NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome / Metatranscriptome Family F080296

Metagenome / Metatranscriptome Family F080296

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F080296
Family Type Metagenome / Metatranscriptome
Number of Sequences 115
Average Sequence Length 45 residues
Representative Sequence HRLMAATRKRKAEDRHAREALAQDNLYPRIAALSRRVLRSEKV
Number of Associated Samples 107
Number of Associated Scaffolds 115

Quality Assessment
Transcriptomic Evidence Yes
Most common taxonomic group Bacteria
% of genes with valid RBS motifs 46.96 %
% of genes near scaffold ends (potentially truncated) 31.30 %
% of genes from short scaffolds (< 2000 bps) 82.61 %
Associated GOLD sequencing projects 100
AlphaFold2 3D model prediction No

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Bacteria (62.609 % of family members)
NCBI Taxonomy ID 2
Taxonomy All Organisms → cellular organisms → Bacteria

Most Common Ecosystem
GOLD Ecosystem Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil
(8.696 % of family members)
Environment Ontology (ENVO) Unclassified
(17.391 % of family members)
Earth Microbiome Project Ontology (EMPO) Free-living → Non-saline → Soil (non-saline)
(45.217 % of family members)



 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      


 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Globular Signal Peptide: No Secondary Structure distribution: α-helix: 86.05%    β-sheet: 0.00%    Coil/Unstructured: 13.95%
Feature Viewer
Powered by Feature Viewer


 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 115 Family Scaffolds
PF10162G8 26.09
PF13432TPR_16 6.09
PF00589Phage_integrase 2.61
PF04255DUF433 1.74
PF13470PIN_3 0.87
PF00881Nitroreductase 0.87
PF01402RHH_1 0.87
PF13565HTH_32 0.87
PF14319Zn_Tnp_IS91 0.87
PF01663Phosphodiest 0.87
PF03551PadR 0.87
PF01979Amidohydro_1 0.87
PF13189Cytidylate_kin2 0.87
PF12867DinB_2 0.87
PF00265TK 0.87
PF07638Sigma70_ECF 0.87

Neighboring Clusters of Orthologous Genes (COGs)

COG IDNameFunctional Category % Frequency in 115 Family Scaffolds
COG2442Predicted antitoxin component of a toxin-antitoxin system, DUF433 familyDefense mechanisms [V] 1.74
COG1435Thymidine kinaseNucleotide transport and metabolism [F] 0.87
COG1595DNA-directed RNA polymerase specialized sigma subunit, sigma24 familyTranscription [K] 0.87
COG1695DNA-binding transcriptional regulator, PadR familyTranscription [K] 0.87
COG1733DNA-binding transcriptional regulator, HxlR familyTranscription [K] 0.87
COG1846DNA-binding transcriptional regulator, MarR familyTranscription [K] 0.87


