_11 0.87
PF12840HTH_20 0.87

Neighboring Clusters of Orthologous Genes (COGs)

COG IDNameFunctional Category % Frequency in 115 Family Scaffolds
COG2124Cytochrome P450Defense mechanisms [V] 5.22
COG4948L-alanine-DL-glutamate epimerase or related enzyme of enolase superfamilyCell wall/membrane/envelope biogenesis [M] 1.74
COG1680CubicO group peptidase, beta-lactamase class C familyDefense mechanisms [V] 0.87
COG1686D-alanyl-D-alanine carboxypeptidaseCell wall/membrane/envelope biogenesis [M] 0.87
COG2226Ubiquinone/menaquinone biosynthesis C-methylase UbiE/MenGCoenzyme transport and metabolism [H] 0.87
COG22272-polyprenyl-3-methyl-5-hydroxy-6-metoxy-1,4-benzoquinol methylaseCoenzyme transport and metabolism [H] 0.87
COG2367Beta-lactamase class ADefense mechanisms [V] 0.87
COG3613Nucleoside 2-deoxyribosyltransferaseNucleotide transport and metabolism [F] 0.87


 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms100.00 %
UnclassifiedrootN/A0.00 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
2170459017|G14TP7Y01BSJ6OAll Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria650Open in IMG/M
3300000956|JGI10216J12902_112610273All Organisms → cellular organisms → Bacteria689Open in IMG/M
3300000956|JGI10216J12902_115610911All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria587Open in IMG/M
3300001534|A15PFW1_10723807All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium643Open in IMG/M
3300005093|Ga0062594_101585748All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria677Open in IMG/M
3300005334|Ga0068869_100356730All Organisms → cellular organisms → Bacteria1193Open in IMG/M
3300005338|Ga0068868_102114643All Organisms → cellular organisms → Bacteria535Open in IMG/M
3300005338|Ga0068868_102285694All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria516Open in IMG/M
3300005343|Ga0070687_101127471All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria575Open in IMG/M
3300005439|Ga0070711_100316169All Organisms → cellular organisms → Bacteria1246Open in IMG/M
3300005440|Ga0070705_100089174All Organisms → cellular organisms → Bacteria1916Open in IMG/M
3300005450|Ga0066682_10495674All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria774Open in IMG/M
3300005456|Ga0070678_101951950All Organisms → cellular organisms → Bacteria → Terrabacteria group555Open in IMG/M
3300005457|Ga0070662_101134714All Organisms → cellular organisms → Bacteria671Open in IMG/M
3300005518|Ga0070699_100525596All Organisms → cellular organisms → Bacteria1076Open in IMG/M
3300005526|Ga0073909_10513656All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria581Open in IMG/M
3300005530|Ga0070679_100630553All Organisms → cellular organisms → Bacteria1015Open in IMG/M
3300005542|Ga0070732_10314312All Organisms → cellular organisms → Bacteria941Open in IMG/M
3300005549|Ga0070704_101076030All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium730Open in IMG/M
3300005561|Ga0066699_10255719All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1237Open in IMG/M
3300005574|Ga0066694_10513267All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria559Open in IMG/M
3300005578|Ga0068854_101276726All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria660Open in IMG/M
3300005618|Ga0068864_101510811All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria675Open in IMG/M
3300005764|Ga0066903_106064372All Organisms → cellular organisms → Bacteria633Open in IMG/M
3300005840|Ga0068870_10499795All Organisms → cellular organisms → Bacteria810Open in IMG/M
3300005844|Ga0068862_100557485All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1095Open in IMG/M
3300006028|Ga0070717_10414642All Organisms → cellular organisms → Bacteria1211Open in IMG/M
3300006038|Ga0075365_11065807All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium569Open in IMG/M
3300006046|Ga0066652_100242438All Organisms → cellular organisms → Bacteria1574Open in IMG/M
3300006175|Ga0070712_101036454All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria711Open in IMG/M
3300006358|Ga0068871_101300141All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria684Open in IMG/M
3300006581|Ga0074048_12696343All Organisms → cellular organisms → Bacteria572Open in IMG/M
3300006847|Ga0075431_101715285All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria585Open in IMG/M
3300007004|Ga0079218_10741846All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria931Open in IMG/M
3300009090|Ga0099827_11586701All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria570Open in IMG/M
3300009100|Ga0075418_11704770All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium685Open in IMG/M
3300009137|Ga0066709_103087294All Organisms → cellular organisms → Bacteria → Terrabacteria group609Open in IMG/M
