Basic Information | |
---|---|
Family ID | F080296 |
Family Type | Metagenome / Metatranscriptome |
Number of Sequences | 115 |
Average Sequence Length | 45 residues |
Representative Sequence | HRLMAATRKRKAEDRHAREALAQDNLYPRIAALSRRVLRSEKV |
Number of Associated Samples | 107 |
Number of Associated Scaffolds | 115 |
Quality Assessment | |
---|---|
Transcriptomic Evidence | Yes |
Most common taxonomic group | Bacteria |
% of genes with valid RBS motifs | 46.96 % |
% of genes near scaffold ends (potentially truncated) | 31.30 % |
% of genes from short scaffolds (< 2000 bps) | 82.61 % |
Associated GOLD sequencing projects | 100 |
AlphaFold2 3D model prediction | No |
Hidden Markov Model |
---|
Powered by Skylign |
Most Common Taxonomy | |
---|---|
Group | Bacteria (62.609 % of family members) |
NCBI Taxonomy ID | 2 |
Taxonomy | All Organisms → cellular organisms → Bacteria |
Most Common Ecosystem | |
---|---|
GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil (8.696 % of family members) |
Environment Ontology (ENVO) | Unclassified (17.391 % of family members) |
Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (45.217 % of family members) |
⦗Top⦘ |
⦗Top⦘ |
Predicted Topology & Secondary Structure | |||||
---|---|---|---|---|---|
Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 86.05% β-sheet: 0.00% Coil/Unstructured: 13.95% | Feature Viewer |
|
|||||
Powered by Feature Viewer |
⦗Top⦘ |
Pfam ID | Name | % Frequency in 115 Family Scaffolds |
---|---|---|
PF10162 | G8 | 26.09 |
PF13432 | TPR_16 | 6.09 |
PF00589 | Phage_integrase | 2.61 |
PF04255 | DUF433 | 1.74 |
PF13470 | PIN_3 | 0.87 |
PF00881 | Nitroreductase | 0.87 |
PF01402 | RHH_1 | 0.87 |
PF13565 | HTH_32 | 0.87 |
PF14319 | Zn_Tnp_IS91 | 0.87 |
PF01663 | Phosphodiest | 0.87 |
PF03551 | PadR | 0.87 |
PF01979 | Amidohydro_1 | 0.87 |
PF13189 | Cytidylate_kin2 | 0.87 |
PF12867 | DinB_2 | 0.87 |
PF00265 | TK | 0.87 |
PF07638 | Sigma70_ECF | 0.87 |
COG ID | Name | Functional Category | % Frequency in 115 Family Scaffolds |
---|---|---|---|
COG2442 | Predicted antitoxin component of a toxin-antitoxin system, DUF433 family | Defense mechanisms [V] | 1.74 |
COG1435 | Thymidine kinase | Nucleotide transport and metabolism [F] | 0.87 |
COG1595 | DNA-directed RNA polymerase specialized sigma subunit, sigma24 family | Transcription [K] | 0.87 |
COG1695 | DNA-binding transcriptional regulator, PadR family | Transcription [K] | 0.87 |
COG1733 | DNA-binding transcriptional regulator, HxlR family | Transcription [K] | 0.87 |
COG1846 | DNA-binding transcriptional regulator, MarR family | Transcription [K] | 0.87 |
⦗Top⦘ |
Name | Rank | Taxonomy | Distribution |
All Organisms | root | All Organisms | 62.61 % |
Unclassified | root | N/A | 37.39 % |
Visualization |
---|
Powered by ApexCharts |
Scaffold | Taxonomy | Length | IMG/M Link |
---|---|---|---|
3300000567|JGI12270J11330_10029447 | Not Available | 3239 | Open in IMG/M |
3300000793|AF_2010_repII_A001DRAFT_10125054 | Not Available | 537 | Open in IMG/M |
3300005330|Ga0070690_100049965 | All Organisms → cellular organisms → Bacteria | 2667 | Open in IMG/M |
3300005332|Ga0066388_102050409 | Not Available | 1027 | Open in IMG/M |
3300005335|Ga0070666_10195942 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1421 | Open in IMG/M |
3300005339|Ga0070660_100403364 | Not Available | 1131 | Open in IMG/M |
3300005435|Ga0070714_100461536 | All Organisms → cellular organisms → Bacteria | 1207 | Open in IMG/M |
3300005439|Ga0070711_100194277 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1562 | Open in IMG/M |
3300005454|Ga0066687_10695754 | All Organisms → cellular organisms → Bacteria | 604 | Open in IMG/M |
3300005467|Ga0070706_101153209 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 713 | Open in IMG/M |
3300005533|Ga0070734_10023973 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 3965 | Open in IMG/M |
3300005533|Ga0070734_10080566 | All Organisms → cellular organisms → Bacteria | 1925 | Open in IMG/M |
3300005542|Ga0070732_10209435 | All Organisms → cellular organisms → Bacteria | 1166 | Open in IMG/M |
3300005545|Ga0070695_100468568 | All Organisms → cellular organisms → Bacteria | 968 | Open in IMG/M |
3300005591|Ga0070761_10283493 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → unclassified Terriglobia → Acidobacteriia bacterium | 994 | Open in IMG/M |
3300005618|Ga0068864_100431135 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1258 | Open in IMG/M |
3300005718|Ga0068866_11343691 | Not Available | 521 | Open in IMG/M |
3300005836|Ga0074470_11402206 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → Cystobacterineae → Myxococcaceae → Myxococcus → Myxococcus virescens | 913 | Open in IMG/M |
3300005836|Ga0074470_11550880 | All Organisms → cellular organisms → Bacteria | 21295 | Open in IMG/M |
3300006028|Ga0070717_10335801 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → unclassified Terriglobia → Acidobacteriia bacterium | 1348 | Open in IMG/M |
3300006041|Ga0075023_100071583 | All Organisms → cellular organisms → Bacteria | 1139 | Open in IMG/M |