 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms62.61 %
UnclassifiedrootN/A37.39 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
3300000567|JGI12270J11330_10029447Not Available3239Open in IMG/M
3300000793|AF_2010_repII_A001DRAFT_10125054Not Available537Open in IMG/M
3300005330|Ga0070690_100049965All Organisms → cellular organisms → Bacteria2667Open in IMG/M
3300005332|Ga0066388_102050409Not Available1027Open in IMG/M
3300005335|Ga0070666_10195942All Organisms → cellular organisms → Bacteria → Acidobacteria1421Open in IMG/M
3300005339|Ga0070660_100403364Not Available1131Open in IMG/M
3300005435|Ga0070714_100461536All Organisms → cellular organisms → Bacteria1207Open in IMG/M
3300005439|Ga0070711_100194277All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1562Open in IMG/M
3300005454|Ga0066687_10695754All Organisms → cellular organisms → Bacteria604Open in IMG/M
3300005467|Ga0070706_101153209All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium713Open in IMG/M
3300005533|Ga0070734_10023973All Organisms → cellular organisms → Bacteria → Acidobacteria3965Open in IMG/M
3300005533|Ga0070734_10080566All Organisms → cellular organisms → Bacteria1925Open in IMG/M
3300005542|Ga0070732_10209435All Organisms → cellular organisms → Bacteria1166Open in IMG/M
3300005545|Ga0070695_100468568All Organisms → cellular organisms → Bacteria968Open in IMG/M
3300005591|Ga0070761_10283493All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → unclassified Terriglobia → Acidobacteriia bacterium994Open in IMG/M
3300005618|Ga0068864_100431135All Organisms → cellular organisms → Bacteria → Acidobacteria1258Open in IMG/M
3300005718|Ga0068866_11343691Not Available521Open in IMG/M
3300005836|Ga0074470_11402206All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → Cystobacterineae → Myxococcaceae → Myxococcus → Myxococcus virescens913Open in IMG/M
3300005836|Ga0074470_11550880All Organisms → cellular organisms → Bacteria21295Open in IMG/M
3300006028|Ga0070717_10335801All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → unclassified Terriglobia → Acidobacteriia bacterium1348Open in IMG/M
3300006041|Ga0075023_100071583All Organisms → cellular organisms → Bacteria1139Open in IMG/M
3300006047|Ga0075024_100634616All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → unclassified Terriglobia → Acidobacteriia bacterium578Open in IMG/M
3300006162|Ga0075030_100243992Not Available1440Open in IMG/M
3300006175|Ga0070712_101502154Not Available589Open in IMG/M
3300006638|Ga0075522_10129517All Organisms → cellular organisms → Bacteria1333Open in IMG/M
3300006903|Ga0075426_10896489Not Available669Open in IMG/M
3300006954|Ga0079219_12359881All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → unclassified Terriglobia → Acidobacteriia bacterium515Open in IMG/M
3300009093|Ga0105240_10977229All Organisms → cellular organisms → Bacteria907Open in IMG/M
3300009148|Ga0105243_11300149All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium744Open in IMG/M
3300009520|Ga0116214_1085902All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → unclassified Terriglobia → Acidobacteriia bacterium1153Open in IMG/M
3300009545|Ga0105237_12587786Not Available518Open in IMG/M
3300009700|Ga0116217_10271557All Organisms → cellular organisms → Bacteria1096Open in IMG/M
3300010049|Ga0123356_10074130All Organisms → cellular organisms → Bacteria3202Open in IMG/M
3300010159|Ga0099796_10446288Not Available575Open in IMG/M
3300010339|Ga0074046_10044501All Organisms → cellular organisms → Bacteria → Proteobacteria2969Open in IMG/M
3300010343|Ga0074044_10997556Not Available549Open in IMG/M
3300010358|Ga0126370_10479049All Organisms → cellular organisms → Bacteria1045Open in IMG/M
3300010373|Ga0134128_10339104All Organisms → cellular organisms → Bacteria1680Open in IMG/M
3300010376|Ga0126381_102237667All Organisms → cellular organisms → Bacteria786Open in IMG/M
3300010376|Ga0126381_104562523Not Available534Open in IMG/M
3300010379|Ga0136449_103894221Not Available560Open in IMG/M
3300012211|Ga0137377_10307863All Organisms → cellular organisms → Bacteria1519Open in IMG/M
3300012917|Ga0137395_10682430All Organisms → cellular organisms → Bacteria743Open in IMG/M
3300012930|Ga0137407_10756321Not Available917Open in IMG/M
3300012960|Ga0164301_11675758Not Available530Open in IMG/M
3300013104|Ga0157370_11080209Not Available725Open in IMG/M
3300013308|Ga0157375_12753456Not Available588Open in IMG/M
3300014156|Ga0181518_10257922All Organisms → cellular organisms → Bacteria → Acidobacteria883Open in IMG/M
3300014489|Ga0182018_10014279All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae5487Open in IMG/M
3300014838|Ga0182030_11401730All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → unclassified Terriglobia → Acidobacteriia bacterium583Open in IMG/M
3300016294|Ga0182041_11391608Not Available644Open in IMG/M
3300016341|Ga0182035_11836191Not Available549Open in IMG/M
3300016445|Ga0182038_11229236Not Available668Open in IMG/M
3300016445|Ga0182038_11726627All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium564Open in IMG/M
3300017821|Ga0187812_1134066Not Available801Open in IMG/M
3300017822|Ga0187802_10071119All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Candidatus Acidoferrales → Candidatus Acidoferrum → Candidatus Acidoferrum panamensis1290Open in IMG/M
3300017823|Ga0187818_10125008All Organisms → cellular organisms → Bacteria1116Open in IMG/M