3300009147|Ga0114129_12991975All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium556Open in IMG/M
3300009156|Ga0111538_11531269All Organisms → cellular organisms → Bacteria841Open in IMG/M
3300009177|Ga0105248_10414359All Organisms → cellular organisms → Bacteria1517Open in IMG/M
3300009789|Ga0126307_11407949All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria565Open in IMG/M
3300009812|Ga0105067_1025491All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria842Open in IMG/M
3300009812|Ga0105067_1069536All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria592Open in IMG/M
3300010039|Ga0126309_10337353All Organisms → cellular organisms → Bacteria883Open in IMG/M
3300010166|Ga0126306_10584160All Organisms → cellular organisms → Bacteria889Open in IMG/M
3300010303|Ga0134082_10342247All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium632Open in IMG/M
3300010359|Ga0126376_11606139All Organisms → cellular organisms → Bacteria682Open in IMG/M
3300010399|Ga0134127_10202033All Organisms → cellular organisms → Bacteria1849Open in IMG/M
3300010399|Ga0134127_10746977All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1023Open in IMG/M
3300012199|Ga0137383_10670709All Organisms → cellular organisms → Bacteria758Open in IMG/M
3300012210|Ga0137378_11129902All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium698Open in IMG/M
3300012351|Ga0137386_10885154All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria640Open in IMG/M
3300012356|Ga0137371_10817686All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria710Open in IMG/M
3300012363|Ga0137390_10915416All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria831Open in IMG/M
3300012668|Ga0157216_10094831All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium1455Open in IMG/M
3300012682|Ga0136611_10274655All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1121Open in IMG/M
3300012913|Ga0157298_10281473All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria580Open in IMG/M
3300012951|Ga0164300_10389329All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria762Open in IMG/M
3300012951|Ga0164300_10494552All Organisms → cellular organisms → Bacteria697Open in IMG/M
3300012955|Ga0164298_10751853All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria691Open in IMG/M
3300012958|Ga0164299_10748248All Organisms → cellular organisms → Bacteria → Terrabacteria group690Open in IMG/M
3300012960|Ga0164301_11856901All Organisms → cellular organisms → Bacteria → Terrabacteria group508Open in IMG/M
3300012989|Ga0164305_12042495All Organisms → cellular organisms → Bacteria → Terrabacteria group524Open in IMG/M
3300013102|Ga0157371_10454561All Organisms → cellular organisms → Bacteria942Open in IMG/M
3300013306|Ga0163162_10443086All Organisms → cellular organisms → Bacteria1431Open in IMG/M
3300013772|Ga0120158_10042519All Organisms → cellular organisms → Bacteria3265Open in IMG/M
3300013772|Ga0120158_10485547All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria548Open in IMG/M
3300015262|Ga0182007_10241580All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria645Open in IMG/M
3300015373|Ga0132257_101858769All Organisms → cellular organisms → Bacteria774Open in IMG/M
3300017654|Ga0134069_1325839All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria549Open in IMG/M
3300017937|Ga0187809_10226575All Organisms → cellular organisms → Bacteria → Terrabacteria group670Open in IMG/M
3300018031|Ga0184634_10474216All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria562Open in IMG/M
3300018071|Ga0184618_10397555All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria584Open in IMG/M
3300018073|Ga0184624_10481829All Organisms → cellular organisms → Bacteria → Terrabacteria group541Open in IMG/M
3300018432|Ga0190275_13070703All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria540Open in IMG/M
3300020070|Ga0206356_10500891All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria618Open in IMG/M
3300020170|Ga0179594_10212753All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria726Open in IMG/M
3300021968|Ga0193698_1050205All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria536Open in IMG/M
3300022226|Ga0224512_10197583All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1039Open in IMG/M
3300024177|Ga0247686_1049851All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria519Open in IMG/M
3300024279|Ga0247692_1054113All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria623Open in IMG/M
3300024331|Ga0247668_1120103All Organisms → cellular organisms → Bacteria → Terrabacteria group533Open in IMG/M