3300006047|Ga0075024_100634616 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → unclassified Terriglobia → Acidobacteriia bacterium | 578 | Open in IMG/M |
3300006162|Ga0075030_100243992 | Not Available | 1440 | Open in IMG/M |
3300006175|Ga0070712_101502154 | Not Available | 589 | Open in IMG/M |
3300006638|Ga0075522_10129517 | All Organisms → cellular organisms → Bacteria | 1333 | Open in IMG/M |
3300006903|Ga0075426_10896489 | Not Available | 669 | Open in IMG/M |
3300006954|Ga0079219_12359881 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → unclassified Terriglobia → Acidobacteriia bacterium | 515 | Open in IMG/M |
3300009093|Ga0105240_10977229 | All Organisms → cellular organisms → Bacteria | 907 | Open in IMG/M |
3300009148|Ga0105243_11300149 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 744 | Open in IMG/M |
3300009520|Ga0116214_1085902 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → unclassified Terriglobia → Acidobacteriia bacterium | 1153 | Open in IMG/M |
3300009545|Ga0105237_12587786 | Not Available | 518 | Open in IMG/M |
3300009700|Ga0116217_10271557 | All Organisms → cellular organisms → Bacteria | 1096 | Open in IMG/M |
3300010049|Ga0123356_10074130 | All Organisms → cellular organisms → Bacteria | 3202 | Open in IMG/M |
3300010159|Ga0099796_10446288 | Not Available | 575 | Open in IMG/M |
3300010339|Ga0074046_10044501 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 2969 | Open in IMG/M |
3300010343|Ga0074044_10997556 | Not Available | 549 | Open in IMG/M |
3300010358|Ga0126370_10479049 | All Organisms → cellular organisms → Bacteria | 1045 | Open in IMG/M |
3300010373|Ga0134128_10339104 | All Organisms → cellular organisms → Bacteria | 1680 | Open in IMG/M |
3300010376|Ga0126381_102237667 | All Organisms → cellular organisms → Bacteria | 786 | Open in IMG/M |
3300010376|Ga0126381_104562523 | Not Available | 534 | Open in IMG/M |
3300010379|Ga0136449_103894221 | Not Available | 560 | Open in IMG/M |
3300012211|Ga0137377_10307863 | All Organisms → cellular organisms → Bacteria | 1519 | Open in IMG/M |
3300012917|Ga0137395_10682430 | All Organisms → cellular organisms → Bacteria | 743 | Open in IMG/M |
3300012930|Ga0137407_10756321 | Not Available | 917 | Open in IMG/M |
3300012960|Ga0164301_11675758 | Not Available | 530 | Open in IMG/M |
3300013104|Ga0157370_11080209 | Not Available | 725 | Open in IMG/M |
3300013308|Ga0157375_12753456 | Not Available | 588 | Open in IMG/M |
3300014156|Ga0181518_10257922 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 883 | Open in IMG/M |
3300014489|Ga0182018_10014279 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 5487 | Open in IMG/M |
3300014838|Ga0182030_11401730 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → unclassified Terriglobia → Acidobacteriia bacterium | 583 | Open in IMG/M |
3300016294|Ga0182041_11391608 | Not Available | 644 | Open in IMG/M |
3300016341|Ga0182035_11836191 | Not Available | 549 | Open in IMG/M |
3300016445|Ga0182038_11229236 | Not Available | 668 | Open in IMG/M |
3300016445|Ga0182038_11726627 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 564 | Open in IMG/M |
3300017821|Ga0187812_1134066 | Not Available | 801 | Open in IMG/M |
3300017822|Ga0187802_10071119 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Candidatus Acidoferrales → Candidatus Acidoferrum → Candidatus Acidoferrum panamensis | 1290 | Open in IMG/M |
3300017823|Ga0187818_10125008 | All Organisms → cellular organisms → Bacteria | 1116 | Open in IMG/M |
3300017924|Ga0187820_1305124 | Not Available | 525 | Open in IMG/M |
3300017928|Ga0187806_1240377 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → unclassified Terriglobia → Acidobacteriia bacterium | 624 | Open in IMG/M |
3300017931|Ga0187877_1264551 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → unclassified Terriglobia → Acidobacteriia bacterium | 661 | Open in IMG/M |
3300017936|Ga0187821_10204383 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 760 | Open in IMG/M |
3300017943|Ga0187819_10046957 | All Organisms → cellular organisms → Bacteria | 2559 | Open in IMG/M |
3300017966|Ga0187776_11529898 | Not Available | 513 | Open in IMG/M |
3300017970|Ga0187783_10113345 | All Organisms → cellular organisms → Bacteria | 1998 | Open in IMG/M |
3300017970|Ga0187783_10331575 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1108 | Open in IMG/M |
3300018006|Ga0187804_10230050 | Not Available | 797 | Open in IMG/M |
3300018012|Ga0187810_10032422 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Candidatus Acidoferrales → Candidatus Acidoferrum → Candidatus Acidoferrum panamensis | 1922 | Open in IMG/M |
3300018019|Ga0187874_10034357 | All Organisms → cellular organisms → Bacteria | 2477 | Open in IMG/M |
3300018035|Ga0187875_10335230 | All Organisms → cellular organisms → Bacteria | 815 | Open in IMG/M |
3300018086|Ga0187769_10381746 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1059 | Open in IMG/M |
3300021088|Ga0210404_10489427 | All Organisms → cellular organisms → Bacteria | 694 | Open in IMG/M |
3300021181|Ga0210388_10071732 | All Organisms → cellular organisms → Bacteria | 2920 | Open in IMG/M |