3300017924|Ga0187820_1305124Not Available525Open in IMG/M
3300017928|Ga0187806_1240377All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → unclassified Terriglobia → Acidobacteriia bacterium624Open in IMG/M
3300017931|Ga0187877_1264551All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → unclassified Terriglobia → Acidobacteriia bacterium661Open in IMG/M
3300017936|Ga0187821_10204383All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium760Open in IMG/M
3300017943|Ga0187819_10046957All Organisms → cellular organisms → Bacteria2559Open in IMG/M
3300017966|Ga0187776_11529898Not Available513Open in IMG/M
3300017970|Ga0187783_10113345All Organisms → cellular organisms → Bacteria1998Open in IMG/M
3300017970|Ga0187783_10331575All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae1108Open in IMG/M
3300018006|Ga0187804_10230050Not Available797Open in IMG/M
3300018012|Ga0187810_10032422All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Candidatus Acidoferrales → Candidatus Acidoferrum → Candidatus Acidoferrum panamensis1922Open in IMG/M
3300018019|Ga0187874_10034357All Organisms → cellular organisms → Bacteria2477Open in IMG/M
3300018035|Ga0187875_10335230All Organisms → cellular organisms → Bacteria815Open in IMG/M
3300018086|Ga0187769_10381746All Organisms → cellular organisms → Bacteria → Acidobacteria1059Open in IMG/M
3300021088|Ga0210404_10489427All Organisms → cellular organisms → Bacteria694Open in IMG/M
3300021181|Ga0210388_10071732All Organisms → cellular organisms → Bacteria2920Open in IMG/M
3300021420|Ga0210394_10454291All Organisms → cellular organisms → Bacteria1127Open in IMG/M
3300021420|Ga0210394_11456508Not Available580Open in IMG/M
3300021432|Ga0210384_10301902Not Available1441Open in IMG/M
3300021474|Ga0210390_11400782Not Available557Open in IMG/M
3300021861|Ga0213853_11363794Not Available529Open in IMG/M
3300025862|Ga0209483_1005515All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium7824Open in IMG/M
3300025900|Ga0207710_10461095All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → unclassified Terriglobia → Acidobacteriia bacterium657Open in IMG/M
3300025905|Ga0207685_10469785All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium657Open in IMG/M
3300025949|Ga0207667_12151948Not Available516Open in IMG/M
3300026035|Ga0207703_10125383All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Edaphobacter → Edaphobacter aggregans2210Open in IMG/M
3300026078|Ga0207702_12210734Not Available539Open in IMG/M
3300026095|Ga0207676_10470715All Organisms → cellular organisms → Bacteria → Acidobacteria1188Open in IMG/M
3300026291|Ga0209890_10122880All Organisms → cellular organisms → Bacteria883Open in IMG/M
3300026322|Ga0209687_1165601All Organisms → cellular organisms → Bacteria704Open in IMG/M
3300027692|Ga0209530_1113752All Organisms → cellular organisms → Bacteria766Open in IMG/M
3300027855|Ga0209693_10488005Not Available590Open in IMG/M
3300027874|Ga0209465_10351421Not Available738Open in IMG/M
3300027905|Ga0209415_11006880Not Available553Open in IMG/M
3300029910|Ga0311369_10851520Not Available733Open in IMG/M
3300029951|Ga0311371_11574720All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → unclassified Terriglobia → Acidobacteriia bacterium726Open in IMG/M
3300030617|Ga0311356_11973279Not Available516Open in IMG/M
3300030737|Ga0302310_10496304All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → unclassified Terriglobia → Acidobacteriia bacterium656Open in IMG/M
3300031057|Ga0170834_107794115Not Available521Open in IMG/M
3300031231|Ga0170824_104471257Not Available648Open in IMG/M
3300031234|Ga0302325_12859545Not Available563Open in IMG/M
3300031236|Ga0302324_100284567Not Available2548Open in IMG/M
3300031474|Ga0170818_113302156All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → unclassified Terriglobia → Acidobacteriia bacterium609Open in IMG/M
3300031525|Ga0302326_10124051All Organisms → cellular organisms → Bacteria4532Open in IMG/M
3300031561|Ga0318528_10483166All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → unclassified Terriglobia → Acidobacteriia bacterium665Open in IMG/M
3300031681|Ga0318572_10938926Not Available514Open in IMG/M
3300031708|Ga0310686_102912136Not Available3202Open in IMG/M
3300031708|Ga0310686_110612072All Organisms → cellular organisms → Bacteria4505Open in IMG/M
3300031748|Ga0318492_10742736Not Available527Open in IMG/M
3300031753|Ga0307477_10348761All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Verrucomicrobiae → Verrucomicrobiales → Verrucomicrobiaceae1018Open in IMG/M
3300031782|Ga0318552_10235394All Organisms → cellular organisms → Bacteria929Open in IMG/M
3300031879|Ga0306919_10236074All Organisms → cellular organisms → Bacteria1372Open in IMG/M
3300031912|Ga0306921_12351857Not Available557Open in IMG/M
3300032160|Ga0311301_10017734All Organisms → cellular organisms → Bacteria20706Open in IMG/M
3300032160|Ga0311301_11645571All Organisms → cellular organisms → Bacteria777Open in IMG/M
3300032261|Ga0306920_101922770All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium831Open in IMG/M
3300032892|Ga0335081_10044850All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium RIFOXYD12_FULL_57_126987Open in IMG/M
3300033158|Ga0335077_10065011All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium RIFOXYD12_FULL_57_124376Open in IMG/M
3300033412|Ga0310810_10126852All Organisms → cellular organisms → Bacteria3002Open in IMG/M