3300025318|Ga0209519_10313226All Organisms → cellular organisms → Bacteria909Open in IMG/M
3300025325|Ga0209341_10670938All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria802Open in IMG/M
3300025912|Ga0207707_11006815All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria683Open in IMG/M
3300025913|Ga0207695_10694401All Organisms → cellular organisms → Bacteria898Open in IMG/M
3300025935|Ga0207709_11624227All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria537Open in IMG/M
3300025945|Ga0207679_11427953All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria635Open in IMG/M
3300025949|Ga0207667_10290060All Organisms → cellular organisms → Bacteria1672Open in IMG/M
3300026067|Ga0207678_10352916All Organisms → cellular organisms → Bacteria1268Open in IMG/M
3300026088|Ga0207641_10283960All Organisms → cellular organisms → Bacteria1558Open in IMG/M
3300028138|Ga0247684_1018854All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1086Open in IMG/M
3300028558|Ga0265326_10242235All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria521Open in IMG/M
3300028587|Ga0247828_11172805All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria513Open in IMG/M
3300028712|Ga0307285_10185570All Organisms → cellular organisms → Bacteria579Open in IMG/M
3300028713|Ga0307303_10104440All Organisms → cellular organisms → Bacteria652Open in IMG/M
3300028754|Ga0307297_10070915All Organisms → cellular organisms → Bacteria1107Open in IMG/M
3300028800|Ga0265338_11201866All Organisms → cellular organisms → Bacteria508Open in IMG/M
3300028807|Ga0307305_10043298All Organisms → cellular organisms → Bacteria2071Open in IMG/M
3300028819|Ga0307296_10646332All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium579Open in IMG/M
3300028881|Ga0307277_10358556All Organisms → cellular organisms → Bacteria → Terrabacteria group650Open in IMG/M
3300031170|Ga0307498_10484745All Organisms → cellular organisms → Bacteria → Terrabacteria group503Open in IMG/M
3300031249|Ga0265339_10155326All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptomycetales → Streptomycetaceae → Streptomyces1154Open in IMG/M
3300031672|Ga0307373_10195425All Organisms → cellular organisms → Bacteria1463Open in IMG/M
3300031680|Ga0318574_10927471All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium510Open in IMG/M
3300031716|Ga0310813_10970343All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria774Open in IMG/M
3300031720|Ga0307469_12073045All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria553Open in IMG/M
3300031821|Ga0318567_10050402All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria2149Open in IMG/M
3300031999|Ga0315274_11708707All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria584Open in IMG/M
3300032009|Ga0318563_10223553All Organisms → cellular organisms → Bacteria1016Open in IMG/M
3300032090|Ga0318518_10257873All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium895Open in IMG/M
3300032164|Ga0315283_11052141All Organisms → cellular organisms → Bacteria858Open in IMG/M
3300032397|Ga0315287_10063037All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria4114Open in IMG/M
3300032397|Ga0315287_11703155All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria705Open in IMG/M
3300033811|Ga0364924_031309All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1089Open in IMG/M



 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil14.78%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil6.96%
Vadose Zone SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil6.09%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Soil5.22%
Corn, Switchgrass And Miscanthus RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere5.22%
SedimentEnvironmental → Aquatic → Freshwater → Lake → Sediment → Sediment3.48%
Miscanthus RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere3.48%
Populus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere3.48%
Groundwater SedimentEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment2.61%
Serpentine SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Serpentine Soil2.61%
PermafrostEnvironmental → Terrestrial → Soil → Unclassified → Permafrost → Permafrost2.61%
Switchgrass RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere2.61%
RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Rhizosphere2.61%
Corn RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere2.61%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil1.74%
Terrestrial SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil1.74%
Grasslands SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil1.74%
Surface SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil1.74%
Corn RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere1.74%