3300021420|Ga0210394_10454291 | All Organisms → cellular organisms → Bacteria | 1127 | Open in IMG/M |
3300021420|Ga0210394_11456508 | Not Available | 580 | Open in IMG/M |
3300021432|Ga0210384_10301902 | Not Available | 1441 | Open in IMG/M |
3300021474|Ga0210390_11400782 | Not Available | 557 | Open in IMG/M |
3300021861|Ga0213853_11363794 | Not Available | 529 | Open in IMG/M |
3300025862|Ga0209483_1005515 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 7824 | Open in IMG/M |
3300025900|Ga0207710_10461095 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → unclassified Terriglobia → Acidobacteriia bacterium | 657 | Open in IMG/M |
3300025905|Ga0207685_10469785 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 657 | Open in IMG/M |
3300025949|Ga0207667_12151948 | Not Available | 516 | Open in IMG/M |
3300026035|Ga0207703_10125383 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Edaphobacter → Edaphobacter aggregans | 2210 | Open in IMG/M |
3300026078|Ga0207702_12210734 | Not Available | 539 | Open in IMG/M |
3300026095|Ga0207676_10470715 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1188 | Open in IMG/M |
3300026291|Ga0209890_10122880 | All Organisms → cellular organisms → Bacteria | 883 | Open in IMG/M |
3300026322|Ga0209687_1165601 | All Organisms → cellular organisms → Bacteria | 704 | Open in IMG/M |
3300027692|Ga0209530_1113752 | All Organisms → cellular organisms → Bacteria | 766 | Open in IMG/M |
3300027855|Ga0209693_10488005 | Not Available | 590 | Open in IMG/M |
3300027874|Ga0209465_10351421 | Not Available | 738 | Open in IMG/M |
3300027905|Ga0209415_11006880 | Not Available | 553 | Open in IMG/M |
3300029910|Ga0311369_10851520 | Not Available | 733 | Open in IMG/M |
3300029951|Ga0311371_11574720 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → unclassified Terriglobia → Acidobacteriia bacterium | 726 | Open in IMG/M |
3300030617|Ga0311356_11973279 | Not Available | 516 | Open in IMG/M |
3300030737|Ga0302310_10496304 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → unclassified Terriglobia → Acidobacteriia bacterium | 656 | Open in IMG/M |
3300031057|Ga0170834_107794115 | Not Available | 521 | Open in IMG/M |
3300031231|Ga0170824_104471257 | Not Available | 648 | Open in IMG/M |
3300031234|Ga0302325_12859545 | Not Available | 563 | Open in IMG/M |
3300031236|Ga0302324_100284567 | Not Available | 2548 | Open in IMG/M |
3300031474|Ga0170818_113302156 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → unclassified Terriglobia → Acidobacteriia bacterium | 609 | Open in IMG/M |
3300031525|Ga0302326_10124051 | All Organisms → cellular organisms → Bacteria | 4532 | Open in IMG/M |
3300031561|Ga0318528_10483166 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → unclassified Terriglobia → Acidobacteriia bacterium | 665 | Open in IMG/M |
3300031681|Ga0318572_10938926 | Not Available | 514 | Open in IMG/M |
3300031708|Ga0310686_102912136 | Not Available | 3202 | Open in IMG/M |
3300031708|Ga0310686_110612072 | All Organisms → cellular organisms → Bacteria | 4505 | Open in IMG/M |
3300031748|Ga0318492_10742736 | Not Available | 527 | Open in IMG/M |
3300031753|Ga0307477_10348761 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Verrucomicrobiae → Verrucomicrobiales → Verrucomicrobiaceae | 1018 | Open in IMG/M |
3300031782|Ga0318552_10235394 | All Organisms → cellular organisms → Bacteria | 929 | Open in IMG/M |
3300031879|Ga0306919_10236074 | All Organisms → cellular organisms → Bacteria | 1372 | Open in IMG/M |
3300031912|Ga0306921_12351857 | Not Available | 557 | Open in IMG/M |
3300032160|Ga0311301_10017734 | All Organisms → cellular organisms → Bacteria | 20706 | Open in IMG/M |
3300032160|Ga0311301_11645571 | All Organisms → cellular organisms → Bacteria | 777 | Open in IMG/M |
3300032261|Ga0306920_101922770 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 831 | Open in IMG/M |
3300032892|Ga0335081_10044850 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium RIFOXYD12_FULL_57_12 | 6987 | Open in IMG/M |
3300033158|Ga0335077_10065011 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium RIFOXYD12_FULL_57_12 | 4376 | Open in IMG/M |
3300033412|Ga0310810_10126852 | All Organisms → cellular organisms → Bacteria | 3002 | Open in IMG/M |
⦗Top⦘ |
Habitat | Taxonomy | Distribution |
Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 8.70% |
Freshwater Sediment | Environmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment | 7.83% |
Peatlands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil | 6.09% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 6.09% |
Palsa | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Palsa | 6.09% |
Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 5.22% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 3.48% |
Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 3.48% |
Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil | 3.48% |
Tropical Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland | 3.48% |
Peatland | Environmental → Aquatic → Freshwater → Wetlands → Bog → Peatland | 2.61% |