 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil8.70%
Freshwater SedimentEnvironmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment7.83%
Peatlands SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil6.09%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil6.09%
PalsaEnvironmental → Terrestrial → Peat → Unclassified → Unclassified → Palsa6.09%
Corn, Switchgrass And Miscanthus RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere5.22%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil3.48%
Vadose Zone SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil3.48%
Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil3.48%
Tropical PeatlandEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland3.48%
PeatlandEnvironmental → Aquatic → Freshwater → Wetlands → Bog → Peatland2.61%
WatershedsEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds2.61%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil2.61%
Surface SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil2.61%
Switchgrass RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere2.61%
Sediment (Intertidal)Environmental → Aquatic → Sediment → Unclassified → Unclassified → Sediment (Intertidal)1.74%
Arctic Peat SoilEnvironmental → Terrestrial → Soil → Unclassified → Permafrost → Arctic Peat Soil1.74%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Soil1.74%
SoilEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Soil1.74%
Bog Forest SoilEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Bog Forest Soil1.74%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil1.74%
SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Soil1.74%
Corn RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere1.74%
Corn RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere1.74%
WatershedsEnvironmental → Aquatic → Freshwater → Sediment → Unclassified → Watersheds0.87%
BogEnvironmental → Aquatic → Freshwater → Wetlands → Bog → Bog0.87%
Terrestrial SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil0.87%
Agricultural SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil0.87%
Hardwood Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil0.87%
BogEnvironmental → Terrestrial → Soil → Wetlands → Permafrost → Bog0.87%
SoilEnvironmental → Terrestrial → Soil → Wetlands → Permafrost → Soil0.87%
PalsaEnvironmental → Terrestrial → Soil → Wetlands → Permafrost → Palsa0.87%
Forest SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil0.87%
Switchgrass RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Switchgrass Rhizosphere0.87%
Agricultural SoilEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Agricultural Soil0.87%
Termite GutHost-Associated → Arthropoda → Digestive System → Gut → Unclassified → Termite Gut0.87%
Miscanthus RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere0.87%
Populus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere0.87%
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere0.87%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere0.87%
Corn RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere0.87%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere0.87%
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere0.87%
Corn RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere0.87%