Groundwater SandEnvironmental → Terrestrial → Soil → Sand → Unclassified → Groundwater Sand1.74%
Corn RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere1.74%
Freshwater SedimentEnvironmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment0.87%
Polar Desert SandEnvironmental → Aquatic → Freshwater → Ice → Unclassified → Polar Desert Sand0.87%
SedimentEnvironmental → Aquatic → Marine → Sediment → Unclassified → Sediment0.87%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil0.87%
Glacier Forefield SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Glacier Forefield Soil0.87%
Corn, Switchgrass And Miscanthus RhizosphereEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Corn, Switchgrass And Miscanthus Rhizosphere0.87%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil0.87%
Agricultural SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil0.87%
Grasslands SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil0.87%
Hardwood Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil0.87%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural → Soil0.87%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil0.87%
Switchgrass RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Switchgrass Rhizosphere0.87%
SoilEnvironmental → Terrestrial → Soil → Loam → Unclassified → Soil0.87%
SoilEnvironmental → Terrestrial → Soil → Clay → Unclassified → Soil0.87%
SedimentEnvironmental → Terrestrial → Floodplain → Sediment → Unclassified → Sediment0.87%
Arabidopsis RhizosphereHost-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere0.87%
Switchgrass RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere0.87%
Miscanthus RhizosphereHost-Associated → Plants → Rhizoplane → Soil → Unclassified → Miscanthus Rhizosphere0.87%
Populus EndosphereHost-Associated → Plants → Roots → Bulk Soil → Unclassified → Populus Endosphere0.87%
Miscanthus RhizosphereHost-Associated → Plants → Roots → Rhizosphere → Soil → Miscanthus Rhizosphere0.87%
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere0.87%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere0.87%
Corn RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere0.87%
Corn RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere0.87%
RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere0.87%
Switchgrass, Maize And Mischanthus LitterEngineered → Solid Waste → Grass → Composting → Unclassified → Switchgrass, Maize And Mischanthus Litter0.87%

Visualization
Powered by ApexCharts



Associated Samples

Taxon OIDSample NameHabitat TypeIMG/M Link
2170459017Litter degradation ZMR4EngineeredOpen in IMG/M
3300000956Soil microbial communities from Great Prairies - Kansas, Native Prairie soilEnvironmentalOpen in IMG/M
3300001534Permafrost active layer microbial communities from McGill Arctic Research Station, Canada - (A15-PF-7A)- 1 week illuminaEnvironmentalOpen in IMG/M
3300005093Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of KBS All BlocksEnvironmentalOpen in IMG/M
3300005334Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2Host-AssociatedOpen in IMG/M
3300005338Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2Host-AssociatedOpen in IMG/M
3300005343Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaGEnvironmentalOpen in IMG/M
3300005439Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaGEnvironmentalOpen in IMG/M
3300005440Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaGEnvironmentalOpen in IMG/M
3300005450Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_131EnvironmentalOpen in IMG/M
3300005456Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaGHost-AssociatedOpen in IMG/M
3300005457Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaGHost-AssociatedOpen in IMG/M
3300005518Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaGEnvironmentalOpen in IMG/M
3300005526Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire. - Coalmine Soil_Cen17_06102014_R1EnvironmentalOpen in IMG/M
3300005530Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaGEnvironmentalOpen in IMG/M
3300005542Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen04_05102014_R1EnvironmentalOpen in IMG/M
3300005549Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaGEnvironmentalOpen in IMG/M
3300005561Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_148EnvironmentalOpen in IMG/M
3300005574Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_143EnvironmentalOpen in IMG/M
3300005578Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2Host-AssociatedOpen in IMG/M
3300005618Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2Host-AssociatedOpen in IMG/M
3300005764Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2)EnvironmentalOpen in IMG/M