Watersheds | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds | 2.61% |
Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 2.61% |
Surface Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil | 2.61% |
Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 2.61% |
Sediment (Intertidal) | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Sediment (Intertidal) | 1.74% |
Arctic Peat Soil | Environmental → Terrestrial → Soil → Unclassified → Permafrost → Arctic Peat Soil | 1.74% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 1.74% |
Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 1.74% |
Bog Forest Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Bog Forest Soil | 1.74% |
Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 1.74% |
Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Soil | 1.74% |
Corn Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere | 1.74% |
Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 1.74% |
Watersheds | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Watersheds | 0.87% |
Bog | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog | 0.87% |
Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 0.87% |
Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 0.87% |
Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 0.87% |
Bog | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Bog | 0.87% |
Soil | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Soil | 0.87% |
Palsa | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Palsa | 0.87% |
Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 0.87% |
Switchgrass Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Switchgrass Rhizosphere | 0.87% |
Agricultural Soil | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Agricultural Soil | 0.87% |
Termite Gut | Host-Associated → Arthropoda → Digestive System → Gut → Unclassified → Termite Gut | 0.87% |
Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere | 0.87% |
Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 0.87% |
Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 0.87% |
Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 0.87% |
Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 0.87% |
Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 0.87% |
Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere | 0.87% |
Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere | 0.87% |
Visualization |
---|
Powered by ApexCharts |
Taxon OID | Sample Name | Habitat Type | IMG/M Link |
---|---|---|---|
3300000567 | Peat soil microbial communities from Weissenstadt, Germany - SII-2010 | Environmental | Open in IMG/M |
3300000793 | Forest soil microbial communities from Amazon forest - 2010 replicate II A001 | Environmental | Open in IMG/M |
3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Environmental | Open in IMG/M |
3300005332 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly) | Environmental | Open in IMG/M |
3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Host-Associated | Open in IMG/M |
3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Host-Associated | Open in IMG/M |
3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Environmental | Open in IMG/M |
3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Environmental | Open in IMG/M |
3300005454 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_136 | Environmental | Open in IMG/M |
3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Environmental | Open in IMG/M |
3300005533 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen06_05102014_R1 | Environmental | Open in IMG/M |
3300005542 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen04_05102014_R1 | Environmental | Open in IMG/M |
3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Environmental | Open in IMG/M |
3300005591 | Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF1 | Environmental | Open in IMG/M |
3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Host-Associated | Open in IMG/M |
3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Host-Associated | Open in IMG/M |
3300005836 | Microbial communities from Youngs Bay mouth sediment, Columbia River estuary, Oregon - S.42_YBB | Environmental | Open in IMG/M |
3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Environmental | Open in IMG/M |
3300006041 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Straight Creek_MetaG_SC_2014 | Environmental | Open in IMG/M |
3300006047 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Straight Creek_MetaG_SC_2013 | Environmental | Open in IMG/M |
3300006162 | Freshwater sediment microbial communities from Pennsylvania, USA - Little Laurel Run_MetaG_LLR_2012 | Environmental | Open in IMG/M |
3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Environmental | Open in IMG/M |
3300006638 | Arctic peat soil microbial communities from the Barrow Environmental Observatory site, Barrow, Alaska, USA - NGEE PermafrostL2-A | Environmental | Open in IMG/M |
3300006903 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD5 | Host-Associated | Open in IMG/M |
3300006954 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Control | Environmental | Open in IMG/M |