Visualization
Powered by ApexCharts



Associated Samples

Taxon OIDSample NameHabitat TypeIMG/M Link
3300000567Peat soil microbial communities from Weissenstadt, Germany - SII-2010EnvironmentalOpen in IMG/M
3300000793Forest soil microbial communities from Amazon forest - 2010 replicate II A001EnvironmentalOpen in IMG/M
3300005330Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaGEnvironmentalOpen in IMG/M
3300005332Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly)EnvironmentalOpen in IMG/M
3300005335Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaGHost-AssociatedOpen in IMG/M
3300005339Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaGHost-AssociatedOpen in IMG/M
3300005435Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaGEnvironmentalOpen in IMG/M
3300005439Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaGEnvironmentalOpen in IMG/M
3300005454Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_136EnvironmentalOpen in IMG/M
3300005467Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaGEnvironmentalOpen in IMG/M
3300005533Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen06_05102014_R1EnvironmentalOpen in IMG/M
3300005542Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen04_05102014_R1EnvironmentalOpen in IMG/M
3300005545Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaGEnvironmentalOpen in IMG/M
3300005591Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF1EnvironmentalOpen in IMG/M
3300005618Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2Host-AssociatedOpen in IMG/M
3300005718Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2Host-AssociatedOpen in IMG/M
3300005836Microbial communities from Youngs Bay mouth sediment, Columbia River estuary, Oregon - S.42_YBBEnvironmentalOpen in IMG/M
3300006028Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaGEnvironmentalOpen in IMG/M
3300006041Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Straight Creek_MetaG_SC_2014EnvironmentalOpen in IMG/M
3300006047Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Straight Creek_MetaG_SC_2013EnvironmentalOpen in IMG/M
3300006162Freshwater sediment microbial communities from Pennsylvania, USA - Little Laurel Run_MetaG_LLR_2012EnvironmentalOpen in IMG/M
3300006175Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaGEnvironmentalOpen in IMG/M
3300006638Arctic peat soil microbial communities from the Barrow Environmental Observatory site, Barrow, Alaska, USA - NGEE PermafrostL2-AEnvironmentalOpen in IMG/M
3300006903Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD5Host-AssociatedOpen in IMG/M
3300006954Agricultural soil microbial communities from Georgia to study Nitrogen management - GA ControlEnvironmentalOpen in IMG/M
3300009093Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaGHost-AssociatedOpen in IMG/M
3300009148Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaGHost-AssociatedOpen in IMG/M
3300009520Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_1_NS metaGEnvironmentalOpen in IMG/M
3300009545Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaGHost-AssociatedOpen in IMG/M
3300009700Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_4_PS metaGEnvironmentalOpen in IMG/M
3300010049Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3Host-AssociatedOpen in IMG/M
3300010159Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3EnvironmentalOpen in IMG/M
3300010339Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - Bog Forest MetaG ECP23OM3EnvironmentalOpen in IMG/M
3300010343Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - Bog Forest MetaG ECP23OM1EnvironmentalOpen in IMG/M
3300010358Tropical forest soil microbial communities from Panama - MetaG Plot_3EnvironmentalOpen in IMG/M
3300010373Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-4EnvironmentalOpen in IMG/M
3300010376Tropical forest soil microbial communities from Panama - MetaG Plot_28EnvironmentalOpen in IMG/M
3300010379Sb_50d combined assemblyEnvironmentalOpen in IMG/M
3300012211Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_40_16 metaGEnvironmentalOpen in IMG/M
3300012917Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czobulk2.16 metaGEnvironmentalOpen in IMG/M
3300012930Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_2_16fungal (Illumina Assembly)EnvironmentalOpen in IMG/M
3300012960Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_231_MGEnvironmentalOpen in IMG/M
3300013104Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaGHost-AssociatedOpen in IMG/M
3300013308Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaGHost-AssociatedOpen in IMG/M
3300014156Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin01_60_metaGEnvironmentalOpen in IMG/M
3300014489Permafrost microbial communities from Stordalen Mire, Sweden - 812P2M metaGEnvironmentalOpen in IMG/M
3300014838Permafrost microbial communities from Stordalen Mire, Sweden - 812S3M metaG (Illumina Assembly)EnvironmentalOpen in IMG/M
3300016294Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.178EnvironmentalOpen in IMG/M
3300016341Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170EnvironmentalOpen in IMG/M
3300016445Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.108EnvironmentalOpen in IMG/M
3300017821Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - ASW-S_2EnvironmentalOpen in IMG/M
3300017822Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - Control_2EnvironmentalOpen in IMG/M
3300017823Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_3EnvironmentalOpen in IMG/M
3300017924Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_5EnvironmentalOpen in IMG/M
3300017928Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - ASW_1EnvironmentalOpen in IMG/M
3300017931Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_17_100EnvironmentalOpen in IMG/M
3300017936Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SourceSoil_1EnvironmentalOpen in IMG/M
3300017943Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_4EnvironmentalOpen in IMG/M
3300017966Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_BV02_MP12_20_MGEnvironmentalOpen in IMG/M
3300017970Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_SJ02_MP02_20_MGEnvironmentalOpen in IMG/M
3300018006Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - Control_4EnvironmentalOpen in IMG/M
3300018012Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - ASW_5EnvironmentalOpen in IMG/M
3300018019Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_16_150EnvironmentalOpen in IMG/M
3300018035Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_17_10EnvironmentalOpen in IMG/M
3300018086Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP02_10_MGEnvironmentalOpen in IMG/M
3300021088Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-28-MEnvironmentalOpen in IMG/M
3300021181Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-19-OEnvironmentalOpen in IMG/M
3300021420Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-12-MEnvironmentalOpen in IMG/M
3300021432Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-MEnvironmentalOpen in IMG/M
3300021474Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-11-OEnvironmentalOpen in IMG/M
3300021861Metatranscriptome of freshwater sediment microbial communities from post-fracked creek in Pennsylvania, United States - ABR_2016 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300025862Arctic peat soil microbial communities from the Barrow Environmental Observatory site, Barrow, Alaska, USA - NGEE PermafrostL2-A (SPAdes)EnvironmentalOpen in IMG/M
3300025900Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025905Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025949Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300026035Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300026078Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300026095Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300026291Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Organic soil replicate 3 DNA2013-049 (SPAdes)EnvironmentalOpen in IMG/M
3300026322Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_136 (SPAdes)EnvironmentalOpen in IMG/M
3300027692Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_Ref_O1 (SPAdes)EnvironmentalOpen in IMG/M
3300027855Warmed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WRM 3 (SPAdes)EnvironmentalOpen in IMG/M
3300027874Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 1 MoBio (SPAdes)EnvironmentalOpen in IMG/M
3300027905Peat soil microbial communities from Weissenstadt, Germany - SII-SIP-2007 (SPAdes)EnvironmentalOpen in IMG/M
3300029910III_Palsa_E2 coassemblyEnvironmentalOpen in IMG/M
3300029951III_Palsa_N1 coassemblyEnvironmentalOpen in IMG/M
3300030617II_Palsa_N2 coassemblyEnvironmentalOpen in IMG/M
3300030737Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - III_Palsa_N1_2EnvironmentalOpen in IMG/M
3300031057Oak Coassembly Site 11 - Champenoux / Amance forestEnvironmentalOpen in IMG/M
3300031231Coassembly Site 11 (all samples) - Champenoux / Amance forestEnvironmentalOpen in IMG/M
3300031234Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Palsa_T0_2EnvironmentalOpen in IMG/M
3300031236Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Palsa_T0_1EnvironmentalOpen in IMG/M
3300031474Fir Coassembly Site 11 - Champenoux / Amance forestEnvironmentalOpen in IMG/M
3300031525Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Palsa_T0_3EnvironmentalOpen in IMG/M
3300031561Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.052b4f26EnvironmentalOpen in IMG/M
3300031681Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f20EnvironmentalOpen in IMG/M
3300031708FICUS49499 Metagenome Czech Republic combined assemblyEnvironmentalOpen in IMG/M
3300031748Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.108b1f22EnvironmentalOpen in IMG/M
3300031753Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM2C_515EnvironmentalOpen in IMG/M
3300031782Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f20EnvironmentalOpen in IMG/M
3300031879Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.172 (v2)EnvironmentalOpen in IMG/M
3300031912Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.080 (v2)EnvironmentalOpen in IMG/M
3300032160Sb_50d combined assembly (MetaSPAdes)EnvironmentalOpen in IMG/M
3300032261Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170 (v2)EnvironmentalOpen in IMG/M
3300032892Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.5EnvironmentalOpen in IMG/M
3300033158Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.1EnvironmentalOpen in IMG/M
3300033412Soil microbial communities from experimental microcosm in Duke University, North Carolina, United States - NCEnvironmentalOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap



 ⦗Top⦘

Family Sequences

Protein ID Sample Taxon ID Habitat Sequence
JGI12270J11330_1002944723300000567Peatlands SoilMAATRKKKAEDRHAREALAQDNLYPRIAALSRRVLRSEKV*
AF_2010_repII_A001DRAFT_1012505423300000793Forest SoilGVSMIDRDRTFHRLMAATRKRKAEDRHAREALAQDNLYPRIAALSRRVLRSEKV*
Ga0070690_10004996523300005330Switchgrass RhizosphereMAATRKKKAEDRHAGEALAQDNLYPRIAALSCRVLRSEKV*
Ga0066388_10205040913300005332Tropical Forest SoilMIDRDRTFHRLMAATRKRKAEDRHAREALAQNNLYPRIAALSRRVLRSEKV*
Ga0070666_1019594223300005335Switchgrass RhizosphereMIDRVRRFHRLMAATRKKKAEDRHAGEALAQDNLYPRIAALSCRVLRSEKV*
Ga0070660_10040336423300005339Corn RhizosphereVSPFDGRHAQRKAEDRHARQALAQDNLYPRIAAISRRVLRSERV*
Ga0070714_10046153613300005435Agricultural SoilHRLMAATRKRKAEDRHAREALAQDNLYPRIAALSRRVLWSEKVTLERE*
Ga0070711_10019427713300005439Corn, Switchgrass And Miscanthus RhizosphereMIDRDRTFHRLMAATRKRNAEDRHAREALAQDNLYPRIAALSRRVLRSEKV*
Ga0066687_1069575423300005454SoilMAATRKRKAEDRHAREALAKDNLYPRIAALSRRVLRSEKV*
Ga0070706_10115320913300005467Corn, Switchgrass And Miscanthus RhizosphereMAATRKRNAEDRHAREALAQDNLYPRIAALSRRLLRSEKV*
Ga0070734_1002397343300005533Surface SoilMAATRNRKAEGHHAREALARDNLYPRIAAPSPRVRRSEKV*
Ga0070734_1008056613300005533Surface SoilMIDRDRTFHRLMAANRKRKAEGHHAREALARDNLYPRIAA
Ga0070732_1020943513300005542Surface SoilGSLGVSMIDRDRTFHRLMAATRKRKAEDRHAREALAQDNLYPRIAALSRRVLRSEKV*
Ga0070695_10046856823300005545Corn, Switchgrass And Miscanthus RhizosphereLGVSMIDRDRTFHRLMAATRKRNAEDRHAREALAQDNLYPRIAALSRRVLRSEKV*
Ga0070761_1028349323300005591SoilMIDRDRTFHRLMAATRKRKAEDRHAREALAQDNLYPRIAALSRRVLRSEKV*
Ga0068864_10043113523300005618Switchgrass RhizosphereMAATRKKKAEDRHAGEALAQDNLYPRIAALSCHVLRSEKV*
Ga0068866_1134369113300005718Miscanthus RhizosphereDRDRRFHRLMAATRKKKAEDRHAREALAQDNLYPGIAALSCRVLRSEKV*
Ga0074470_1140220613300005836Sediment (Intertidal)MIDRDRTFHRLMAATRKKKAEDRHTKEALAQDNLYPRIAALSRRVLRSEKV*
Ga0074470_1155088023300005836Sediment (Intertidal)MAATRKKKAEDRHAKEALAQDNLYPRIAAPSRRVLRSEKV*
Ga0070717_1033580133300006028Corn, Switchgrass And Miscanthus RhizosphereMIDQDRTFHRLMAATRKRKAEDRHAREALAQDNLSPRIAALSRRVLRSEKV*
Ga0075023_10007158323300006041WatershedsMAATRKRKAEDRHAREALAQDNLYPRIAALSRRVLRSEKV*
Ga0075024_10063461623300006047WatershedsKRKAEDRHAREALAQDNLYPRIAALSRRVLRSEKV*
Ga0075030_10024399223300006162WatershedsMAATCKKKAVDRLAREALAQGNLYPRIAAFSRRVLRNEK
Ga0070712_10150215423300006175Corn, Switchgrass And Miscanthus RhizosphereMIDRDRTFHRLMAARRKKKAEDRHAREALAQDNLYPRIAALSRRVLRSEKM*
Ga0075522_1012951723300006638Arctic Peat SoilMIDRDRTFHRLMAATRKGKAEDRHAREALAQDNLYPRIAALSRRVLRSEKV*
Ga0075426_1089648913300006903Populus RhizosphereMAATRKRNAEDRHAREALAQDNLYPRIAALSRRVLRSEKV*
Ga0079219_1235988113300006954Agricultural SoilDRTFHRLMAATRKRNAEDRHAREALAQDNLYPRIAALSRRVLRSEKV*
Ga0105240_1097722923300009093Corn RhizosphereMAATRKRKAEDRHAREALAQDNLYPRIAALSRRVLWSEKVTLERE*
Ga0105243_1130014923300009148Miscanthus RhizosphereMAATRKKKAEDRHAREALAQDNLYPGIAALSCRVLRSEKV*
Ga0116214_108590223300009520Peatlands SoilMIDRDRTFHRLMAATRKRKAEDHRAREALAQDNLYPRIAALSRRVLRSEKV*
Ga0105237_1258778623300009545Corn RhizosphereRLMAATRKRKAEDRHAREALAQDNLYPRIAALSRRVLWSEKVTLERE*
Ga0116217_1027155713300009700Peatlands SoilQEKAEDRHAREALAQDKLYPRIAALSRRVLRSEKV*
Ga0123356_1007413043300010049Termite GutMIDRDRTFYHLMAATRKRKAEDRHAREALAQDNLYPRIAALSRHVLRSEKV*
Ga0099796_1044628813300010159Vadose Zone SoilMAATRKRKAEDRHAGEALAQDNLYPRIAALSRRVLRSEKV*
Ga0074046_1004450123300010339Bog Forest SoilMAATREKKAEDRHAREALAQDNLYPRIAALSLRVLRSEKM*