3300005840Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2Host-AssociatedOpen in IMG/M
3300005844Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2Host-AssociatedOpen in IMG/M
3300006028Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaGEnvironmentalOpen in IMG/M
3300006038Populus root and rhizosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5Host-AssociatedOpen in IMG/M
3300006046Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_101EnvironmentalOpen in IMG/M
3300006175Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaGEnvironmentalOpen in IMG/M
3300006358Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2Host-AssociatedOpen in IMG/M
3300006581Soil and rhizosphere microbial communities from Centre INRS-Institut Armand-Frappier, Laval, Canada - Soil microcosm metaTmtLPB (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300006847Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5Host-AssociatedOpen in IMG/M
3300007004Agricultural soil microbial communities from Utah to study Nitrogen management - NC CompostEnvironmentalOpen in IMG/M
3300009090Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con1.8 metaGEnvironmentalOpen in IMG/M
3300009100Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD2Host-AssociatedOpen in IMG/M
3300009137Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_158EnvironmentalOpen in IMG/M
3300009147Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2)Host-AssociatedOpen in IMG/M
3300009156Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD1 (version 2)Host-AssociatedOpen in IMG/M
3300009177Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaGHost-AssociatedOpen in IMG/M
3300009789Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot28EnvironmentalOpen in IMG/M
3300009812Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW N2_50_60EnvironmentalOpen in IMG/M
3300010039Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot56EnvironmentalOpen in IMG/M
3300010166Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot27EnvironmentalOpen in IMG/M
3300010303Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_5_09182015EnvironmentalOpen in IMG/M
3300010359Tropical forest soil microbial communities from Panama - MetaG Plot_15EnvironmentalOpen in IMG/M
3300010399Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-3EnvironmentalOpen in IMG/M
3300012199Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_40_16 metaGEnvironmentalOpen in IMG/M
3300012210Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_60_16 metaGEnvironmentalOpen in IMG/M
3300012351Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_100_16 metaGEnvironmentalOpen in IMG/M
3300012356Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_40_16 metaGEnvironmentalOpen in IMG/M
3300012363Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h2.4A metaGEnvironmentalOpen in IMG/M
3300012668Arctic soils microbial communities. Combined Assembly of 23 SPsEnvironmentalOpen in IMG/M
3300012682Polar desert sand microbial communities from Dry Valleys, Antarctica - metaG UQ223 (23.06)EnvironmentalOpen in IMG/M
3300012913Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S043-104R-2EnvironmentalOpen in IMG/M
3300012951Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_226_MGEnvironmentalOpen in IMG/M
3300012955Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_216_MGEnvironmentalOpen in IMG/M
3300012958Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_221_MGEnvironmentalOpen in IMG/M
3300012960Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_231_MGEnvironmentalOpen in IMG/M
3300012989Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_237_MGEnvironmentalOpen in IMG/M
3300013102Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaGHost-AssociatedOpen in IMG/M
3300013306Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaGHost-AssociatedOpen in IMG/M
3300013772Permafrost microbial communities from Nunavut, Canada - A10_80_0.25MEnvironmentalOpen in IMG/M
3300015262Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaGHost-AssociatedOpen in IMG/M
3300015373Combined assembly of cpr5 rhizosphereHost-AssociatedOpen in IMG/M
3300017654Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_40cm_2_24_1 metaGEnvironmentalOpen in IMG/M
3300017937Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - ASW_4EnvironmentalOpen in IMG/M
3300018031Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3-1_200_b1EnvironmentalOpen in IMG/M
3300018071Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM0_30_b1EnvironmentalOpen in IMG/M
3300018073Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3_5_b1EnvironmentalOpen in IMG/M