3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Host-Associated | Open in IMG/M |
3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Host-Associated | Open in IMG/M |
3300009520 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_1_NS metaG | Environmental | Open in IMG/M |
3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Host-Associated | Open in IMG/M |
3300009700 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_4_PS metaG | Environmental | Open in IMG/M |
3300010049 | Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 | Host-Associated | Open in IMG/M |
3300010159 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 | Environmental | Open in IMG/M |
3300010339 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - Bog Forest MetaG ECP23OM3 | Environmental | Open in IMG/M |
3300010343 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - Bog Forest MetaG ECP23OM1 | Environmental | Open in IMG/M |
3300010358 | Tropical forest soil microbial communities from Panama - MetaG Plot_3 | Environmental | Open in IMG/M |
3300010373 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-4 | Environmental | Open in IMG/M |
3300010376 | Tropical forest soil microbial communities from Panama - MetaG Plot_28 | Environmental | Open in IMG/M |
3300010379 | Sb_50d combined assembly | Environmental | Open in IMG/M |
3300012211 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_40_16 metaG | Environmental | Open in IMG/M |
3300012917 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czobulk2.16 metaG | Environmental | Open in IMG/M |
3300012930 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_2_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
3300012960 | Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_231_MG | Environmental | Open in IMG/M |
3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Host-Associated | Open in IMG/M |
3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Host-Associated | Open in IMG/M |
3300014156 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin01_60_metaG | Environmental | Open in IMG/M |
3300014489 | Permafrost microbial communities from Stordalen Mire, Sweden - 812P2M metaG | Environmental | Open in IMG/M |
3300014838 | Permafrost microbial communities from Stordalen Mire, Sweden - 812S3M metaG (Illumina Assembly) | Environmental | Open in IMG/M |
3300016294 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.178 | Environmental | Open in IMG/M |
3300016341 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170 | Environmental | Open in IMG/M |
3300016445 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.108 | Environmental | Open in IMG/M |
3300017821 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - ASW-S_2 | Environmental | Open in IMG/M |
3300017822 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - Control_2 | Environmental | Open in IMG/M |
3300017823 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_3 | Environmental | Open in IMG/M |
3300017924 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_5 | Environmental | Open in IMG/M |
3300017928 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - ASW_1 | Environmental | Open in IMG/M |
3300017931 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_17_100 | Environmental | Open in IMG/M |
3300017936 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SourceSoil_1 | Environmental | Open in IMG/M |
3300017943 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_4 | Environmental | Open in IMG/M |
3300017966 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_BV02_MP12_20_MG | Environmental | Open in IMG/M |
3300017970 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_SJ02_MP02_20_MG | Environmental | Open in IMG/M |
3300018006 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - Control_4 | Environmental | Open in IMG/M |
3300018012 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - ASW_5 | Environmental | Open in IMG/M |
3300018019 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_16_150 | Environmental | Open in IMG/M |
3300018035 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_17_10 | Environmental | Open in IMG/M |
3300018086 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP02_10_MG | Environmental | Open in IMG/M |
3300021088 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-28-M | Environmental | Open in IMG/M |
3300021181 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-19-O | Environmental | Open in IMG/M |
3300021420 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-12-M | Environmental | Open in IMG/M |
3300021432 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-M | Environmental | Open in IMG/M |
3300021474 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-11-O | Environmental | Open in IMG/M |
3300021861 | Metatranscriptome of freshwater sediment microbial communities from post-fracked creek in Pennsylvania, United States - ABR_2016 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300025862 | Arctic peat soil microbial communities from the Barrow Environmental Observatory site, Barrow, Alaska, USA - NGEE PermafrostL2-A (SPAdes) | Environmental | Open in IMG/M |