Ga0074044_1099755613300010343Bog Forest SoilMAATREKKAEDRHAREALAQDNLYPRIAALSRRVLRSEKV*
Ga0126370_1047904923300010358Tropical Forest SoilMTDRDRTFHRLMAATRKRKAEDRHAREALAQDNLYPRIAALSRRVLRSEKV*
Ga0134128_1033910423300010373Terrestrial SoilMAATRKRKAEDRHAGQALAQDNLYPRIAAISRRVLRSERV*
Ga0126381_10223766713300010376Tropical Forest SoilRTFHRLMAATRKRKAVDRHAREALAQDNLYPRIAARSRRVLRSEKV*
Ga0126381_10456252313300010376Tropical Forest SoilMAATRKRKAVDRHAREALAQDNLYPRIAALSRRVLRSEKV*
Ga0136449_10389422123300010379Peatlands SoilMAATRKRKAEDHRAREALAQDNLYPRIAALSRRVLRSEKV*
Ga0137377_1030786313300012211Vadose Zone SoilMAATRKKKAEDRHAREALAQDNLYPHIAALSRRVLRSEKV*
Ga0137395_1068243013300012917Vadose Zone SoilLMAATRKRKAEDVKHREALAQDNLCPRIAALSRRVLRTEKV*
Ga0137407_1075632123300012930Vadose Zone SoilMIDRDRTFHRLMAATRKRKAEDRHAREALAQDNLYPRIAALSRRVPRSEKV*
Ga0164301_1167575813300012960SoilSMIDRDRTFHRLMAATRKRNAEDRHAREALAQDNLYPRIAALSRRVLRSEKV*
Ga0157370_1108020913300013104Corn RhizosphereMAATRKRKAEDRHAGQALAQDNLYPRIAAISRRVLRSEKV*
Ga0157375_1275345613300013308Miscanthus RhizosphereMAARRKKKAEDRHAGEALAQDNLYPRIAALSCRVLRSEKV*
Ga0181518_1025792213300014156BogMAATRKRKAEDRHAREALAQDNLYPRIAALSRRVPRSEKV*
Ga0182018_1001427923300014489PalsaMAATRKKKAEDRHARKALAQDNLYPRIAALSRRVLRSEKV*
Ga0182030_1140173023300014838BogTSVRVADDSPAEREALAQDNLYPCIAALSRRVLRSEKV*
Ga0182041_1139160833300016294SoilMIDRDRTFQRLMAATRKRKAEDRHAREALAEDNLYPRIAALSRRVLRSEKVQSMSPEGSVGSG
Ga0182035_1183619123300016341SoilMIDRDRTFHRLVAATRKKKAEDRHAREALAQDNLYSRIAALSRRVLRSEKV
Ga0182038_1122923613300016445SoilMIDRDRTFHRLMAATRKRKAEDRHAREALAQDNLYPRIAALSRRVLRS
Ga0182038_1172662713300016445SoilMIDRDRTLHRLMAATRKRKAEDRHAREALAQDNLYPRIAALSRRVLRS
Ga0187812_113406623300017821Freshwater SedimentMIDRDRTFHRLMAATRKRKAEDRHAREALAQDNLYPRIAALSRRVLRSEKV
Ga0187802_1007111923300017822Freshwater SedimentMAATRKRKAEDRHAREALAQDNLYPRIAALSRRVLRSEKV
Ga0187818_1012500813300017823Freshwater SedimentMAATRKRKAEDRHAREAPAQDNLYPRIAALSRRVLRSEKV
Ga0187820_130512423300017924Freshwater SedimentLGVSMIDRDRTFHRLMAATRKRKAEDRHAREALAQDNLYPRIAALSRRVLRSEKV
Ga0187806_124037723300017928Freshwater SedimentMIDRDRTFHRLMAATRKREAEDRHAREALAQDNLYPRIAALSRRVLRSEKV
Ga0187877_126455113300017931PeatlandHRLMAATRKRKAEDRHAREALAQDNLYPRIAALSRRVLRSEKV
Ga0187821_1020438313300017936Freshwater SedimentMAATRKRKAEDSHAREALAQDNLYPRIAALSRRVLRSEKV
Ga0187819_1004695713300017943Freshwater SedimentMAATRKRKAEDRHAREALAQNNLYPRIAALNRRVLRSEKV
Ga0187776_1152989813300017966Tropical PeatlandMIDRDRTFHRLMAGTRKKKAEDRHAREALAQDNLYPRIAALSRRVLRSEKV
Ga0187783_1011334543300017970Tropical PeatlandMIDGDRTFHRLMGATRKRKAEDRHAREALAQDNLYPRIAALSRNVLRSEKV
Ga0187783_1033157533300017970Tropical PeatlandMIDRDRTFHRLMAATRKRKAEDRHAREALAQDNLYPRIAALSR
Ga0187804_1023005013300018006Freshwater SedimentMAATRKKKAEDRHAREALAQDNLYPRIAALSRRVLRSEKV
Ga0187810_1003242223300018012Freshwater SedimentMIDRDRTFHRLMAATRKRKAEDRHAREAPAQDNLYPRIAALSRRVLRSEKV
Ga0187874_1003435723300018019PeatlandMIDRDRTFHRLMAATRRRKAEDRHAREALAQDNLYPRIAALSRRVLRSEKV
Ga0187875_1033523023300018035PeatlandSLGVSLIDRDRTFHRLMAATRKRKAEDRHAREALAQDNLYPRIAALSRRVLRSEKV
Ga0187769_1038174623300018086Tropical PeatlandMIDRDRTFHRLMAATRKKKAEDRHAREALAQDNLYPRIAALSRRVLRSEKV
Ga0210404_1048942713300021088SoilMAATRKRKAEDRHAREALAQDNLYLRIAALSRRVLRSEKV
Ga0210388_1007173213300021181SoilMIDRDRTFHRLMAATRKRKAEDRHASEAHAQDNLYPRIAALSRRVPRSE
Ga0210394_1045429113300021420SoilMFHRLMAATRKRKAEDSHARKALAQDNRYPRIAALSRRVLRSEKV
Ga0210394_1145650813300021420SoilMAATRKKKAEDRHAREALAQDNLYPPIAALSRRVLRSEKV
Ga0210384_1030190223300021432SoilMAATRKRKAEDRHAKEVLAQDNLYPRIAALSRRVLRSEKV