3300018432Populus adjacent soil microbial communities from riparian zone of Yellowstone River, Montana, USA - 550 TEnvironmentalOpen in IMG/M
3300020070Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2)EnvironmentalOpen in IMG/M
3300020170Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad1_1_08_16fungal (Illumina Assembly)EnvironmentalOpen in IMG/M
3300021968Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? L3c1EnvironmentalOpen in IMG/M
3300022226Sediment microbial communities from San Francisco Bay, California, United States - SF_May12_sed_USGS_13EnvironmentalOpen in IMG/M
3300024177Soil microbial communities from Purdue University Martell Research Forest, Indiana, United States - CNK27EnvironmentalOpen in IMG/M
3300024279Soil microbial communities from Purdue University Martell Research Forest, Indiana, United States - CNK33EnvironmentalOpen in IMG/M
3300024331Soil microbial communities from Purdue University Martell Research Forest, Indiana, United States - CNK09EnvironmentalOpen in IMG/M
3300025318Soil microbial communities from Rifle, Colorado, USA - sediment 13ft 1EnvironmentalOpen in IMG/M
3300025325Soil microbial communities from Rifle, Colorado - Rifle CSP2_sed 13_2 (SPAdes)EnvironmentalOpen in IMG/M
3300025912Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025913Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025935Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025945Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025949Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300026067Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300026088Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300028138Soil microbial communities from Purdue University Martell Research Forest, Indiana, United States - CNK25EnvironmentalOpen in IMG/M
3300028558Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaGHost-AssociatedOpen in IMG/M
3300028587Soil microbial communities from agricultural site in Penn Yan, New York, United States - 12C_Control_Day3EnvironmentalOpen in IMG/M
3300028712Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_139EnvironmentalOpen in IMG/M
3300028713Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_184EnvironmentalOpen in IMG/M
3300028754Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_157EnvironmentalOpen in IMG/M
3300028800Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaGHost-AssociatedOpen in IMG/M
3300028807Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_186EnvironmentalOpen in IMG/M
3300028819Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_153EnvironmentalOpen in IMG/M
3300028881Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_116EnvironmentalOpen in IMG/M
3300031170Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 12_SEnvironmentalOpen in IMG/M
3300031249Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaGHost-AssociatedOpen in IMG/M
3300031672Soil microbial communities from Risofladan, Vaasa, Finland - OX-2EnvironmentalOpen in IMG/M
3300031680Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f22EnvironmentalOpen in IMG/M
3300031716Soil microbial communities from experimental microcosm in Duke University, North Carolina, United States - YN3EnvironmentalOpen in IMG/M
3300031720Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM2C_515EnvironmentalOpen in IMG/M
3300031821Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.088b5f20EnvironmentalOpen in IMG/M
3300031999Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G02_20EnvironmentalOpen in IMG/M
3300032009Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.066b5f19EnvironmentalOpen in IMG/M
3300032090Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f22EnvironmentalOpen in IMG/M
3300032164Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G09_0EnvironmentalOpen in IMG/M
3300032397Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G11_0EnvironmentalOpen in IMG/M
3300033811Sediment microbial communities from East River floodplain, Colorado, United States - 28_j17EnvironmentalOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap



 ⦗Top⦘

Family Sequences

Protein ID Sample Taxon ID Habitat Sequence
4ZMR_031928302170459017Switchgrass, Maize And Mischanthus LitterMTEARGRVYLAGPPYAEEYRRRAEALVRELGWEPVDPMRRD
JGI10216J12902_11261027333300000956SoilVPRVYLAGPPFADDYRRRAETLVREAGWEPVDPMRRDFRG
JGI10216J12902_11561091123300000956SoilMRIYLAGPPFAEEYRRRASALVRAAGWEPVDPMRR
A15PFW1_1072380713300001534PermafrostVPRVYLAGPPFADEYRVRASELARAAGWEPVDPMRRDFRGGAESH
Ga0062594_10158574813300005093SoilVRRIYLAGPPFAEEYRRRAAALVTAHGCEPVDPMRRDFRGRTEGNE
Ga0068869_10035673033300005334Miscanthus RhizosphereVRRIYLAGPPFAEEYRRRAAALVTAHGCEPVDPMRRDFRGRTE
Ga0068868_10211464323300005338Miscanthus RhizosphereVRRVYLAGPPFAEEYRRRAAELLAAAGCEPVDPMRRDFRGNTVGHEA