3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) | Environmental | Open in IMG/M |
3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) | Host-Associated | Open in IMG/M |
3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) | Host-Associated | Open in IMG/M |
3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) | Host-Associated | Open in IMG/M |
3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) | Host-Associated | Open in IMG/M |
3300026291 | Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Organic soil replicate 3 DNA2013-049 (SPAdes) | Environmental | Open in IMG/M |
3300026322 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_136 (SPAdes) | Environmental | Open in IMG/M |
3300027692 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_Ref_O1 (SPAdes) | Environmental | Open in IMG/M |
3300027855 | Warmed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WRM 3 (SPAdes) | Environmental | Open in IMG/M |
3300027874 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 1 MoBio (SPAdes) | Environmental | Open in IMG/M |
3300027905 | Peat soil microbial communities from Weissenstadt, Germany - SII-SIP-2007 (SPAdes) | Environmental | Open in IMG/M |
3300029910 | III_Palsa_E2 coassembly | Environmental | Open in IMG/M |
3300029951 | III_Palsa_N1 coassembly | Environmental | Open in IMG/M |
3300030617 | II_Palsa_N2 coassembly | Environmental | Open in IMG/M |
3300030737 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - III_Palsa_N1_2 | Environmental | Open in IMG/M |
3300031057 | Oak Coassembly Site 11 - Champenoux / Amance forest | Environmental | Open in IMG/M |
3300031231 | Coassembly Site 11 (all samples) - Champenoux / Amance forest | Environmental | Open in IMG/M |
3300031234 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Palsa_T0_2 | Environmental | Open in IMG/M |
3300031236 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Palsa_T0_1 | Environmental | Open in IMG/M |
3300031474 | Fir Coassembly Site 11 - Champenoux / Amance forest | Environmental | Open in IMG/M |
3300031525 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Palsa_T0_3 | Environmental | Open in IMG/M |
3300031561 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.052b4f26 | Environmental | Open in IMG/M |
3300031681 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f20 | Environmental | Open in IMG/M |
3300031708 | FICUS49499 Metagenome Czech Republic combined assembly | Environmental | Open in IMG/M |
3300031748 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.108b1f22 | Environmental | Open in IMG/M |
3300031753 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM2C_515 | Environmental | Open in IMG/M |
3300031782 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f20 | Environmental | Open in IMG/M |
3300031879 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.172 (v2) | Environmental | Open in IMG/M |
3300031912 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.080 (v2) | Environmental | Open in IMG/M |
3300032160 | Sb_50d combined assembly (MetaSPAdes) | Environmental | Open in IMG/M |
3300032261 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170 (v2) | Environmental | Open in IMG/M |
3300032892 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.5 | Environmental | Open in IMG/M |
3300033158 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.1 | Environmental | Open in IMG/M |
3300033412 | Soil microbial communities from experimental microcosm in Duke University, North Carolina, United States - NC | Environmental | Open in IMG/M |
Geographical Distribution | |
---|---|
Zoom: | Powered by OpenStreetMap |
⦗Top⦘ |
Protein ID | Sample Taxon ID | Habitat | Sequence |
JGI12270J11330_100294472 | 3300000567 | Peatlands Soil | MAATRKKKAEDRHAREALAQDNLYPRIAALSRRVLRSEKV* |
AF_2010_repII_A001DRAFT_101250542 | 3300000793 | Forest Soil | GVSMIDRDRTFHRLMAATRKRKAEDRHAREALAQDNLYPRIAALSRRVLRSEKV* |
Ga0070690_1000499652 | 3300005330 | Switchgrass Rhizosphere | MAATRKKKAEDRHAGEALAQDNLYPRIAALSCRVLRSEKV* |
Ga0066388_1020504091 | 3300005332 | Tropical Forest Soil | MIDRDRTFHRLMAATRKRKAEDRHAREALAQNNLYPRIAALSRRVLRSEKV* |
Ga0070666_101959422 | 3300005335 | Switchgrass Rhizosphere | MIDRVRRFHRLMAATRKKKAEDRHAGEALAQDNLYPRIAALSCRVLRSEKV* |
Ga0070660_1004033642 | 3300005339 | Corn Rhizosphere | VSPFDGRHAQRKAEDRHARQALAQDNLYPRIAAISRRVLRSERV* |
Ga0070714_1004615361 | 3300005435 | Agricultural Soil | HRLMAATRKRKAEDRHAREALAQDNLYPRIAALSRRVLWSEKVTLERE* |
Ga0070711_1001942771 | 3300005439 | Corn, Switchgrass And Miscanthus Rhizosphere | MIDRDRTFHRLMAATRKRNAEDRHAREALAQDNLYPRIAALSRRVLRSEKV* |
Ga0066687_106957542 | 3300005454 | Soil | MAATRKRKAEDRHAREALAKDNLYPRIAALSRRVLRSEKV* |
Ga0070706_1011532091 | 3300005467 | Corn, Switchgrass And Miscanthus Rhizosphere | MAATRKRNAEDRHAREALAQDNLYPRIAALSRRLLRSEKV* |
Ga0070734_100239734 | 3300005533 | Surface Soil | MAATRNRKAEGHHAREALARDNLYPRIAAPSPRVRRSEKV* |
Ga0070734_100805661 | 3300005533 | Surface Soil | MIDRDRTFHRLMAANRKRKAEGHHAREALARDNLYPRIAA |