Ga0210390_1140078213300021474SoilMIDRDRTFHRLMAAPRKRKAEDRHASEALAQDNLYPRVAALSRRVLRSEKVLSMSPEGSVGSR
Ga0213853_1136379423300021861WatershedsMIDRDRTFHRLMAATRKRKAEDRHAREALAQDNLYPRIAALSRRVLR
Ga0209483_100551523300025862Arctic Peat SoilMIDRDRTFHRLMAATRKGKAEDRHAREALAQDNLYPRIAALSRRVLRSEKV
Ga0207710_1046109523300025900Switchgrass RhizosphereMAATRKKKAEDRHAGEALAQDNLYPRIAALSCRVLRSEKV
Ga0207685_1046978513300025905Corn, Switchgrass And Miscanthus RhizosphereMAATRKRNAEDRHAREALAQDNLYPRIAALSRRVLRSEKV
Ga0207667_1215194813300025949Corn RhizosphereMAATRKRKAEDRHAGQALAQDNLYPRIAAISRRVLRSEKV
Ga0207703_1012538343300026035Switchgrass RhizosphereMIDRVRRFHRLMAATRKKKAEDRHAGEALAQDNLYPRIAALSCRVLRSEKV
Ga0207702_1221073423300026078Corn RhizosphereFHRLMAVTRKRNAEDRHAREALAQDNLYPRIAALSRRVLRSEKV
Ga0207676_1047071523300026095Switchgrass RhizosphereMAATRKKKAEDRHAGEALAQDNLYPRIAALSCHVLRSEKV
Ga0209890_1012288023300026291SoilMAATRKKKAEDRPAREALAQDNLYPRIAALSRRVLRSEKV
Ga0209687_116560133300026322SoilMAATRKRKAEDRHAREALAKDNLYPRIAALSRRVLRSEKV
Ga0209530_111375223300027692Forest SoilDRTFHRLMAAARKRKAEDRHAREALAQDTLYPRIAALSRRVLRSEKV
Ga0209693_1048800513300027855SoilMIDRDRTLHRLMAATRKRKAEDRHAKEALAQDNLYPRIAALSRRVLRSEKV
Ga0209465_1035142113300027874Tropical Forest SoilMIDRDRTLHRLMAATRKRKAEDRHARGALAQDNLYPRIAALSRRVLRSEKV
Ga0209415_1100688013300027905Peatlands SoilMIDRDRTFHRLMAATSKRKAEDRHAKEALAQDNLYPRIAALSRR
Ga0311369_1085152023300029910PalsaMAATRKKKAEDRHARKALAQDNLYPRIAALSRRVLRSEKL
Ga0311371_1157472013300029951PalsaMAATRKKKAEDRHARKALAQDNLYPRIAALSRRVLRSEKV
Ga0311356_1197327923300030617PalsaMAATRKRKAEDRHAGEALAQDNLYPRIAALSRRVLRSE
Ga0302310_1049630423300030737PalsaMIDRDRTFHRLMAATRKRKAEDRHARVALAQDNLYPRIAALSRRVLRSEKV
Ga0170834_10779411523300031057Forest SoilMAATRKRKAEDRHAREALTQDNLYPGIAALSRRVLRSEKV
Ga0170824_10447125713300031231Forest SoilMAATRKRKAENRHAREALAQDNLYPRIAALSRRVLRSEKV
Ga0302325_1285954513300031234PalsaMAATRKRKAEDRHAGEALAQDNLYPRIAALSRLVLRSEKV
Ga0302324_10028456723300031236PalsaMAATRKRKAEDRHARVALAKDNLYPRIAALSRRVLRSEKV
Ga0170818_11330215623300031474Forest SoilATRKRKAEDRHAREALAQDNLYPRIAALSRRVLRSEKV
Ga0302326_1012405153300031525PalsaMIDRDRTFHRLMAATRKRKAEDRHARVALAKDNLYPRIAALSRRVLRSEKV
Ga0318528_1048316613300031561SoilRKKKAEDRHGREALAQDNLYPRIAALSRRVLRSEKV
Ga0318572_1093892613300031681SoilMIDRDRTFHPLMAATRKRKAEDRHAREALAQDNLYPRIAALSRRVLRSEKVQSMSPEGSVGSG
Ga0310686_10291213633300031708SoilMIDRDRTFHRLMAATRKKKAEDRHAREALARDNLYPRIAALSRRVLRSEKV
Ga0310686_11061207253300031708SoilMAATRKRKAEDRHAGEALAQDNLYPRIAALSRRVLRSEKV
Ga0318492_1074273613300031748SoilGVSMIDRDRTFHRLIAATRKRKAEDRHAREALAQDNLYPRIAALSRRVLRSEKV
Ga0307477_1034876113300031753Hardwood Forest SoilMVDRDRTFHRLMAATRKKKAEDRHARKALAQDNLYP
Ga0318552_1023539413300031782SoilKRKAEDRHAREALAQDNLYPRIAALSRRVLRSEKV
Ga0306919_1023607423300031879SoilMIDRDRTFHRLIAATRKRKAEDRHAREALAQDNLYPRIAALSRRVLRSEKV
Ga0306921_1235185713300031912SoilMIDRDRTLHRLMAATRKRKAEDRHAREALAQDNLYPRIAALSR
Ga0311301_10017734213300032160Peatlands SoilMIDRDRTFHRLMAATRKRKAEDHHAREALAQDNLYPRIAALSRRVLRSEKV
Ga0311301_1164557113300032160Peatlands SoilMIDRDRMFHRLMAATRKRKAEDRHAREALAQDNLYPRIAALSRRVVRSERA
Ga0306920_10192277023300032261SoilMIDRDRTFQRLMAATRKRKAEDRHAREALAEDNLYPRIAALSRRVLRSEKV
Ga0335081_1004485033300032892SoilMIDRDRTFHRLMAATRKRKAEDRHVREALAQDNLYPPIAALSRRVLRSEKV
Ga0335077_1006501123300033158SoilMAATRKRKAEDRHVREALAQDNLYPPIAALSRRVLRSEKV
Ga0310810_1012685223300033412SoilMIDRDRTFHRLMAVTRKRNAEDRHAREALAQDNLYPRIAALSRRVLRSEKV


 ⦗Top⦘


© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.