Ga0068868_10228569423300005338Miscanthus RhizosphereVPRVYLAGPPFAEEYRRRAVALAEAAGWEPVDPMRRDFRGHTQGH
Ga0070687_10112747113300005343Switchgrass RhizosphereVRRIYLAGPPFAEEYRRRASALVSARGCEPVDPMRRDFRGRTE
Ga0070711_10031616943300005439Corn, Switchgrass And Miscanthus RhizosphereVPRVYLAGPPFSDEYRKRAVALCREHGWETVDPMRRDFRGAT
Ga0070705_10008917413300005440Corn, Switchgrass And Miscanthus RhizosphereVRRVYLAGPPFAEEYRRRASELLVAAGCEPVDPMRRDFRGRTE
Ga0066682_1049567413300005450SoilVLRVYVAGPPFAEEYRRRASTLLRAAGLEPVDPMRRDFRGR
Ga0070678_10195195013300005456Miscanthus RhizosphereMPTYSRRVPRVYLAGPPFAEEYRRRAVALAEAAGWEPVDPMRRDFRG
Ga0070662_10113471413300005457Corn RhizosphereMTGKRVYLAGPPFADEYRRRASALLEAASCMPVDPMRRDFRGRT
Ga0070699_10052559633300005518Corn, Switchgrass And Miscanthus RhizosphereMLRVYLAGPPRADEYRRQATELVRARGWEPVDPMRRDFRGRTEGN
Ga0073909_1051365613300005526Surface SoilVSRVYLAGPPFADEYRRRAAALAEAAGWEPVDPMRRDF
Ga0070679_10063055313300005530Corn RhizosphereVPRVYLAGPPFADEYRLRASALALAAGWEPVDPMRRDFRG
Ga0070732_1031431213300005542Surface SoilVKRVYLAGPPDADDYRRRASELVRTRGWEPVDPMRRDFRGRTEGNER
Ga0070704_10107603033300005549Corn, Switchgrass And Miscanthus RhizosphereMAGRVYLAGPPFAEEYRRRAAALLREAGVEPVDPMRRDFRGNTTGHES
Ga0066699_1025571943300005561SoilMPQQPKERRVYLAGPPYAEEYRRRAEGLVRALGWEPVD
Ga0066694_1051326713300005574SoilVPRVYLAGPPFADEYRRRASALLREAGWEPVDPMRRDFR
Ga0068854_10127672613300005578Corn RhizosphereVPRVYLAGPPFAEEYRRRAVALAKAAGWEPVDPMRRDFRG
Ga0068864_10151081133300005618Switchgrass RhizosphereMRVYLAGPPFADEYRSRADALVRAAGWEPVDPMRRD
Ga0066903_10606437213300005764Tropical Forest SoilVTRVYLAGPPFAEEYRRRAAVLLADAGLEPVDPMRR
Ga0068870_1049979513300005840Miscanthus RhizosphereVTRVYLAGPPFADEYRRRASELLLAAGCEPVDPMRRDFR
Ga0068862_10055748543300005844Switchgrass RhizosphereMRIYLAGPPFADEYRRRADALVRAAGWEPVDPMRRD
Ga0070717_1041464233300006028Corn, Switchgrass And Miscanthus RhizosphereMTAYCSRVRRVYLAGPPFADEYRRRAVRLAHDAGWEPVDPMRRDFRGAT
Ga0075365_1106580723300006038Populus EndosphereMKRAYLAGPPYAEEYRRRADSLLRAAGWEPVDPLRRDFRGRTEG
Ga0066652_10024243813300006046SoilVPRVYLAGPPFADEYRRRARELVRELGWEPVDPMRRDFR
Ga0070712_10103645413300006175Corn, Switchgrass And Miscanthus RhizosphereVKRIYLAGPPFAEEYRRRASALIAARGCEPVDPMRRDFRGGTEG
Ga0068871_10130014123300006358Miscanthus RhizosphereVKRIYLAGPPFAEEYRRRASALIAARGCEPVDPMRRDFR
Ga0074048_1269634313300006581SoilMAGRRVYLAGPPYADEYQRRAAELAAARGWEPVDPMRRD
Ga0075431_10171528523300006847Populus RhizosphereVRVYLAGPPYAEEYRRRAAQLLDAAGIEAVDPMRRDFRGAT
Ga0079218_1074184643300007004Agricultural SoilVRIYLAGPPFADEYRRRAAELVRGRGWEPIDPMRRDFRGRTA
Ga0099827_1158670113300009090Vadose Zone SoilMMDAGGSGGRPLRRVYLAGPPYAEEYRRRAAALVRRSGWEPVDPMRRD
Ga0075418_1170477013300009100Populus RhizosphereMMEARGRVYLAGPPYAEEYRRRADALVRRLGWEPVDPMRRDF
Ga0066709_10308729413300009137Grasslands SoilVARVYLAGPPFADEYRRRASRLLEEAGQQPVDPMRRDFR
Ga0114129_1299197523300009147Populus RhizosphereMRVYLAGPPFAEEYRRRAAELLRERGHEPVDPMRRDFRGRTAGNEVE
Ga0111538_1153126913300009156Populus RhizosphereMGLLYAAMRVYLAGPPASDEYRRRADELVRAAGWEPVDPFRRDFR
Ga0105248_1041435913300009177Switchgrass RhizosphereVKRVYLAGPPFAEEYRRRAAALVTAHGCEPVDPMRRDFRGRTEGNE
Ga0126307_1140794913300009789Serpentine SoilMARTLRPVKRVYLAGPPYAEEYRRRAGELVRAAGLEPVDPMRRDYR
Ga0105067_102549133300009812Groundwater SandMGDGVRRVYLAGPPYADEYRRRADRLVRQAGWEPVDPMRRDFRGRTQ
Ga0105067_106953623300009812Groundwater SandVRRVYLAGPPYADEYRRRAAALVREIGWEPVDPMR
Ga0126309_1033735333300010039Serpentine SoilVRRVYLAGPPWAEEFRRRATELVRGRGWEPVDPMR
Ga0126306_1058416033300010166Serpentine SoilVYLAGPPWAEEYRRRATELVRARGWEPVDPMRRDFRGNT
Ga0134082_1034224713300010303Grasslands SoilMKRVYLAGPPFADEYRRSAIALVRELGWEPVDPMRRDF
Ga0126376_1160613913300010359Tropical Forest SoilVRRVYLAGPPFADEYRRRAAALVQELGWEAVDPMRRDFRG
Ga0134127_1020203313300010399Terrestrial SoilVRRIYLAGPPFAEEYRRRAAELLAAAGCEPVDPMRRDFRGHT
Ga0134127_1074697733300010399Terrestrial SoilVPVTGPYSRPVQRVYLAGPPFAEEYRRRAEQLLRERGLEPVDPM
Ga0137383_1067070933300012199Vadose Zone SoilMPQQQEARRVYLAGPPYAEEYRRRAETLVRALGWEPIDPMRRDYRGRT
Ga0137378_1112990223300012210Vadose Zone SoilVPRVYLAGPPFADDYRRRATQLVRELEWEPVDPMRRDFRG
Ga0137386_1088515413300012351Vadose Zone SoilMTRRVYLAGQSYADNYRRRAQALVRAAGWEPVDPM
Ga0137371_1081768633300012356Vadose Zone SoilMLKLYAEMRVYLAGPPFAEEYRRRAAELIREAGWEPV
Ga0137390_1091541633300012363Vadose Zone SoilMPRVYLAGPPFADEYRVRASALALAAGWEPVDPMRR
Ga0157216_1009483143300012668Glacier Forefield SoilMRVYLAGPPYAEEYRRRADALVRAAGWEPVDPMRRDFRGRTEGH
Ga0136611_1027465513300012682Polar Desert SandMRVYLAGPPFAEEYRRRAEALVRAAGWEPVDPMRRDFRGRTE
Ga0157298_1028147323300012913SoilMPSVYLAGPPFAEEYRRRATVLVEALGWEPIDPMRRDFRGRTQ
Ga0164300_1038932933300012951SoilVKRIYLAGPPFAEEYRRRASALIAARGCEPVDPMR