Ga0070732_102094351 | 3300005542 | Surface Soil | GSLGVSMIDRDRTFHRLMAATRKRKAEDRHAREALAQDNLYPRIAALSRRVLRSEKV* |
Ga0070695_1004685682 | 3300005545 | Corn, Switchgrass And Miscanthus Rhizosphere | LGVSMIDRDRTFHRLMAATRKRNAEDRHAREALAQDNLYPRIAALSRRVLRSEKV* |
Ga0070761_102834932 | 3300005591 | Soil | MIDRDRTFHRLMAATRKRKAEDRHAREALAQDNLYPRIAALSRRVLRSEKV* |
Ga0068864_1004311352 | 3300005618 | Switchgrass Rhizosphere | MAATRKKKAEDRHAGEALAQDNLYPRIAALSCHVLRSEKV* |
Ga0068866_113436911 | 3300005718 | Miscanthus Rhizosphere | DRDRRFHRLMAATRKKKAEDRHAREALAQDNLYPGIAALSCRVLRSEKV* |
Ga0074470_114022061 | 3300005836 | Sediment (Intertidal) | MIDRDRTFHRLMAATRKKKAEDRHTKEALAQDNLYPRIAALSRRVLRSEKV* |
Ga0074470_115508802 | 3300005836 | Sediment (Intertidal) | MAATRKKKAEDRHAKEALAQDNLYPRIAAPSRRVLRSEKV* |
Ga0070717_103358013 | 3300006028 | Corn, Switchgrass And Miscanthus Rhizosphere | MIDQDRTFHRLMAATRKRKAEDRHAREALAQDNLSPRIAALSRRVLRSEKV* |
Ga0075023_1000715832 | 3300006041 | Watersheds | MAATRKRKAEDRHAREALAQDNLYPRIAALSRRVLRSEKV* |
Ga0075024_1006346162 | 3300006047 | Watersheds | KRKAEDRHAREALAQDNLYPRIAALSRRVLRSEKV* |
Ga0075030_1002439922 | 3300006162 | Watersheds | MAATCKKKAVDRLAREALAQGNLYPRIAAFSRRVLRNEK |
Ga0070712_1015021542 | 3300006175 | Corn, Switchgrass And Miscanthus Rhizosphere | MIDRDRTFHRLMAARRKKKAEDRHAREALAQDNLYPRIAALSRRVLRSEKM* |
Ga0075522_101295172 | 3300006638 | Arctic Peat Soil | MIDRDRTFHRLMAATRKGKAEDRHAREALAQDNLYPRIAALSRRVLRSEKV* |
Ga0075426_108964891 | 3300006903 | Populus Rhizosphere | MAATRKRNAEDRHAREALAQDNLYPRIAALSRRVLRSEKV* |
Ga0079219_123598811 | 3300006954 | Agricultural Soil | DRTFHRLMAATRKRNAEDRHAREALAQDNLYPRIAALSRRVLRSEKV* |
Ga0105240_109772292 | 3300009093 | Corn Rhizosphere | MAATRKRKAEDRHAREALAQDNLYPRIAALSRRVLWSEKVTLERE* |
Ga0105243_113001492 | 3300009148 | Miscanthus Rhizosphere | MAATRKKKAEDRHAREALAQDNLYPGIAALSCRVLRSEKV* |
Ga0116214_10859022 | 3300009520 | Peatlands Soil | MIDRDRTFHRLMAATRKRKAEDHRAREALAQDNLYPRIAALSRRVLRSEKV* |
Ga0105237_125877862 | 3300009545 | Corn Rhizosphere | RLMAATRKRKAEDRHAREALAQDNLYPRIAALSRRVLWSEKVTLERE* |
Ga0116217_102715571 | 3300009700 | Peatlands Soil | QEKAEDRHAREALAQDKLYPRIAALSRRVLRSEKV* |
Ga0123356_100741304 | 3300010049 | Termite Gut | MIDRDRTFYHLMAATRKRKAEDRHAREALAQDNLYPRIAALSRHVLRSEKV* |
Ga0099796_104462881 | 3300010159 | Vadose Zone Soil | MAATRKRKAEDRHAGEALAQDNLYPRIAALSRRVLRSEKV* |
Ga0074046_100445012 | 3300010339 | Bog Forest Soil | MAATREKKAEDRHAREALAQDNLYPRIAALSLRVLRSEKM* |
Ga0074044_109975561 | 3300010343 | Bog Forest Soil | MAATREKKAEDRHAREALAQDNLYPRIAALSRRVLRSEKV* |
Ga0126370_104790492 | 3300010358 | Tropical Forest Soil | MTDRDRTFHRLMAATRKRKAEDRHAREALAQDNLYPRIAALSRRVLRSEKV* |
Ga0134128_103391042 | 3300010373 | Terrestrial Soil | MAATRKRKAEDRHAGQALAQDNLYPRIAAISRRVLRSERV* |
Ga0126381_1022376671 | 3300010376 | Tropical Forest Soil | RTFHRLMAATRKRKAVDRHAREALAQDNLYPRIAARSRRVLRSEKV* |
Ga0126381_1045625231 | 3300010376 | Tropical Forest Soil | MAATRKRKAVDRHAREALAQDNLYPRIAALSRRVLRSEKV* |
Ga0136449_1038942212 | 3300010379 | Peatlands Soil | MAATRKRKAEDHRAREALAQDNLYPRIAALSRRVLRSEKV* |
Ga0137377_103078631 | 3300012211 | Vadose Zone Soil | MAATRKKKAEDRHAREALAQDNLYPHIAALSRRVLRSEKV* |
Ga0137395_106824301 | 3300012917 | Vadose Zone Soil | LMAATRKRKAEDVKHREALAQDNLCPRIAALSRRVLRTEKV* |
Ga0137407_107563212 | 3300012930 | Vadose Zone Soil | MIDRDRTFHRLMAATRKRKAEDRHAREALAQDNLYPRIAALSRRVPRSEKV* |
Ga0164301_116757581 | 3300012960 | Soil | SMIDRDRTFHRLMAATRKRNAEDRHAREALAQDNLYPRIAALSRRVLRSEKV* |
Ga0157370_110802091 | 3300013104 | Corn Rhizosphere | MAATRKRKAEDRHAGQALAQDNLYPRIAAISRRVLRSEKV* |
Ga0157375_127534561 | 3300013308 | Miscanthus Rhizosphere | MAARRKKKAEDRHAGEALAQDNLYPRIAALSCRVLRSEKV* |
Ga0181518_102579221 | 3300014156 | Bog | MAATRKRKAEDRHAREALAQDNLYPRIAALSRRVPRSEKV* |
Ga0182018_100142792 | 3300014489 | Palsa | MAATRKKKAEDRHARKALAQDNLYPRIAALSRRVLRSEKV* |
Ga0182030_114017302 | 3300014838 | Bog | TSVRVADDSPAEREALAQDNLYPCIAALSRRVLRSEKV* |
Ga0182041_113916083 | 3300016294 | Soil | MIDRDRTFQRLMAATRKRKAEDRHAREALAEDNLYPRIAALSRRVLRSEKVQSMSPEGSVGSG |
Ga0182035_118361912 | 3300016341 | Soil | MIDRDRTFHRLVAATRKKKAEDRHAREALAQDNLYSRIAALSRRVLRSEKV |
Ga0182038_112292361 | 3300016445 | Soil | MIDRDRTFHRLMAATRKRKAEDRHAREALAQDNLYPRIAALSRRVLRS |
Ga0182038_117266271 | 3300016445 | Soil | MIDRDRTLHRLMAATRKRKAEDRHAREALAQDNLYPRIAALSRRVLRS |
Ga0187812_11340662 | 3300017821 | Freshwater Sediment | MIDRDRTFHRLMAATRKRKAEDRHAREALAQDNLYPRIAALSRRVLRSEKV |
Ga0187802_100711192 | 3300017822 | Freshwater Sediment | MAATRKRKAEDRHAREALAQDNLYPRIAALSRRVLRSEKV |
Ga0187818_101250081 | 3300017823 | Freshwater Sediment | MAATRKRKAEDRHAREAPAQDNLYPRIAALSRRVLRSEKV |
Ga0187820_13051242 | 3300017924 | Freshwater Sediment | LGVSMIDRDRTFHRLMAATRKRKAEDRHAREALAQDNLYPRIAALSRRVLRSEKV |
Ga0187806_12403772 | 3300017928 | Freshwater Sediment | MIDRDRTFHRLMAATRKREAEDRHAREALAQDNLYPRIAALSRRVLRSEKV |
Ga0187877_12645511 | 3300017931 | Peatland | HRLMAATRKRKAEDRHAREALAQDNLYPRIAALSRRVLRSEKV |
Ga0187821_102043831 | 3300017936 | Freshwater Sediment | MAATRKRKAEDSHAREALAQDNLYPRIAALSRRVLRSEKV |
Ga0187819_100469571 | 3300017943 | Freshwater Sediment | MAATRKRKAEDRHAREALAQNNLYPRIAALNRRVLRSEKV |
Ga0187776_115298981 | 3300017966 | Tropical Peatland | MIDRDRTFHRLMAGTRKKKAEDRHAREALAQDNLYPRIAALSRRVLRSEKV |
Ga0187783_101133454 | 3300017970 | Tropical Peatland | MIDGDRTFHRLMGATRKRKAEDRHAREALAQDNLYPRIAALSRNVLRSEKV |
Ga0187783_103315753 | 3300017970 | Tropical Peatland | MIDRDRTFHRLMAATRKRKAEDRHAREALAQDNLYPRIAALSR |
Ga0187804_102300501 | 3300018006 | Freshwater Sediment | MAATRKKKAEDRHAREALAQDNLYPRIAALSRRVLRSEKV |
Ga0187810_100324222 | 3300018012 | Freshwater Sediment | MIDRDRTFHRLMAATRKRKAEDRHAREAPAQDNLYPRIAALSRRVLRSEKV |
Ga0187874_100343572 | 3300018019 | Peatland | MIDRDRTFHRLMAATRRRKAEDRHAREALAQDNLYPRIAALSRRVLRSEKV |
Ga0187875_103352302 | 3300018035 | Peatland | SLGVSLIDRDRTFHRLMAATRKRKAEDRHAREALAQDNLYPRIAALSRRVLRSEKV |
Ga0187769_103817462 | 3300018086 | Tropical Peatland | MIDRDRTFHRLMAATRKKKAEDRHAREALAQDNLYPRIAALSRRVLRSEKV |
Ga0210404_104894271 | 3300021088 | Soil | MAATRKRKAEDRHAREALAQDNLYLRIAALSRRVLRSEKV |
Ga0210388_100717321 | 3300021181 | Soil | MIDRDRTFHRLMAATRKRKAEDRHASEAHAQDNLYPRIAALSRRVPRSE |
Ga0210394_104542911 | 3300021420 | Soil | MFHRLMAATRKRKAEDSHARKALAQDNRYPRIAALSRRVLRSEKV |
Ga0210394_114565081 | 3300021420 | Soil | MAATRKKKAEDRHAREALAQDNLYPPIAALSRRVLRSEKV |
Ga0210384_103019022 | 3300021432 | Soil | MAATRKRKAEDRHAKEVLAQDNLYPRIAALSRRVLRSEKV |
Ga0210390_114007821 | 3300021474 | Soil | MIDRDRTFHRLMAAPRKRKAEDRHASEALAQDNLYPRVAALSRRVLRSEKVLSMSPEGSVGSR |
Ga0213853_113637942 | 3300021861 | Watersheds | MIDRDRTFHRLMAATRKRKAEDRHAREALAQDNLYPRIAALSRRVLR |
Ga0209483_10055152 | 3300025862 | Arctic Peat Soil | MIDRDRTFHRLMAATRKGKAEDRHAREALAQDNLYPRIAALSRRVLRSEKV |
Ga0207710_104610952 | 3300025900 | Switchgrass Rhizosphere | MAATRKKKAEDRHAGEALAQDNLYPRIAALSCRVLRSEKV |
Ga0207685_104697851 | 3300025905 | Corn, Switchgrass And Miscanthus Rhizosphere | MAATRKRNAEDRHAREALAQDNLYPRIAALSRRVLRSEKV |
Ga0207667_121519481 | 3300025949 | Corn Rhizosphere | MAATRKRKAEDRHAGQALAQDNLYPRIAAISRRVLRSEKV |
Ga0207703_101253834 | 3300026035 | Switchgrass Rhizosphere | MIDRVRRFHRLMAATRKKKAEDRHAGEALAQDNLYPRIAALSCRVLRSEKV |
Ga0207702_122107342 | 3300026078 | Corn Rhizosphere | FHRLMAVTRKRNAEDRHAREALAQDNLYPRIAALSRRVLRSEKV |
Ga0207676_104707152 | 3300026095 | Switchgrass Rhizosphere | MAATRKKKAEDRHAGEALAQDNLYPRIAALSCHVLRSEKV |
Ga0209890_101228802 | 3300026291 | Soil | MAATRKKKAEDRPAREALAQDNLYPRIAALSRRVLRSEKV |
Ga0209687_11656013 | 3300026322 | Soil | MAATRKRKAEDRHAREALAKDNLYPRIAALSRRVLRSEKV |
Ga0209530_11137522 | 3300027692 | Forest Soil | DRTFHRLMAAARKRKAEDRHAREALAQDTLYPRIAALSRRVLRSEKV |
Ga0209693_104880051 | 3300027855 | Soil | MIDRDRTLHRLMAATRKRKAEDRHAKEALAQDNLYPRIAALSRRVLRSEKV |
Ga0209465_103514211 | 3300027874 | Tropical Forest Soil | MIDRDRTLHRLMAATRKRKAEDRHARGALAQDNLYPRIAALSRRVLRSEKV |
Ga0209415_110068801 | 3300027905 | Peatlands Soil | MIDRDRTFHRLMAATSKRKAEDRHAKEALAQDNLYPRIAALSRR |
Ga0311369_108515202 | 3300029910 | Palsa | MAATRKKKAEDRHARKALAQDNLYPRIAALSRRVLRSEKL |
Ga0311371_115747201 | 3300029951 | Palsa | MAATRKKKAEDRHARKALAQDNLYPRIAALSRRVLRSEKV |
Ga0311356_119732792 | 3300030617 | Palsa | MAATRKRKAEDRHAGEALAQDNLYPRIAALSRRVLRSE |
Ga0302310_104963042 | 3300030737 | Palsa | MIDRDRTFHRLMAATRKRKAEDRHARVALAQDNLYPRIAALSRRVLRSEKV |
Ga0170834_1077941152 | 3300031057 | Forest Soil | MAATRKRKAEDRHAREALTQDNLYPGIAALSRRVLRSEKV |
Ga0170824_1044712571 | 3300031231 | Forest Soil | MAATRKRKAENRHAREALAQDNLYPRIAALSRRVLRSEKV |
Ga0302325_128595451 | 3300031234 | Palsa | MAATRKRKAEDRHAGEALAQDNLYPRIAALSRLVLRSEKV |
Ga0302324_1002845672 | 3300031236 | Palsa | MAATRKRKAEDRHARVALAKDNLYPRIAALSRRVLRSEKV |
Ga0170818_1133021562 | 3300031474 | Forest Soil | ATRKRKAEDRHAREALAQDNLYPRIAALSRRVLRSEKV |
Ga0302326_101240515 | 3300031525 | Palsa | MIDRDRTFHRLMAATRKRKAEDRHARVALAKDNLYPRIAALSRRVLRSEKV |
Ga0318528_104831661 | 3300031561 | Soil | RKKKAEDRHGREALAQDNLYPRIAALSRRVLRSEKV |
Ga0318572_109389261 | 3300031681 | Soil | MIDRDRTFHPLMAATRKRKAEDRHAREALAQDNLYPRIAALSRRVLRSEKVQSMSPEGSVGSG |
Ga0310686_1029121363 | 3300031708 | Soil | MIDRDRTFHRLMAATRKKKAEDRHAREALARDNLYPRIAALSRRVLRSEKV |
Ga0310686_1106120725 | 3300031708 | Soil | MAATRKRKAEDRHAGEALAQDNLYPRIAALSRRVLRSEKV |
Ga0318492_107427361 | 3300031748 | Soil | GVSMIDRDRTFHRLIAATRKRKAEDRHAREALAQDNLYPRIAALSRRVLRSEKV |
Ga0307477_103487611 | 3300031753 | Hardwood Forest Soil | MVDRDRTFHRLMAATRKKKAEDRHARKALAQDNLYP |
Ga0318552_102353941 | 3300031782 | Soil | KRKAEDRHAREALAQDNLYPRIAALSRRVLRSEKV |
Ga0306919_102360742 | 3300031879 | Soil | MIDRDRTFHRLIAATRKRKAEDRHAREALAQDNLYPRIAALSRRVLRSEKV |
Ga0306921_123518571 | 3300031912 | Soil | MIDRDRTLHRLMAATRKRKAEDRHAREALAQDNLYPRIAALSR |
Ga0311301_1001773421 | 3300032160 | Peatlands Soil | MIDRDRTFHRLMAATRKRKAEDHHAREALAQDNLYPRIAALSRRVLRSEKV |
Ga0311301_116455711 | 3300032160 | Peatlands Soil | MIDRDRMFHRLMAATRKRKAEDRHAREALAQDNLYPRIAALSRRVVRSERA |
Ga0306920_1019227702 | 3300032261 | Soil | MIDRDRTFQRLMAATRKRKAEDRHAREALAEDNLYPRIAALSRRVLRSEKV |
Ga0335081_100448503 | 3300032892 | Soil | MIDRDRTFHRLMAATRKRKAEDRHVREALAQDNLYPPIAALSRRVLRSEKV |
Ga0335077_100650112 | 3300033158 | Soil | MAATRKRKAEDRHVREALAQDNLYPPIAALSRRVLRSEKV |
Ga0310810_101268522 | 3300033412 | Soil | MIDRDRTFHRLMAVTRKRNAEDRHAREALAQDNLYPRIAALSRRVLRSEKV |
⦗Top⦘ |