Ga0164300_1049455213300012951SoilVRRIYLAGPPFAEEYRRRAAELVGARGCEPVDPMRRDFRGN
Ga0164298_1075185323300012955SoilVRRIYLAGPPFAEEYRRRAAELLSAQGCEPVDPMRRDFRG
Ga0164299_1074824823300012958SoilLRVYLAGPPFADEYRRRAVDLLLAAGCEPVDPMRRDF
Ga0164301_1185690113300012960SoilMPTYSRRVPRVYLAGPPFADEYRRRAVALAEAAGWEPVDPMRRDFR
Ga0164305_1204249513300012989SoilMAGRRIYLAGPPYAEEYRRRAAGLVATRGWEPVDPMRRD
Ga0157371_1045456113300013102Corn RhizosphereVRRIYLAGPPFAEEYRRRAAALVTAHGCEPVDPMRRD
Ga0163162_1044308613300013306Switchgrass RhizosphereVRRIYLAGPPFAEEYRRRATELLIGAGCEPVDPMCRDFRGRTEGHEA
Ga0120158_1004251963300013772PermafrostVYLAGPPFAEEYRRRADALVRAIGWEPVDPMRRDFRGMTVGNEHE
Ga0120158_1048554723300013772PermafrostVRRVYLAGPPFADEYRRRADALARAAGWEPVDPMRRDFRGATVGHE
Ga0182007_1024158013300015262RhizosphereVKRVYLAGPPFADEYRVRASALLEAAGLEAVDPMR
Ga0132257_10185876923300015373Arabidopsis RhizosphereMAGRKIYLAGPPYAEEYRRRAAELVATRGWEPVDPMRRDFRGSTQDK
Ga0134069_132583923300017654Grasslands SoilMRVYLAGPPSADDYRRRAIELVRELGWEPVDPFRRDFRGR
Ga0187809_1022657533300017937Freshwater SedimentVPRVYLAGPPFADEYRRRADELVRMRGWEPVDPMRRDFRGATE
Ga0184634_1047421613300018031Groundwater SedimentVKRVYLAGPPYADEYRRRADALVRRIGWEPIDPMRRDFR
Ga0184618_1039755513300018071Groundwater SedimentVKRVYLAGPPFAEEYRRRAEELLREAGLEPVDPMRRDYRGRTE
Ga0184624_1048182923300018073Groundwater SedimentVRRVYLAGPPFADEYRRRATVLVREHGAEPVDPMRRDFRGG
Ga0190275_1307070323300018432SoilVRRVYLAGPPYADEYRRRATRLLEQRGLEPLDPMRRDFRGRTEGHE
Ga0206356_1050089123300020070Corn, Switchgrass And Miscanthus RhizosphereVKRIYLAGPPFAEEYRRRASALIAARGCEPVDPMRRDFRGG
Ga0179594_1021275333300020170Vadose Zone SoilMSRVYLAGPPYAEEYRRRADALVRELGWEPVDPMRR
Ga0193698_105020513300021968SoilLRRIYLAGPPFAEEYRRRASELVSARGCEPVDPMRRDFRGRTE
Ga0224512_1019758313300022226SedimentMKRVYLAGPPYAEEYRRRATALARNANWEAVDPMRRDFRGRTSGH
Ga0247686_104985113300024177SoilVTRVYLAGPPFAEEYRRRASELLVAAGCEPVDPMRRDF
Ga0247692_105411333300024279SoilVPRVYLAGPPFADEYRVRASALAAAAGWEPVDPMRRDFRGGTQ
Ga0247668_112010313300024331SoilMGQTLRVKRVYLAGPPFADDYRRRAMELLRARGYEPID
Ga0209519_1031322613300025318SoilMRRVYLAGPPYAEEYRRRAEALLREAGCEPVDPMRRD
Ga0209341_1067093813300025325SoilMSQSSKRGAVRSVYLAGPPYADEYRSRAAKLVREIGWEPVDPMRHDYR
Ga0207707_1100681513300025912Corn RhizosphereVKRVYLAGPPFAEEYRRRASELLVAAGCEPVDPMRRDFRGRTE
Ga0207695_1069440133300025913Corn RhizosphereMPRVYLAGPPFADEYRVRAAALAVAAGWEPVDPMRRDFRSGT
Ga0207709_1162422723300025935Miscanthus RhizosphereVRRIYLAGPPFAEEYRRRAAALVTAQGCEPVDPMCRDFRGR
Ga0207679_1142795313300025945Corn RhizosphereVKRIYLAGPPFAEEYRRRASALIAARGCEPVDPMRRDF
Ga0207667_1029006043300025949Corn RhizosphereVPRVYLAGPPFADDYRRRATALVTELGWEPVDPMRRDYRGRTEGNEA
Ga0207678_1035291633300026067Corn RhizosphereVRRIYLAGPPFAEEYRRRASALVSARGCEPVDPMRRDFR
Ga0207641_1028396013300026088Switchgrass RhizosphereVRRIYLAGPPFAEEYRRRASSLVSARGCEPVDPMRRDFRGR
Ga0247684_101885413300028138SoilVTRVYLAGPPFADEYRRRASELLLSAGCEPVDPMRRDFRGGTEGHE
Ga0265326_1024223523300028558RhizosphereVTVALRVYVAGPPFAEEYRRRATELVRERGWEPVDPMRRDFR
Ga0247828_1117280513300028587SoilMRVYLAGPPFAEEYRRRAAAQMRAAGWEPVDPMRRDFRGAT
Ga0307285_1018557023300028712SoilVKRVYLAGPPFADEYRRRAAELLLARGCEPVDPMRRDFRGRTEGNEA
Ga0307303_1010444013300028713SoilVRRVYLAGPPFADEYRVRATALVQEHGGEPVDPMRR
Ga0307297_1007091533300028754SoilVRRIYLAGPPFAEEYRRRASELVSAHGCEPVDPMRRDYRGNTVGTE
Ga0265338_1120186623300028800RhizosphereMQRIYLAGPPYANEYRRRASELLRERGLEPVDPMRRDFRGRTEGNER
Ga0307305_1004329843300028807SoilVPRVYLAGPPFADDYRRRAAELVRELGWEPVDPMRRDFRGRTEG
Ga0307296_1064633223300028819SoilVYLAGPPYAEEYRRRATELCEAAGWEVVDPMRRDFRG
Ga0307277_1035855613300028881SoilVPRVYLAGPPFADEYRIRASALALAAGWEPVNPMRRDFRA
Ga0307498_1048474513300031170SoilVRRVYLAGPPFADEYRRRATALVQERGGEPIDPMRRDFRGG
Ga0265339_1015532633300031249RhizosphereMQRIYLAGPPYADEYRRRASELLLKRGLKPVDPMRR
Ga0307373_1019542533300031672SoilVSRVYLAGPPFADEYRRRAAALVREAGWEPVDPMRRDYRGRTQG
Ga0318574_1092747123300031680SoilVTRIYLAGPPSADEYRRRATELIRARGFEPVNPMRRDFRGRTE
Ga0310813_1097034323300031716SoilVKRIYLAGPPFAEEYRRRAVALVGERGCEPVDPMRRDFRGR
Ga0307469_1207304523300031720Hardwood Forest SoilMRVYLAGPPFAEEYRRRAAELLRERGHEPVDPMRRDFRGRTVGN
Ga0318567_1005040243300031821SoilMRVYLAGPPYADEYRARATELLLAAGHEPVDPMRRDFRGGTQGHEA
Ga0315274_1170870713300031999SedimentVNRVYLAGPPFADEYRRRAAALVRERGWEPIDPMRRDFRGG
Ga0318563_1022355333300032009SoilVSSRRVYLAGPPFADEYRRRAAELVRAHGWEPVDPMRRDFRGR
Ga0318518_1025787333300032090SoilMKRVYLAGPPFAEEYRRRASALLAEAGFDPVDPMRRDF
Ga0315283_1105214133300032164SedimentVNRVYLAGPPFADEYRRRAAALVRERGWEPIDPMRRDFRG
Ga0315287_1006303753300032397SedimentVNRVYLAGPPFADEYRRRAAALVRERGWEPIDPMRRDFRGATQG
Ga0315287_1170315513300032397SedimentVNRVYLAGPPFADEYRRRAAALVRERGWEPVDPMRRDFRGGT
Ga0364924_031309_1_1083300033811SedimentMRSVYLAGPPYADEYRTRAAALVRAIGWEPVAPMRR


 ⦗Top⦘


© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.